BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12646

Length=1230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611117.1|  PREDICTED: probable galacturonosyltransferas...    192   7e-63   Nicotiana tomentosiformis
gb|EYU19206.1|  hypothetical protein MIMGU_mgv1a004325mg                192   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_011097926.1|  PREDICTED: probable galacturonosyltransferas...    194   6e-62   Sesamum indicum [beniseed]
ref|XP_009794961.1|  PREDICTED: probable galacturonosyltransferas...    188   7e-62   Nicotiana sylvestris
ref|XP_004244158.1|  PREDICTED: probable galacturonosyltransferas...    187   1e-61   Solanum lycopersicum
ref|XP_009597423.1|  PREDICTED: probable galacturonosyltransferas...    190   1e-61   Nicotiana tomentosiformis
ref|XP_006360097.1|  PREDICTED: probable galacturonosyltransferas...    181   7e-61   Solanum tuberosum [potatoes]
emb|CDP05804.1|  unnamed protein product                                190   9e-61   Coffea canephora [robusta coffee]
ref|XP_009792847.1|  PREDICTED: probable galacturonosyltransferas...    187   1e-60   Nicotiana sylvestris
ref|XP_011095315.1|  PREDICTED: probable galacturonosyltransferas...    191   3e-60   
ref|XP_006352487.1|  PREDICTED: probable galacturonosyltransferas...    185   2e-59   Solanum tuberosum [potatoes]
ref|XP_004248332.1|  PREDICTED: probable galacturonosyltransferas...    184   8e-59   
ref|XP_002282637.2|  PREDICTED: probable galacturonosyltransferas...    166   3e-55   Vitis vinifera
ref|XP_006452149.1|  hypothetical protein CICLE_v10007975mg             165   5e-55   
ref|XP_007213904.1|  hypothetical protein PRUPE_ppa004043mg             166   7e-55   Prunus persica
gb|KDO46374.1|  hypothetical protein CISIN_1g007529mg                   164   8e-55   Citrus sinensis [apfelsine]
ref|XP_006452150.1|  hypothetical protein CICLE_v10007975mg             164   8e-55   
ref|XP_008244342.1|  PREDICTED: probable galacturonosyltransferas...    166   1e-54   Prunus mume [ume]
ref|XP_006452151.1|  hypothetical protein CICLE_v10007975mg             164   1e-54   
ref|XP_002522830.1|  conserved hypothetical protein                     161   6e-53   
ref|XP_008365716.1|  PREDICTED: probable galacturonosyltransferas...    157   7e-53   
ref|XP_008349951.1|  PREDICTED: probable galacturonosyltransferas...    157   1e-52   
ref|XP_008386024.1|  PREDICTED: probable galacturonosyltransferas...    156   1e-52   
ref|XP_011650537.1|  PREDICTED: probable galacturonosyltransferas...    158   2e-52   Cucumis sativus [cucumbers]
ref|XP_009358091.1|  PREDICTED: probable galacturonosyltransferas...    156   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_003540419.1|  PREDICTED: probable galacturonosyltransferas...    157   7e-52   Glycine max [soybeans]
ref|XP_004294339.1|  PREDICTED: probable galacturonosyltransferas...    160   7e-52   Fragaria vesca subsp. vesca
ref|XP_007149694.1|  hypothetical protein PHAVU_005G091200g             157   1e-51   Phaseolus vulgaris [French bean]
ref|XP_010060438.1|  PREDICTED: probable galacturonosyltransferas...    158   1e-51   Eucalyptus grandis [rose gum]
ref|XP_008463444.1|  PREDICTED: probable galacturonosyltransferas...    154   2e-51   Cucumis melo [Oriental melon]
ref|XP_010694261.1|  PREDICTED: probable galacturonosyltransferas...    157   5e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG21333.1|  putative galacturonosyltransferase 12 -like protein     162   5e-51   Gossypium arboreum [tree cotton]
ref|XP_009355580.1|  PREDICTED: probable galacturonosyltransferas...    155   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_004505434.1|  PREDICTED: probable galacturonosyltransferas...    159   7e-51   Cicer arietinum [garbanzo]
ref|XP_011048284.1|  PREDICTED: probable galacturonosyltransferas...    157   1e-50   Populus euphratica
ref|XP_012070727.1|  PREDICTED: probable galacturonosyltransferas...    154   1e-50   Jatropha curcas
ref|XP_006370613.1|  hypothetical protein POPTR_0001s44250g             157   1e-50   Populus trichocarpa [western balsam poplar]
gb|AFK39430.1|  unknown                                                 151   1e-50   Medicago truncatula
ref|XP_003596615.1|  Glycosyltransferase CAZy family GT8                151   2e-50   Medicago truncatula
ref|XP_008775923.1|  PREDICTED: probable galacturonosyltransferas...    156   3e-49   Phoenix dactylifera
gb|ACJ85767.1|  unknown                                                 146   3e-49   Medicago truncatula
emb|CAN78125.1|  hypothetical protein VITISV_028754                     166   3e-49   Vitis vinifera
ref|XP_004487615.1|  PREDICTED: probable galacturonosyltransferas...    150   7e-49   Cicer arietinum [garbanzo]
gb|KJB81833.1|  hypothetical protein B456_013G164000                    152   2e-48   Gossypium raimondii
ref|XP_008800493.1|  PREDICTED: probable galacturonosyltransferas...    149   2e-48   Phoenix dactylifera
gb|KHG10223.1|  putative galacturonosyltransferase 12 -like protein     152   2e-48   Gossypium arboreum [tree cotton]
ref|XP_010908149.1|  PREDICTED: probable galacturonosyltransferas...    150   2e-48   Elaeis guineensis
gb|KJB81832.1|  hypothetical protein B456_013G164000                    152   2e-48   Gossypium raimondii
ref|XP_008775922.1|  PREDICTED: probable galacturonosyltransferas...    152   7e-48   Phoenix dactylifera
ref|XP_002317564.1|  hypothetical protein POPTR_0011s13600g             147   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011030886.1|  PREDICTED: probable galacturonosyltransferas...    148   7e-47   Populus euphratica
ref|XP_006401545.1|  hypothetical protein EUTSA_v10013202mg             152   6e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010931276.1|  PREDICTED: probable galacturonosyltransferas...    144   7e-46   Elaeis guineensis
gb|EYU33598.1|  hypothetical protein MIMGU_mgv1a004326mg                172   2e-44   Erythranthe guttata [common monkey flower]
gb|KJB13572.1|  hypothetical protein B456_002G082100                    164   1e-42   Gossypium raimondii
ref|XP_007021085.1|  Glycosyltransferase, CAZy family GT8               167   2e-42   
gb|KDO46375.1|  hypothetical protein CISIN_1g007529mg                   164   1e-41   Citrus sinensis [apfelsine]
gb|KJB13573.1|  hypothetical protein B456_002G082100                    163   1e-41   Gossypium raimondii
ref|XP_010092313.1|  putative galacturonosyltransferase 12              163   5e-41   Morus notabilis
gb|KJB13571.1|  hypothetical protein B456_002G082100                    162   7e-41   Gossypium raimondii
ref|XP_004505435.1|  PREDICTED: probable galacturonosyltransferas...    159   4e-40   
gb|KCW67211.1|  hypothetical protein EUGRSUZ_F00995                     158   1e-39   Eucalyptus grandis [rose gum]
gb|EPS70108.1|  hypothetical protein M569_04651                         158   2e-39   Genlisea aurea
gb|ABP65660.1|  secondary wall-associated glycosyltransferase fam...    158   2e-39   Populus tremula x Populus alba [gray poplar]
ref|XP_010475659.1|  PREDICTED: probable galacturonosyltransferas...    149   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_007132980.1|  hypothetical protein PHAVU_011G141200g             155   3e-38   Phaseolus vulgaris [French bean]
ref|XP_010539273.1|  PREDICTED: probable galacturonosyltransferas...    154   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_003543290.1|  PREDICTED: probable galacturonosyltransferas...    154   6e-38   Glycine max [soybeans]
emb|CDY41005.1|  BnaA02g27950D                                          154   6e-38   Brassica napus [oilseed rape]
gb|KFK27082.1|  hypothetical protein AALP_AA8G331600                    152   2e-37   Arabis alpina [alpine rockcress]
emb|CDY28757.1|  BnaA02g09490D                                          152   2e-37   Brassica napus [oilseed rape]
ref|XP_002866055.1|  GAUT12/IRX8/LGT6                                   151   5e-37   Arabidopsis lyrata subsp. lyrata
ref|NP_200280.1|  probable galacturonosyltransferase 12                 151   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540035.1|  PREDICTED: probable galacturonosyltransferas...    151   8e-37   Glycine max [soybeans]
ref|XP_006281668.1|  hypothetical protein CARUB_v10027804mg             150   9e-37   Capsella rubella
ref|XP_006582240.1|  PREDICTED: probable galacturonosyltransferas...    150   9e-37   Glycine max [soybeans]
ref|XP_009127073.1|  PREDICTED: probable galacturonosyltransferas...    150   1e-36   Brassica rapa
emb|CDY42476.1|  BnaA10g08520D                                          150   1e-36   Brassica napus [oilseed rape]
emb|CDY47455.1|  BnaC09g31020D                                          149   4e-36   Brassica napus [oilseed rape]
ref|XP_009120000.1|  PREDICTED: probable galacturonosyltransferas...    148   5e-36   Brassica rapa
ref|XP_010443047.1|  PREDICTED: probable galacturonosyltransferas...    148   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010240964.1|  PREDICTED: probable galacturonosyltransferas...    147   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011650538.1|  PREDICTED: probable galacturonosyltransferas...    146   2e-35   Cucumis sativus [cucumbers]
ref|XP_010267797.1|  PREDICTED: probable galacturonosyltransferas...    147   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010482877.1|  PREDICTED: probable galacturonosyltransferas...    146   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009402871.1|  PREDICTED: probable galacturonosyltransferas...    144   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006830459.2|  PREDICTED: probable galacturonosyltransferas...    142   7e-34   
gb|ERM97875.1|  hypothetical protein AMTR_s00115p00091320               142   8e-34   Amborella trichopoda
ref|XP_009397165.1|  PREDICTED: probable galacturonosyltransferas...    140   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006837044.1|  PREDICTED: probable galacturonosyltransferas...    119   4e-31   Amborella trichopoda
ref|XP_009402872.1|  PREDICTED: probable galacturonosyltransferas...    132   2e-30   
gb|KJB40881.1|  hypothetical protein B456_007G081500                    103   3e-27   Gossypium raimondii
gb|KJB40880.1|  hypothetical protein B456_007G081500                    103   4e-27   Gossypium raimondii
gb|KJB40879.1|  hypothetical protein B456_007G081500                    103   4e-27   Gossypium raimondii
gb|KHG03530.1|  putative galacturonosyltransferase 14 -like protein     102   6e-27   Gossypium arboreum [tree cotton]
ref|XP_010258139.1|  PREDICTED: probable galacturonosyltransferas...    101   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002983680.1|  galacturonosyltransferase GAUT12/13/14/15-li...    106   5e-26   
ref|XP_010551820.1|  PREDICTED: probable galacturonosyltransferas...  99.8    8e-26   Tarenaya hassleriana [spider flower]
ref|XP_010551819.1|  PREDICTED: probable galacturonosyltransferas...  99.8    9e-26   Tarenaya hassleriana [spider flower]
ref|XP_006297411.1|  hypothetical protein CARUB_v10013435mg           99.8    2e-25   Capsella rubella
ref|XP_010485435.1|  PREDICTED: probable galacturonosyltransferas...  99.8    3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010417209.1|  PREDICTED: probable galacturonosyltransferas...  99.8    3e-25   
ref|XP_010485434.1|  PREDICTED: probable galacturonosyltransferas...  99.8    3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002884297.1|  GAUT13                                           99.4    3e-25   
gb|KHG04367.1|  putative galacturonosyltransferase 13 -like protein     100   3e-25   Gossypium arboreum [tree cotton]
emb|CDY43026.1|  BnaA03g11730D                                          113   4e-25   Brassica napus [oilseed rape]
ref|NP_186753.2|  putative galacturonosyltransferase 13               99.0    4e-25   
ref|NP_001118545.1|  putative galacturonosyltransferase 13            98.6    4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KJB75647.1|  hypothetical protein B456_012G049900                  99.4    5e-25   Gossypium raimondii
ref|NP_197051.2|  probable galacturonosyltransferase 14               98.6    7e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KJB75644.1|  hypothetical protein B456_012G049900                  99.4    7e-25   Gossypium raimondii
gb|KJB75645.1|  hypothetical protein B456_012G049900                  99.4    7e-25   Gossypium raimondii
ref|XP_007032682.1|  Galacturonosyltransferase 13 isoform 2           99.8    8e-25   
ref|XP_007032681.1|  Galacturonosyltransferase 13 isoform 1           99.8    8e-25   Theobroma cacao [chocolate]
ref|XP_006287475.1|  hypothetical protein CARUB_v10000686mg           98.2    8e-25   
gb|KJB75646.1|  hypothetical protein B456_012G049900                  99.0    9e-25   Gossypium raimondii
ref|XP_010525101.1|  PREDICTED: probable galacturonosyltransferas...  98.2    1e-24   Tarenaya hassleriana [spider flower]
ref|XP_010525102.1|  PREDICTED: probable galacturonosyltransferas...  97.8    1e-24   Tarenaya hassleriana [spider flower]
ref|XP_006400067.1|  hypothetical protein EUTSA_v10013218mg           98.2    1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010492387.1|  PREDICTED: probable galacturonosyltransferas...  96.7    2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010420207.1|  PREDICTED: probable galacturonosyltransferas...  97.1    2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006408454.1|  hypothetical protein EUTSA_v10020487mg           97.4    2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_003596616.1|  Glycosyltransferase CAZy family GT8                113   3e-24   
ref|XP_010453684.1|  PREDICTED: probable galacturonosyltransferas...  95.9    4e-24   Camelina sativa [gold-of-pleasure]
emb|CDX78631.1|  BnaA03g05430D                                          100   1e-23   
ref|XP_011035850.1|  PREDICTED: probable galacturonosyltransferas...    102   3e-23   Populus euphratica
ref|XP_009147387.1|  PREDICTED: probable galacturonosyltransferas...  97.1    4e-23   Brassica rapa
ref|XP_009147389.1|  PREDICTED: probable galacturonosyltransferas...  96.7    5e-23   Brassica rapa
ref|XP_010550021.1|  PREDICTED: probable galacturonosyltransferas...  94.7    5e-23   Tarenaya hassleriana [spider flower]
ref|XP_002873726.1|  hypothetical protein ARALYDRAFT_326001           99.8    6e-23   
ref|XP_001753633.1|  predicted protein                                94.4    8e-23   
emb|CDX70612.1|  BnaC03g06960D                                        96.7    2e-22   
ref|XP_010259116.1|  PREDICTED: probable galacturonosyltransferas...  90.1    2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009131467.1|  PREDICTED: probable galacturonosyltransferas...  98.6    2e-22   Brassica rapa
emb|CAC01746.1|  putative protein                                     98.6    3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011013393.1|  PREDICTED: probable galacturonosyltransferas...    102   3e-22   Populus euphratica
gb|AAF26170.1|AC008261_27  unknown protein                            99.0    5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305374.1|  hypothetical protein POPTR_0004s12340g             102   6e-22   
ref|XP_002324094.2|  glycosyl transferase family 8 family protein       102   7e-22   Populus trichocarpa [western balsam poplar]
gb|KFK25790.1|  hypothetical protein AALP_AA8G160800                  99.8    1e-21   Arabis alpina [alpine rockcress]
ref|XP_001755223.1|  predicted protein                                90.9    2e-21   
ref|XP_008661159.1|  PREDICTED: probable galacturonosyltransferas...  90.9    3e-21   Zea mays [maize]
ref|XP_004149844.2|  PREDICTED: probable galacturonosyltransferas...  84.7    3e-21   Cucumis sativus [cucumbers]
gb|KFK37569.1|  hypothetical protein AALP_AA3G000200                  96.7    3e-21   Arabis alpina [alpine rockcress]
ref|XP_008450151.1|  PREDICTED: probable galacturonosyltransferas...  84.7    3e-21   Cucumis melo [Oriental melon]
ref|XP_004962991.1|  PREDICTED: probable galacturonosyltransferas...  90.1    3e-21   Setaria italica
emb|CDX69522.1|  BnaA10g18710D                                        91.3    5e-21   
ref|XP_009360554.1|  PREDICTED: probable galacturonosyltransferas...  86.7    6e-21   
ref|XP_008341636.1|  PREDICTED: probable galacturonosyltransferas...  86.7    7e-21   Malus domestica [apple tree]
gb|KJB40878.1|  hypothetical protein B456_007G081500                    104   7e-21   Gossypium raimondii
gb|EPS71758.1|  hypothetical protein M569_02993                       89.7    8e-21   Genlisea aurea
ref|XP_009360552.1|  PREDICTED: probable galacturonosyltransferas...  86.3    8e-21   
ref|XP_004304247.1|  PREDICTED: probable galacturonosyltransferas...  85.5    8e-21   Fragaria vesca subsp. vesca
ref|XP_010661124.1|  PREDICTED: probable galacturonosyltransferas...  84.3    8e-21   Vitis vinifera
ref|XP_008341635.1|  PREDICTED: probable galacturonosyltransferas...  86.3    8e-21   Malus domestica [apple tree]
ref|XP_007217256.1|  hypothetical protein PRUPE_ppa004045mg           85.5    9e-21   Prunus persica
ref|XP_008230851.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  85.5    9e-21   
ref|XP_002443426.1|  hypothetical protein SORBIDRAFT_08g019260        89.0    9e-21   Sorghum bicolor [broomcorn]
emb|CDY26424.1|  BnaC09g42440D                                        90.1    1e-20   Brassica napus [oilseed rape]
ref|XP_002284273.1|  PREDICTED: probable galacturonosyltransferas...  83.6    1e-20   Vitis vinifera
ref|XP_009121571.1|  PREDICTED: probable galacturonosyltransferas...  89.7    1e-20   Brassica rapa
ref|XP_010936345.1|  PREDICTED: probable galacturonosyltransferas...  86.7    1e-20   Elaeis guineensis
gb|EMS53278.1|  putative galacturonosyltransferase 13                 86.3    2e-20   Triticum urartu
ref|XP_008792744.1|  PREDICTED: probable galacturonosyltransferas...  85.5    2e-20   Phoenix dactylifera
ref|XP_001755587.1|  predicted protein                                89.4    2e-20   
ref|XP_008459373.1|  PREDICTED: probable galacturonosyltransferas...  83.6    2e-20   Cucumis melo [Oriental melon]
ref|XP_011656007.1|  PREDICTED: probable galacturonosyltransferas...  84.0    2e-20   Cucumis sativus [cucumbers]
ref|XP_008459374.1|  PREDICTED: probable galacturonosyltransferas...  83.6    2e-20   Cucumis melo [Oriental melon]
gb|EPS67977.1|  hypothetical protein M569_06796                       92.0    2e-20   Genlisea aurea
ref|XP_006452148.1|  hypothetical protein CICLE_v10007975mg             100   2e-20   
dbj|BAJ97300.1|  predicted protein                                    85.5    3e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004141462.1|  PREDICTED: probable galacturonosyltransferas...  83.6    3e-20   Cucumis sativus [cucumbers]
ref|XP_008379400.1|  PREDICTED: probable galacturonosyltransferas...  84.3    3e-20   
ref|XP_007151295.1|  hypothetical protein PHAVU_004G034200g           80.9    3e-20   Phaseolus vulgaris [French bean]
ref|NP_001145771.1|  uncharacterized protein LOC100279278             87.8    3e-20   Zea mays [maize]
ref|XP_009397278.1|  PREDICTED: probable galacturonosyltransferas...  90.1    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397279.1|  PREDICTED: probable galacturonosyltransferas...  89.7    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785954.1|  PREDICTED: probable galacturonosyltransferas...  86.3    6e-20   Phoenix dactylifera
ref|XP_009365847.1|  PREDICTED: probable galacturonosyltransferas...  82.8    7e-20   Pyrus x bretschneideri [bai li]
ref|XP_006452153.1|  hypothetical protein CICLE_v10007975mg           99.8    7e-20   
ref|XP_009399119.1|  PREDICTED: probable galacturonosyltransferas...  85.1    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398279.1|  PREDICTED: probable galacturonosyltransferas...  86.3    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006593688.1|  PREDICTED: probable galacturonosyltransferas...  83.6    9e-20   Glycine max [soybeans]
emb|CDX90990.1|  BnaC02g06070D                                        86.7    1e-19   
ref|XP_003543923.1|  PREDICTED: probable galacturonosyltransferas...  83.6    1e-19   
ref|XP_009126048.1|  PREDICTED: probable galacturonosyltransferas...  85.9    1e-19   Brassica rapa
gb|KHF97963.1|  putative galacturonosyltransferase 14 -like protein   94.4    1e-19   Gossypium arboreum [tree cotton]
emb|CDX85550.1|  BnaA02g02630D                                        85.9    2e-19   
ref|XP_006664673.1|  PREDICTED: probable galacturonosyltransferas...  93.6    2e-19   
ref|XP_009388912.1|  PREDICTED: probable galacturonosyltransferas...  85.5    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFJ12115.1|  glycosyltransferase                                   95.9    2e-19   Nicotiana tabacum [American tobacco]
ref|XP_010467967.1|  PREDICTED: probable galacturonosyltransferas...    100   2e-19   
ref|XP_006482685.1|  PREDICTED: probable galacturonosyltransferas...  84.7    3e-19   Citrus sinensis [apfelsine]
ref|XP_006431227.1|  hypothetical protein CICLE_v10011444mg           84.7    3e-19   Citrus clementina [clementine]
gb|KFK37568.1|  hypothetical protein AALP_AA3G000200                  96.7    4e-19   Arabis alpina [alpine rockcress]
ref|XP_010089605.1|  putative galacturonosyltransferase 14            82.8    5e-19   Morus notabilis
ref|NP_001067123.1|  Os12g0578500                                     91.7    7e-19   
ref|XP_003554778.1|  PREDICTED: probable galacturonosyltransferas...  80.9    1e-18   Glycine max [soybeans]
ref|XP_006603902.1|  PREDICTED: probable galacturonosyltransferas...  80.9    1e-18   Glycine max [soybeans]
ref|XP_012084795.1|  PREDICTED: probable galacturonosyltransferas...  87.0    2e-18   Jatropha curcas
ref|XP_008805098.1|  PREDICTED: probable galacturonosyltransferas...  80.1    2e-18   Phoenix dactylifera
ref|XP_002526079.1|  Glycosyltransferase QUASIMODO1, putative         84.7    2e-18   Ricinus communis
ref|XP_010032534.1|  PREDICTED: probable galacturonosyltransferas...  73.9    2e-18   Eucalyptus grandis [rose gum]
ref|XP_012084794.1|  PREDICTED: probable galacturonosyltransferas...  86.3    3e-18   Jatropha curcas
ref|XP_007139505.1|  hypothetical protein PHAVU_008G035400g           82.8    3e-18   Phaseolus vulgaris [French bean]
ref|XP_003578583.1|  PREDICTED: probable galacturonosyltransferas...  77.8    4e-18   Brachypodium distachyon [annual false brome]
ref|XP_010550020.1|  PREDICTED: probable galacturonosyltransferas...  95.9    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_010923584.1|  PREDICTED: probable galacturonosyltransferas...  79.7    5e-18   Elaeis guineensis
emb|CAN68963.1|  hypothetical protein VITISV_019278                   84.7    6e-18   Vitis vinifera
ref|XP_010904951.1|  PREDICTED: probable galacturonosyltransferas...  78.2    7e-18   Elaeis guineensis
ref|XP_012084793.1|  PREDICTED: probable galacturonosyltransferas...  84.7    9e-18   
gb|AES74845.2|  CAZy family GT8 glycosyltransferase                   78.2    1e-17   Medicago truncatula
gb|EPS70077.1|  hypothetical protein M569_04673                       84.7    1e-17   Genlisea aurea
ref|XP_010939106.1|  PREDICTED: probable galacturonosyltransferas...  80.9    2e-17   Elaeis guineensis
gb|AES77579.2|  CAZy family GT8 glycosyltransferase                   81.3    2e-17   Medicago truncatula
gb|KEH21641.1|  CAZy family GT8 glycosyltransferase                   81.3    2e-17   Medicago truncatula
emb|CBI22287.3|  unnamed protein product                              83.6    4e-17   Vitis vinifera
gb|EMT08056.1|  Glycosyltransferase QUASIMODO1                        83.2    4e-17   
ref|XP_006338386.1|  PREDICTED: probable galacturonosyltransferas...  73.9    4e-17   Solanum tuberosum [potatoes]
ref|XP_004491881.1|  PREDICTED: probable galacturonosyltransferas...  77.8    4e-17   Cicer arietinum [garbanzo]
emb|CDX91967.1|  BnaC03g32690D                                        81.3    4e-17   
ref|XP_006603901.1|  PREDICTED: probable galacturonosyltransferas...  81.3    5e-17   Glycine max [soybeans]
ref|XP_009134641.1|  PREDICTED: probable galacturonosyltransferas...  80.5    6e-17   Brassica rapa
ref|XP_006603900.1|  PREDICTED: probable galacturonosyltransferas...  80.9    6e-17   Glycine max [soybeans]
ref|XP_004985228.1|  PREDICTED: probable galacturonosyltransferas...  86.3    1e-16   Setaria italica
ref|XP_003531845.1|  PREDICTED: probable galacturonosyltransferas...  80.5    1e-16   Glycine max [soybeans]
ref|XP_010670179.1|  PREDICTED: probable galacturonosyltransferas...  82.4    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004232177.1|  PREDICTED: probable galacturonosyltransferas...  72.0    2e-16   Solanum lycopersicum
gb|KHN13575.1|  Putative galacturonosyltransferase 14                 78.6    2e-16   Glycine soja [wild soybean]
gb|EAY83641.1|  hypothetical protein OsI_38869                        90.5    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_003552555.1|  PREDICTED: probable galacturonosyltransferas...  78.6    3e-16   Glycine max [soybeans]
ref|XP_009121572.1|  PREDICTED: probable galacturonosyltransferas...  90.1    5e-16   Brassica rapa
gb|AFW89248.1|  hypothetical protein ZEAMMB73_107521                  84.3    5e-16   
ref|XP_008658925.1|  PREDICTED: uncharacterized protein LOC100384...  84.3    5e-16   
ref|XP_003558510.1|  PREDICTED: probable galacturonosyltransferas...  83.2    5e-16   Brachypodium distachyon [annual false brome]
dbj|BAJ86151.1|  predicted protein                                    84.7    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465655.1|  hypothetical protein SORBIDRAFT_01g043170        83.6    8e-16   
ref|XP_008646847.1|  PREDICTED: uncharacterized protein LOC100501...  83.2    1e-15   
gb|ABF94604.1|  Glycosyl transferase family 8 protein, expressed      83.2    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009629908.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-15   Nicotiana tomentosiformis
ref|XP_009629907.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-15   Nicotiana tomentosiformis
ref|XP_011098715.1|  PREDICTED: probable galacturonosyltransferas...  75.5    2e-15   Sesamum indicum [beniseed]
ref|XP_006651162.1|  PREDICTED: probable galacturonosyltransferas...  87.8    2e-15   
ref|XP_009587642.1|  PREDICTED: probable galacturonosyltransferas...  72.8    3e-15   Nicotiana tomentosiformis
ref|XP_009587641.1|  PREDICTED: probable galacturonosyltransferas...  72.8    3e-15   Nicotiana tomentosiformis
ref|XP_009789619.1|  PREDICTED: probable galacturonosyltransferas...  75.5    3e-15   Nicotiana sylvestris
ref|XP_009789618.1|  PREDICTED: probable galacturonosyltransferas...  75.1    4e-15   Nicotiana sylvestris
emb|CDP02301.1|  unnamed protein product                              71.6    4e-15   Coffea canephora [robusta coffee]
emb|CDP18723.1|  unnamed protein product                              86.7    5e-15   Coffea canephora [robusta coffee]
ref|XP_003618627.1|  Glycosyltransferase CAZy family GT8              78.2    6e-15   
ref|XP_009360555.1|  PREDICTED: probable galacturonosyltransferas...  86.7    7e-15   
ref|XP_010053216.1|  PREDICTED: probable galacturonosyltransferas...  85.5    7e-15   
ref|XP_008341638.1|  PREDICTED: probable galacturonosyltransferas...  86.3    7e-15   Malus domestica [apple tree]
ref|XP_011083308.1|  PREDICTED: probable galacturonosyltransferas...  86.3    7e-15   Sesamum indicum [beniseed]
ref|XP_009603903.1|  PREDICTED: probable galacturonosyltransferas...  73.9    8e-15   Nicotiana tomentosiformis
ref|XP_009786493.1|  PREDICTED: probable galacturonosyltransferas...  73.6    9e-15   Nicotiana sylvestris
ref|XP_008341637.1|  PREDICTED: probable galacturonosyltransferas...  86.3    9e-15   Malus domestica [apple tree]
gb|EMT07847.1|  Glycosyltransferase QUASIMODO1                        86.3    9e-15   
ref|XP_009126049.1|  PREDICTED: probable galacturonosyltransferas...  85.9    9e-15   Brassica rapa
ref|XP_009399120.1|  PREDICTED: probable galacturonosyltransferas...  85.1    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011467906.1|  PREDICTED: probable galacturonosyltransferas...  85.5    2e-14   Fragaria vesca subsp. vesca
ref|XP_006363419.1|  PREDICTED: probable galacturonosyltransferas...  69.3    2e-14   Solanum tuberosum [potatoes]
ref|XP_006363420.1|  PREDICTED: probable galacturonosyltransferas...  69.3    2e-14   Solanum tuberosum [potatoes]
ref|XP_010317115.1|  PREDICTED: probable galacturonosyltransferas...  69.3    2e-14   Solanum lycopersicum
ref|XP_004233377.1|  PREDICTED: probable galacturonosyltransferas...  69.3    2e-14   Solanum lycopersicum
ref|XP_009790357.1|  PREDICTED: probable galacturonosyltransferas...  72.8    2e-14   Nicotiana sylvestris
ref|XP_009790355.1|  PREDICTED: probable galacturonosyltransferas...  72.8    2e-14   Nicotiana sylvestris
ref|XP_010053190.1|  PREDICTED: probable galacturonosyltransferas...  85.1    2e-14   
ref|XP_010109354.1|  putative galacturonosyltransferase 15            84.7    2e-14   Morus notabilis
ref|XP_008658926.1|  PREDICTED: uncharacterized protein LOC100384...  84.3    4e-14   Zea mays [maize]
ref|XP_008379401.1|  PREDICTED: probable galacturonosyltransferas...  84.0    4e-14   
ref|XP_006363746.1|  PREDICTED: probable galacturonosyltransferas...  67.8    5e-14   Solanum tuberosum [potatoes]
ref|XP_006363747.1|  PREDICTED: probable galacturonosyltransferas...  67.4    6e-14   Solanum tuberosum [potatoes]
ref|XP_006363745.1|  PREDICTED: probable galacturonosyltransferas...  67.4    6e-14   Solanum tuberosum [potatoes]
tpg|DAA47197.1|  TPA: hypothetical protein ZEAMMB73_881803            65.1    6e-14   
ref|XP_010525353.1|  PREDICTED: probable galacturonosyltransferas...  83.2    8e-14   Tarenaya hassleriana [spider flower]
ref|XP_010939115.1|  PREDICTED: probable galacturonosyltransferas...  83.2    9e-14   
ref|XP_010670180.1|  PREDICTED: probable galacturonosyltransferas...  83.2    9e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009365848.1|  PREDICTED: probable galacturonosyltransferas...  82.8    1e-13   Pyrus x bretschneideri [bai li]
gb|EYU34623.1|  hypothetical protein MIMGU_mgv1a004198mg              71.6    1e-13   
gb|EYU34622.1|  hypothetical protein MIMGU_mgv1a004198mg              71.6    1e-13   
ref|XP_010656939.1|  PREDICTED: probable galacturonosyltransferas...  82.4    1e-13   
ref|XP_010656940.1|  PREDICTED: probable galacturonosyltransferas...  82.4    1e-13   
ref|XP_009134640.1|  PREDICTED: probable galacturonosyltransferas...  82.0    2e-13   
emb|CDX74279.1|  BnaA03g27680D                                        82.0    2e-13   
gb|EYU44171.1|  hypothetical protein MIMGU_mgv1a004225mg              69.7    2e-13   
ref|XP_004234296.1|  PREDICTED: probable galacturonosyltransferas...  67.4    2e-13   
ref|XP_010317525.1|  PREDICTED: probable galacturonosyltransferas...  67.0    3e-13   
ref|XP_007151294.1|  hypothetical protein PHAVU_004G034200g           80.9    4e-13   
ref|XP_006603903.1|  PREDICTED: probable galacturonosyltransferas...  80.9    4e-13   
emb|CAN67083.1|  hypothetical protein VITISV_043869                   80.9    5e-13   
ref|XP_002279893.1|  PREDICTED: probable galacturonosyltransferas...  80.9    5e-13   
ref|XP_010656938.1|  PREDICTED: probable galacturonosyltransferas...  80.9    5e-13   
gb|KJB75448.1|  hypothetical protein B456_012G042500                  80.5    5e-13   
ref|XP_010504844.1|  PREDICTED: probable galacturonosyltransferas...  80.5    6e-13   
ref|XP_010516538.1|  PREDICTED: probable galacturonosyltransferas...  80.5    6e-13   
ref|XP_006290475.1|  hypothetical protein CARUB_v100169971mg          80.1    8e-13   
ref|XP_007048827.1|  Galacturonosyltransferase 15                     80.1    9e-13   
ref|XP_011085730.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  71.2    1e-12   
ref|XP_003614823.1|  Glycosyltransferase CAZy family GT8              77.0    1e-12   
ref|XP_006402747.1|  hypothetical protein EUTSA_v10005879mg           79.7    1e-12   
gb|KGN47034.1|  hypothetical protein Csa_6G177440                     79.3    1e-12   
ref|XP_010904952.1|  PREDICTED: probable galacturonosyltransferas...  79.3    1e-12   
ref|XP_012066531.1|  PREDICTED: probable galacturonosyltransferas...  79.3    1e-12   
ref|XP_004143178.1|  PREDICTED: probable galacturonosyltransferas...  79.3    1e-12   
ref|XP_002878240.1|  GAUT15                                           79.0    2e-12   
ref|NP_191438.2|  probable galacturonosyltransferase 15               79.0    2e-12   
ref|XP_010524091.1|  PREDICTED: probable galacturonosyltransferas...  79.0    2e-12   
ref|XP_012066532.1|  PREDICTED: probable galacturonosyltransferas...  78.6    2e-12   
ref|XP_012066530.1|  PREDICTED: probable galacturonosyltransferas...  78.6    2e-12   
ref|XP_008456365.1|  PREDICTED: probable galacturonosyltransferas...  78.6    3e-12   
emb|CDY03282.1|  BnaC09g10660D                                        78.2    3e-12   
emb|CDY39266.1|  BnaC06g27250D                                        78.2    3e-12   
ref|XP_009116563.1|  PREDICTED: probable galacturonosyltransferas...  78.2    3e-12   
gb|KDO60919.1|  hypothetical protein CISIN_1g0094682mg                77.8    4e-12   
emb|CDX71920.1|  BnaC08g29540D                                        77.8    4e-12   
gb|KDO60917.1|  hypothetical protein CISIN_1g0094682mg                77.8    4e-12   
gb|KDO60918.1|  hypothetical protein CISIN_1g0094682mg                77.8    5e-12   
gb|KDO60920.1|  hypothetical protein CISIN_1g0094682mg                77.8    5e-12   
ref|XP_006484832.1|  PREDICTED: probable galacturonosyltransferas...  77.4    5e-12   
gb|KFK35102.1|  hypothetical protein AALP_AA5G235900                  77.0    8e-12   
ref|XP_008342375.1|  PREDICTED: probable galacturonosyltransferas...  77.0    8e-12   
ref|XP_011098076.1|  PREDICTED: probable galacturonosyltransferas...  76.6    9e-12   
ref|XP_003551912.1|  PREDICTED: probable galacturonosyltransferas...  77.0    9e-12   
ref|XP_011098074.1|  PREDICTED: probable galacturonosyltransferas...  77.0    1e-11   
ref|XP_008229394.1|  PREDICTED: probable galacturonosyltransferas...  76.6    1e-11   
gb|KHN18104.1|  Putative galacturonosyltransferase 15                 76.6    1e-11   
ref|XP_010029326.1|  PREDICTED: probable galacturonosyltransferas...  76.6    1e-11   
ref|XP_010272676.1|  PREDICTED: probable galacturonosyltransferas...  75.5    1e-11   
ref|XP_010273413.1|  PREDICTED: probable galacturonosyltransferas...  76.3    2e-11   
emb|CAB88296.1|  putative protein                                     76.3    2e-11   
ref|XP_010273414.1|  PREDICTED: probable galacturonosyltransferas...  76.3    2e-11   
ref|XP_009377684.1|  PREDICTED: probable galacturonosyltransferas...  76.3    2e-11   
ref|XP_006437201.1|  hypothetical protein CICLE_v10031200mg           76.3    2e-11   
ref|XP_010427793.1|  PREDICTED: probable galacturonosyltransferas...  76.3    2e-11   
ref|XP_004513724.1|  PREDICTED: probable galacturonosyltransferas...  75.9    2e-11   
gb|EMS58544.1|  putative galacturonosyltransferase 14                 75.9    3e-11   
ref|XP_007215390.1|  hypothetical protein PRUPE_ppa005810mg           75.1    3e-11   
ref|XP_003532100.1|  PREDICTED: probable galacturonosyltransferas...  75.1    4e-11   
gb|KHM99621.1|  Putative galacturonosyltransferase 15                 74.7    4e-11   
ref|XP_011471011.1|  PREDICTED: probable galacturonosyltransferas...  74.3    6e-11   
ref|XP_011471012.1|  PREDICTED: probable galacturonosyltransferas...  74.3    6e-11   
ref|XP_002520380.1|  Glycosyltransferase QUASIMODO1, putative         74.3    6e-11   
emb|CDX98331.1|  BnaC06g16920D                                        74.3    7e-11   
ref|XP_003610561.1|  Glycosyltransferase CAZy family GT8              73.9    7e-11   
gb|AES92758.2|  CAZy family GT8 glycosyltransferase                   73.9    7e-11   
ref|XP_009356653.1|  PREDICTED: probable galacturonosyltransferas...  73.9    8e-11   
ref|XP_008365620.1|  PREDICTED: probable galacturonosyltransferas...  73.9    8e-11   
ref|XP_007146361.1|  hypothetical protein PHAVU_006G034100g           73.9    9e-11   
ref|XP_008775259.1|  PREDICTED: probable galacturonosyltransferas...  73.2    1e-10   
ref|XP_008775258.1|  PREDICTED: probable galacturonosyltransferas...  73.6    1e-10   
ref|XP_002321071.1|  hypothetical protein POPTR_0014s13860g           73.6    1e-10   
ref|XP_011033733.1|  PREDICTED: probable galacturonosyltransferas...  73.2    1e-10   
emb|CDX67766.1|  BnaA07g18060D                                        73.2    1e-10   
ref|XP_009104173.1|  PREDICTED: probable galacturonosyltransferas...  73.2    1e-10   
gb|ERN20473.1|  hypothetical protein AMTR_s00068p00156710             66.6    2e-10   
gb|KEH33762.1|  CAZy family GT8 glycosyltransferase                   72.0    3e-10   
gb|KHN38308.1|  Putative galacturonosyltransferase 15                 70.9    7e-10   
ref|XP_010924681.1|  PREDICTED: probable galacturonosyltransferas...  70.9    7e-10   
ref|XP_003518517.1|  PREDICTED: probable galacturonosyltransferas...  70.9    8e-10   
ref|XP_009762630.1|  PREDICTED: probable galacturonosyltransferas...  70.9    9e-10   
gb|KJB40877.1|  hypothetical protein B456_007G081500                  70.5    9e-10   
ref|XP_008792283.1|  PREDICTED: probable galacturonosyltransferas...  70.5    1e-09   
ref|XP_006348942.1|  PREDICTED: probable galacturonosyltransferas...  69.7    2e-09   
gb|KDO72667.1|  hypothetical protein CISIN_1g009348mg                 69.3    2e-09   
gb|KHN11952.1|  Putative galacturonosyltransferase 15                 69.3    2e-09   
ref|XP_003545139.1|  PREDICTED: probable galacturonosyltransferas...  69.3    2e-09   
gb|KJB75451.1|  hypothetical protein B456_012G042500                  68.2    3e-09   
gb|KHG22010.1|  putative galacturonosyltransferase 15 -like protein   68.6    3e-09   
ref|XP_004243233.1|  PREDICTED: probable galacturonosyltransferas...  68.9    3e-09   
gb|KJB75449.1|  hypothetical protein B456_012G042500                  68.6    3e-09   
ref|XP_010916158.1|  PREDICTED: probable galacturonosyltransferas...  68.6    4e-09   
gb|EEC74744.1|  hypothetical protein OsI_10497                        68.6    4e-09   
ref|XP_009762631.1|  PREDICTED: probable galacturonosyltransferas...  67.0    1e-08   
ref|XP_009415181.1|  PREDICTED: probable galacturonosyltransferas...  67.0    1e-08   
ref|XP_011628840.1|  PREDICTED: probable galacturonosyltransferas...  66.6    1e-08   
ref|XP_003567070.1|  PREDICTED: probable galacturonosyltransferas...  66.2    2e-08   
emb|CAN61080.1|  hypothetical protein VITISV_031214                   65.9    3e-08   
dbj|BAJ89181.1|  predicted protein                                    65.9    3e-08   
ref|XP_009612076.1|  PREDICTED: probable galacturonosyltransferas...  65.5    4e-08   
ref|XP_007141382.1|  hypothetical protein PHAVU_008G190700g           65.1    6e-08   
ref|XP_009612077.1|  PREDICTED: probable galacturonosyltransferas...  64.7    6e-08   
ref|XP_007141381.1|  hypothetical protein PHAVU_008G190700g           64.7    7e-08   
ref|NP_001147797.1|  transferase, transferring glycosyl groups        64.3    1e-07   
ref|XP_008672823.1|  PREDICTED: transferase, transferring glycosy...  63.9    1e-07   
emb|CDM84208.1|  unnamed protein product                              63.9    1e-07   
ref|NP_001044121.1|  Os01g0727100                                     63.2    2e-07   
gb|EEC71413.1|  hypothetical protein OsI_03591                        63.2    2e-07   
ref|XP_006644650.1|  PREDICTED: probable galacturonosyltransferas...  62.4    4e-07   
emb|CAN77305.1|  hypothetical protein VITISV_030063                   61.6    5e-07   
gb|EMT26841.1|  Glycosyltransferase QUASIMODO1                        61.2    1e-06   
ref|XP_002456278.1|  hypothetical protein SORBIDRAFT_03g033400        60.1    2e-06   
gb|EPS67336.1|  glycosyltransferase                                   59.7    2e-06   
ref|XP_004969814.1|  PREDICTED: probable galacturonosyltransferas...  59.7    3e-06   
ref|XP_004969813.1|  PREDICTED: probable galacturonosyltransferas...  59.7    3e-06   
ref|XP_004969815.1|  PREDICTED: probable galacturonosyltransferas...  59.3    3e-06   
ref|XP_004969816.1|  PREDICTED: probable galacturonosyltransferas...  59.3    3e-06   
ref|XP_006437202.1|  hypothetical protein CICLE_v10031200mg           58.2    6e-06   
ref|XP_006437203.1|  hypothetical protein CICLE_v10031200mg           58.2    6e-06   
ref|XP_006437204.1|  hypothetical protein CICLE_v10031200mg           57.8    7e-06   
gb|KEH33763.1|  CAZy family GT8 glycosyltransferase                   58.2    7e-06   
gb|KJB75453.1|  hypothetical protein B456_012G042500                  56.2    3e-05   
gb|KJB75455.1|  hypothetical protein B456_012G042500                  55.8    4e-05   
gb|KJB75454.1|  hypothetical protein B456_012G042500                  55.5    4e-05   
gb|EMS46995.1|  putative galacturonosyltransferase 15                 53.9    2e-04   
ref|XP_003621361.1|  Glycosyltransferase CAZy family GT8              53.5    3e-04   



>ref|XP_009611117.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana tomentosiformis]
Length=537

 Score =   192 bits (489),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG++LEST+PEVIY VLEEP+++TE++  PE+PQTL++ IAE K  RPDAKTFA KLKAM
Sbjct  86    LGKRLESTVPEVIYQVLEEPSDQTEMRTRPESPQTLDEFIAEMKDGRPDAKTFAVKLKAM  145

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQTTRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+N+NARLQLPSPELVP+
Sbjct  146   VTLLEQTTRTAKIQEYLYRHVASSSIPKQLHCLALKLAHEHSTNSNARLQLPSPELVPA  204


 Score = 77.0 bits (188),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KG K+FIK ++ S+R+S+R+VFY LL  TFLLRFVF+ TA+DT
Sbjct  5    MQLHISPSLRHVTVLPAKGFKDFIKVKVGSKRLSYRMVFYFLLFLTFLLRFVFVLTAIDT  64

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            IDGE KCS +GC G+KI P I  K
Sbjct  65   IDGERKCSTLGCLGKKIGPRILGK  88



>gb|EYU19206.1| hypothetical protein MIMGU_mgv1a004325mg [Erythranthe guttata]
Length=533

 Score =   192 bits (488),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+LEST+PEVIY VLEEP  + EIQ GPE PQT+ED +AE K +RPDAKTFA KLKAM
Sbjct  82    LGRRLESTVPEVIYQVLEEPVTQGEIQTGPEIPQTMEDFVAEIKDERPDAKTFAVKLKAM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEH+ NANARLQLP  ELVP+
Sbjct  142   VTLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLTLKLANEHAINANARLQLPLAELVPA  200


 Score = 77.0 bits (188),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVT+LP+KGV+EFIK +I SRR+S+R+VFYS+L FTFLLRFVF+ TAV+T
Sbjct  1    MQLHISPSLRHVTLLPSKGVREFIKVKIGSRRLSYRMVFYSVLFFTFLLRFVFVLTAVET  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS +GC G+++ P I 
Sbjct  61   IDGETKCSSLGCLGKRLGPRIL  82



>ref|XP_011097926.1| PREDICTED: probable galacturonosyltransferase 12 [Sesamum indicum]
Length=533

 Score =   194 bits (493),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ EST+PEV+Y VLEEP N++E+Q GPE PQTLED IAE K +RPDAKTFA KLK+M
Sbjct  82    LGRRHESTVPEVMYQVLEEPVNQSEVQSGPEVPQTLEDFIAEMKDERPDAKTFAIKLKSM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             + FLEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS E VP+
Sbjct  142   VTFLEQRTRTAKIQEYLYRHVASSSIPKQLHCLTLKLANEHSTNAQARLQLPSAEFVPA  200


 Score = 72.8 bits (177),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP+KG +EFIK +I SRR+S+R+VFYSLL+FTFLLRFVF+ TAVD 
Sbjct  1    MQLHISPSLRHVTVLPSKGFREFIKVKIGSRRLSYRMVFYSLLVFTFLLRFVFVLTAVDH  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            I+GE+KC+ +GC G+K+ P I 
Sbjct  61   IEGETKCTTLGCLGKKLGPRIL  82



>ref|XP_009794961.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana sylvestris]
Length=537

 Score =   188 bits (478),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG++LEST+PEVIY VLEEP+++TE++  PE+PQTL++ IAE K  RPDAKTFA KLK+M
Sbjct  86    LGKRLESTVPEVIYQVLEEPSDQTEMRTRPESPQTLDEFIAEMKVGRPDAKTFAVKLKSM  145

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQTTRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+N+NARLQLP PELVP+
Sbjct  146   VTLLEQTTRTAKIQEYLYRHVASSSIPKQLHCLALKLAHEHSTNSNARLQLPLPELVPA  204


 Score = 78.6 bits (192),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  621  VSEMQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            ++ MQLHISPSLRHVTVLP KG K+FIK ++ S+R+S+R+VFY LL  TFLLRFVF+ TA
Sbjct  2    LNAMQLHISPSLRHVTVLPAKGFKDFIKVKVGSKRLSYRMVFYFLLFLTFLLRFVFVLTA  61

Query  801  VDTIDGESKCSGIGCFGRKIRPSIFRK  881
            +DTIDGE KCS +GC G+KI P I  K
Sbjct  62   IDTIDGERKCSTLGCLGKKIGPRILGK  88



>ref|XP_004244158.1| PREDICTED: probable galacturonosyltransferase 12 [Solanum lycopersicum]
Length=533

 Score =   187 bits (475),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG++LEST+PEVIY VLEEP+++T+ Q  PE+PQTLE+ +AE K  RPDAKTFA KLKAM
Sbjct  82    LGKRLESTVPEVIYRVLEEPSDQTDTQTRPESPQTLEEFVAEMKDGRPDAKTFAVKLKAM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LE+ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+N+NARLQLPSPELVP+
Sbjct  142   VTQLEERTRTAKIQEYLYRHVASSSIPKQLHCLALKLAHEHSTNSNARLQLPSPELVPA  200


 Score = 78.6 bits (192),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KG KEFIK ++ S+R+S+R+VFY LL  TFLLRFVF+ TA+DT
Sbjct  1    MQLHISPSLRHVTVLPAKGFKEFIKVKVGSKRLSYRMVFYCLLFLTFLLRFVFVLTAIDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            IDGE KCS +GC G+KI P I  K
Sbjct  61   IDGERKCSTLGCLGKKIGPRILGK  84



>ref|XP_009597423.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana tomentosiformis]
Length=537

 Score =   190 bits (482),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGRQLEST+PEVIY VLEEP+++ E++ GPETPQTLE+ +AE K  +PDA+TFA KLKAM
Sbjct  86    LGRQLESTVPEVIYQVLEEPSDQIEMEAGPETPQTLEEFMAEMKDTKPDAETFAVKLKAM  145

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQTTRTAKIQEYLYRHVAS+ IPKQLHCL L LA+EHS NANARLQLPS ELVP+
Sbjct  146   VTLLEQTTRTAKIQEYLYRHVASSGIPKQLHCLDLKLAHEHSINANARLQLPSAELVPA  204


 Score = 75.5 bits (184),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPSLRHVTVLP KG KEFIK ++ SRR+S+ +VFYSLLLFTFLLRFVF+ TAVDT
Sbjct  5    MQLLISPSLRHVTVLPAKGFKEFIKIKVGSRRLSYLMVFYSLLLFTFLLRFVFVLTAVDT  64

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE KCS +GC GRKI P I 
Sbjct  65   IDGELKCSTLGCLGRKIGPRIL  86



>ref|XP_006360097.1| PREDICTED: probable galacturonosyltransferase 12-like [Solanum 
tuberosum]
Length=537

 Score =   181 bits (460),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             L ++LEST+PEVIY VLEEP+++T+ Q  PE+PQTLE+ IAE K  RPDAKTFA KLKAM
Sbjct  86    LRKRLESTVPEVIYRVLEEPSDQTDTQTRPESPQTLEEFIAEMKDGRPDAKTFAVKLKAM  145

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LE+ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+N+NAR QLPSPELVP+
Sbjct  146   VTQLEERTRTAKIQEYLYRHVASSSIPKQLHCLALKLAHEHSTNSNARHQLPSPELVPA  204


 Score = 82.0 bits (201),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KG KEFIK ++ S+R+S+R+VFY LL  TFLLRFVF+ TA+DT
Sbjct  5    MQLHISPSLRHVTVLPAKGFKEFIKVKVGSKRLSYRMVFYCLLFLTFLLRFVFVLTAIDT  64

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            IDGE KCS +GC G+KI P I RK
Sbjct  65   IDGERKCSTLGCLGKKIGPRILRK  88



>emb|CDP05804.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   190 bits (482),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ EST+PEVIY VLEEP N+ E+Q GP+ PQTLED +AE +  RPDAK FA KLKAM
Sbjct  82    LGRRTESTVPEVIYQVLEEPVNQDELQAGPQIPQTLEDFMAEIRDSRPDAKAFALKLKAM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQL+CL+L LANEHSSNANARLQLPSPEL+P+
Sbjct  142   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLYCLTLRLANEHSSNANARLQLPSPELIPA  200


 Score = 73.2 bits (178),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KG KEFIK ++ SRR S+R+VFYSLL FTFLLRF+F+ TAVD 
Sbjct  1    MQLHISPSLRHVTVLPAKGFKEFIKVKVGSRRFSYRMVFYSLLFFTFLLRFIFVLTAVDN  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ID ++KCS IGC G+++ P I 
Sbjct  61   IDRDTKCSSIGCLGKRLGPRIL  82



>ref|XP_009792847.1| PREDICTED: probable galacturonosyltransferase 12 [Nicotiana sylvestris]
Length=537

 Score =   187 bits (476),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGRQLEST+PEVIY VLEEP+++ E++ GPETPQTLE+ +AE K  +PDA+TFA KLKAM
Sbjct  86    LGRQLESTVPEVIYQVLEEPSDQIEMEAGPETPQTLEEFMAEMKDTKPDAETFAVKLKAM  145

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQTTRTAKIQEYLYRHVAS+ IPKQLHCL L LA+E+S NANARLQLPS ELVP+
Sbjct  146   VTLLEQTTRTAKIQEYLYRHVASSGIPKQLHCLDLKLAHEYSINANARLQLPSAELVPA  204


 Score = 75.1 bits (183),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPSLRHVTVLP KG K+FIK ++ SRR+S+ +VFYSLLL TFLLRFVF+ TAVDT
Sbjct  5    MQLLISPSLRHVTVLPAKGFKDFIKVKVGSRRLSYLMVFYSLLLCTFLLRFVFVLTAVDT  64

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE KCS +GC GRKI P I 
Sbjct  65   IDGEQKCSTLGCLGRKIGPRIL  86



>ref|XP_011095315.1| PREDICTED: probable galacturonosyltransferase 12 [Sesamum indicum]
Length=534

 Score =   191 bits (484),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQ-LESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+ LEST+PEVIY VLEEP ++  +Q+GPE PQTLED IAE K +RPDAKTFA KLKA
Sbjct  82    LGRRVLESTVPEVIYQVLEEPVDQGGVQLGPEIPQTLEDFIAEMKDERPDAKTFAVKLKA  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NANARLQLPS ELVP+
Sbjct  142   MVTLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINANARLQLPSAELVPA  201


 Score = 70.5 bits (171),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EF+K +I SRR+S+R+VFYS+LL  FLLRFVF+  AVD 
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFMKVKIGSRRLSYRMVFYSVLLAAFLLRFVFVLAAVDN  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDG++ CS IGC G+++ P I 
Sbjct  61   IDGQTGCSTIGCLGKRLGPRIL  82



>ref|XP_006352487.1| PREDICTED: probable galacturonosyltransferase 12-like [Solanum 
tuberosum]
Length=533

 Score =   185 bits (470),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG QLEST+PEVIY VLEEP ++ EI+ GPETPQ+LE+ + E K  RPDA+TFA KLKAM
Sbjct  82    LGTQLESTVPEVIYQVLEEPTDQIEIEEGPETPQSLEEFMEEMKDTRPDAETFAVKLKAM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+ IPKQLHCL L LA+EHS NANARLQLPSPELVP+
Sbjct  142   VTLLEQRTRTAKIQEYLYRHVASSGIPKQLHCLDLKLAHEHSINANARLQLPSPELVPA  200


 Score = 73.2 bits (178),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPSLRHVTVLP KG KEF+K ++ SRR+S+ +VFYSLLLFTFLLRFVF+ TA DT
Sbjct  1    MQLLISPSLRHVTVLPAKGFKEFVKVKVGSRRISYLMVFYSLLLFTFLLRFVFMLTAEDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE KCS +GC GRKI P I 
Sbjct  61   IDGERKCSTLGCLGRKIGPRIL  82



>ref|XP_004248332.1| PREDICTED: probable galacturonosyltransferase 12 [Solanum lycopersicum]
Length=537

 Score =   184 bits (466),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG QLEST+PEVIY VLEEP ++ EI+ GPETPQ+LE+ + E K  RPDA+TFA KLK M
Sbjct  86    LGSQLESTVPEVIYQVLEEPTDQIEIEEGPETPQSLEEFMEEMKDTRPDAETFAVKLKTM  145

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+ IPKQLHCL L LA+EHS NANARLQLPSPELVP+
Sbjct  146   VTLLEQRTRTAKIQEYLYRHVASSGIPKQLHCLDLKLAHEHSINANARLQLPSPELVPA  204


 Score = 72.8 bits (177),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPSLRHVTVLP KG KEF+K ++ SRR+S+ +VFYSLLLFTFLLRFVF+ TA DT
Sbjct  5    MQLLISPSLRHVTVLPAKGFKEFVKVKVGSRRISYLMVFYSLLLFTFLLRFVFVLTAEDT  64

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE KCS +GC GRKI P I 
Sbjct  65   IDGERKCSTLGCLGRKIGPRIL  86



>ref|XP_002282637.2| PREDICTED: probable galacturonosyltransferase 12 [Vitis vinifera]
 emb|CBI20502.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   166 bits (420),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG + ES +PEV+Y +L+EPA++ EIQ   + PQTLE+  AE K  R DA+ FA KL+AM
Sbjct  82    LGGRHESPVPEVMYQILDEPASKDEIQGRDDIPQTLEEFTAEVKESRSDARAFAIKLRAM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NANARLQLPS ELVP
Sbjct  142   VTLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNANARLQLPSAELVP  199


 Score = 78.2 bits (191),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SRRVS+R+VFYSLL FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRRVSYRMVFYSLLFFTFLLRFVFVLTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS IGC G+++ P I 
Sbjct  61   IDGETKCSTIGCLGKRLGPRIL  82



>ref|XP_006452149.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 ref|XP_006452152.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 gb|ESR65389.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 gb|ESR65392.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
Length=345

 Score =   165 bits (417),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ +ST+PEVIY +LEEP ++ E++   + PQTLE+ +A+ K  + DAKTFA KL+ M
Sbjct  82    LGRRPQSTVPEVIYQILEEPMSKDELKGRSDIPQTLEEFMADMKESKSDAKTFAIKLRDM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  200


 Score = 79.0 bits (193),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SRR+S+R++FYSLL  TFLLRFVF+ +AVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRRLSYRMLFYSLLFLTFLLRFVFVLSAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS IGC G+++ P I 
Sbjct  61   IDGESKCSTIGCLGKRLGPRIL  82



>ref|XP_007213904.1| hypothetical protein PRUPE_ppa004043mg [Prunus persica]
 gb|EMJ15103.1| hypothetical protein PRUPE_ppa004043mg [Prunus persica]
Length=533

 Score =   166 bits (421),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+L+ST+PEVIY +LEEP  + E+Q   + PQ+L++ +AE K  + DAKTFA KL+ M
Sbjct  82    LGRRLDSTVPEVIYQILEEPIGKDELQGRSDIPQSLDEFMAEIKEGKSDAKTFAVKLRDM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LANEH+SNA ARLQLPS ELVP+
Sbjct  142   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLANEHASNAAARLQLPSAELVPA  200


 Score = 76.6 bits (187),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK ++ SRR+S+R++FYS+L FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVKVGSRRLSYRMLFYSILFFTFLLRFVFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE KCS IGC G+++ P I 
Sbjct  61   IDGERKCSTIGCLGKRLGPKIL  82



>gb|KDO46374.1| hypothetical protein CISIN_1g007529mg [Citrus sinensis]
Length=600

 Score =   164 bits (414),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ +ST+PEVIY +LEEP ++ E++   + PQTLE+ +A+ K  + DAKTFA KL+ M
Sbjct  149   LGRRPQSTVPEVIYQILEEPMSKDELKGRSDIPQTLEEFMADMKESKSDAKTFAIKLRDM  208

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  209   VTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  267


 Score = 79.0 bits (193),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +3

Query  597  GWFRFVSRVSEMQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfll  776
            G F F +   +MQLHISPSLRHVTVLP KGV+EFIK ++ SRR+S+R++FYSLL  TFLL
Sbjct  58   GSFSFAA-WEKMQLHISPSLRHVTVLPGKGVREFIKVKVGSRRLSYRMLFYSLLFLTFLL  116

Query  777  rfvflfTAVDTIDGESKCSGIGCFGRKIRPSIF  875
            RFVF+ +AVDTIDGESKCS IGC G+++ P I 
Sbjct  117  RFVFVLSAVDTIDGESKCSTIGCLGKRLGPRIL  149



>ref|XP_006452150.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 gb|ESR65390.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
Length=457

 Score =   164 bits (416),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ +ST+PEVIY +LEEP ++ E++   + PQTLE+ +A+ K  + DAKTFA KL+ M
Sbjct  82    LGRRPQSTVPEVIYQILEEPMSKDELKGRSDIPQTLEEFMADMKESKSDAKTFAIKLRDM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  200


 Score = 78.6 bits (192),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SRR+S+R++FYSLL  TFLLRFVF+ +AVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRRLSYRMLFYSLLFLTFLLRFVFVLSAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS IGC G+++ P I 
Sbjct  61   IDGESKCSTIGCLGKRLGPRIL  82



>ref|XP_008244342.1| PREDICTED: probable galacturonosyltransferase 12 [Prunus mume]
Length=533

 Score =   166 bits (419),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+L+ST+PEVIY +LEEP  + E+Q   + PQ+L++ +AE K  + DA+TFA KL+ M
Sbjct  82    LGRRLDSTVPEVIYQILEEPIGKDELQGRSDIPQSLDEFMAEIKEGKSDARTFAVKLRDM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LANEH+SNA ARLQLPS ELVP+
Sbjct  142   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLANEHASNAAARLQLPSAELVPA  200


 Score = 76.6 bits (187),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK ++ SRR+S+R++FYS+L FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVKVGSRRLSYRMLFYSILFFTFLLRFVFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE KCS IGC G+++ P I 
Sbjct  61   IDGERKCSTIGCLGKRLGPKIL  82



>ref|XP_006452151.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 ref|XP_006475304.1| PREDICTED: probable galacturonosyltransferase 12-like [Citrus 
sinensis]
 gb|ESR65391.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
Length=533

 Score =   164 bits (414),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ +ST+PEVIY +LEEP ++ E++   + PQTLE+ +A+ K  + DAKTFA KL+ M
Sbjct  82    LGRRPQSTVPEVIYQILEEPMSKDELKGRSDIPQTLEEFMADMKESKSDAKTFAIKLRDM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  200


 Score = 78.2 bits (191),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SRR+S+R++FYSLL  TFLLRFVF+ +AVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRRLSYRMLFYSLLFLTFLLRFVFVLSAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS IGC G+++ P I 
Sbjct  61   IDGESKCSTIGCLGKRLGPRIL  82



>ref|XP_002522830.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39528.1| conserved hypothetical protein [Ricinus communis]
Length=463

 Score =   161 bits (408),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+L+S +PEVIY VL++P ++ +++   + PQTLE+ +A+ K  + +AKTFA KL+ M
Sbjct  82    LGRRLDSAVPEVIYQVLQDPLDQDDLKGRSDIPQTLEEFMADVKDTKLNAKTFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQL+CL+L LANEHS+NA ARLQLP+PELVP+
Sbjct  142   VTLLEQRTRTAKIQEYLYRHVASSSIPKQLYCLALRLANEHSTNAAARLQLPTPELVPA  200


 Score = 75.5 bits (184),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++  +RVS+R++FYSLL FTFL+RFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGGKRVSYRMLFYSLLFFTFLVRFVFVLSTVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS +GC G+++ P I 
Sbjct  61   IDGESKCSTLGCLGKRLGPRIL  82



>ref|XP_008365716.1| PREDICTED: probable galacturonosyltransferase 12 [Malus domestica]
Length=532

 Score =   157 bits (396),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ ES +PEVIY +LEEP  + E+Q   + PQ+L++ + E K  + DA+TFA KL+ M
Sbjct  82    LGRR-ESRVPEVIYQILEEPIGKHELQGRSDIPQSLDEFMVEIKDGKFDARTFAVKLREM  140

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LANEH+SNA ARLQLPS ELVP+
Sbjct  141   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLANEHASNAAARLQLPSAELVPA  199


 Score = 79.7 bits (195),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SRR+S+R++FYS+L FTFLLRF F+ TAVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRRLSYRMLFYSILFFTFLLRFAFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS +GC G+++ P I 
Sbjct  61   IDGESKCSSLGCLGKRLGPKIL  82



>ref|XP_008349951.1| PREDICTED: probable galacturonosyltransferase 12 [Malus domestica]
Length=532

 Score =   157 bits (396),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR  ES +PEVIY +LEEP  + E+Q   + PQTL++ + E K  + DA TFA KL+ M
Sbjct  82    LGRT-ESXVPEVIYQILEEPIGKHELQGRSDIPQTLDEFMVEIKNGKSDAMTFAVKLREM  140

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LANEH+SNA ARLQLPS ELVP+
Sbjct  141   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALXLANEHASNAAARLQLPSAELVPA  199


 Score = 79.0 bits (193),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK ++ SRR+S+R++FYS+L FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVKVGSRRLSYRMLFYSILFFTFLLRFVFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS IGC G+++ P I 
Sbjct  61   IDGESKCSSIGCLGKRLGPKIL  82



>ref|XP_008386024.1| PREDICTED: probable galacturonosyltransferase 12 [Malus domestica]
Length=532

 Score =   156 bits (395),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR  ES +PEVIY +LEEP  + E+Q   + PQTL++ + E K  + DA TFA KL+ M
Sbjct  82    LGRT-ESXVPEVIYQILEEPIGKHELQGRSDIPQTLDEFMVEIKNGKSDAMTFAVKLREM  140

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LANEH+SNA ARLQLPS ELVP+
Sbjct  141   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLANEHASNAAARLQLPSAELVPA  199


 Score = 79.0 bits (193),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK ++ SRR+S+R++FYS+L FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVKVGSRRLSYRMLFYSILFFTFLLRFVFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS IGC G+++ P I 
Sbjct  61   IDGESKCSSIGCLGKRLGPKIL  82



>ref|XP_011650537.1| PREDICTED: probable galacturonosyltransferase 12 isoform X1 [Cucumis 
sativus]
 gb|KGN56159.1| hypothetical protein Csa_3G081360 [Cucumis sativus]
Length=534

 Score =   158 bits (399),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPET-PQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LG +LE  +P+V+Y +L++P ++ E+Q   +  PQTLED +AE K  +PDAKTFA KL+ 
Sbjct  82    LGSRLEPKVPDVMYQILDKPMSKDELQGRLDNIPQTLEDFMAEIKEIKPDAKTFALKLRK  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M++ +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  142   MVSLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  201


 Score = 77.0 bits (188),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+E+IK ++ SR+VS R++ YSLL FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREYIKVKVGSRKVSCRMLIYSLLFFTFLLRFVFVLTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS +GC G+K+ P + 
Sbjct  61   IDGESKCSTLGCLGKKLGPRLL  82



>ref|XP_009358091.1| PREDICTED: probable galacturonosyltransferase 12 [Pyrus x bretschneideri]
Length=532

 Score =   156 bits (395),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ ES +PEVIY +LEEP  + E+Q   + PQ+L++ + E K  + DA+TFA KL+ M
Sbjct  82    LGRR-ESRVPEVIYQILEEPIGKHELQGRSDIPQSLDEFMVEIKDGKLDARTFAVKLREM  140

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LANEH+SNA ARLQLPS ELVP+
Sbjct  141   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLANEHASNAAARLQLPSAELVPA  199


 Score = 78.6 bits (192),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK ++  RR+S+R++FYS+L FTFLLRF F+ TAVDT
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVKVGLRRLSYRMLFYSILFFTFLLRFAFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS +GC G+++ P I 
Sbjct  61   IDGESKCSSLGCLGKRLGPKIL  82



>ref|XP_003540419.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN27977.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   157 bits (398),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ EST+ EVIY  L+EP  + E+Q   + PQTLE+ + E K    DAKTFA KL+ M
Sbjct  82    LGRRPESTVLEVIYQTLDEPVGKNELQGRSDIPQTLEEFMTEMKKGGYDAKTFAVKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR AKIQEYLYRHVAS+SIPKQLHCLSL LANEH++NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTRMAKIQEYLYRHVASSSIPKQLHCLSLTLANEHTNNAAARLQLPSAELVPA  200


 Score = 75.9 bits (185),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P+KG KEFIK ++ SRRVS+R++FYSLL FTFLLRFVF+ TAVD 
Sbjct  1    MQLHISPSLRHVTVFPSKGFKEFIKVKVASRRVSYRMLFYSLLFFTFLLRFVFVLTAVDG  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KC+ IGC G+K+ P I 
Sbjct  61   IDGENKCTTIGCLGKKLGPRIL  82



>ref|XP_004294339.1| PREDICTED: probable galacturonosyltransferase 12 [Fragaria vesca 
subsp. vesca]
Length=533

 Score =   160 bits (404),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+LES++PEV+Y VLEEP  + E++   + PQ+L++ +AE K    DA+TFA KL+ M
Sbjct  82    LGRRLESSVPEVVYQVLEEPIGKDELKGRSDIPQSLDEFMAEIKDSNIDARTFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             I  LE+ TR AKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS E VP+
Sbjct  142   ITLLEERTRNAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAEFVPA  200


 Score = 73.2 bits (178),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P K V+EFIK ++ SRR+S+R++FYS+L FTF+LRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVFPGKEVREFIKVKVGSRRLSYRMLFYSILFFTFILRFVFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE++CS IGC G+++ P I 
Sbjct  61   IDGETRCSTIGCLGKRLGPRIL  82



>ref|XP_007149694.1| hypothetical protein PHAVU_005G091200g [Phaseolus vulgaris]
 gb|ESW21688.1| hypothetical protein PHAVU_005G091200g [Phaseolus vulgaris]
Length=533

 Score =   157 bits (396),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ EST+PEVIY  L EP  + E+Q   + PQTLE+ + E K    DAKTFA KL+ M
Sbjct  82    LGRRSESTVPEVIYQTLNEPLGKLELQGRFDIPQTLEEFMTEMKSGGYDAKTFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +E+ TR AKIQEYLYRHVAS+SIPKQLHCLSL LANEH++NA ARLQLPS ELVP+
Sbjct  142   VTLMEERTRMAKIQEYLYRHVASSSIPKQLHCLSLSLANEHTNNAAARLQLPSAELVPA  200


 Score = 75.9 bits (185),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KG KEFIK ++ SRRVS+R++FY LL FTFLLRFVF+ TAVD 
Sbjct  1    MQLHISPSLRHVTVFPGKGFKEFIKVKVASRRVSYRMLFYFLLFFTFLLRFVFVLTAVDG  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS IGC G+K+ P I 
Sbjct  61   IDGENKCSTIGCLGKKLGPRIL  82



>ref|XP_010060438.1| PREDICTED: probable galacturonosyltransferase 12 [Eucalyptus 
grandis]
 gb|KCW67210.1| hypothetical protein EUGRSUZ_F00995 [Eucalyptus grandis]
Length=533

 Score =   158 bits (400),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             L R+LE  +PEVIY +L++P +E E++   E PQTLED + E K  R DAK FA +L+ M
Sbjct  82    LHRRLEPAVPEVIYQILDKPVSEDELKGKSEIPQTLEDFVTEMKESRSDAKAFALRLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQL+CL+L LANEHS+NA ARLQLPS E VP+
Sbjct  142   VTLLEQRTRTAKIQEYLYRHVASSSIPKQLYCLTLKLANEHSTNAAARLQLPSAEFVPA  200


 Score = 73.9 bits (180),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFI  ++ SRR S+R++FY LLLFTFLLR +F+ TAVD 
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFINVKVGSRRFSYRMLFYMLLLFTFLLRVIFVMTAVDG  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
             DGE KCS IGC G+K+ P I  +
Sbjct  61   FDGERKCSSIGCLGKKLGPKILHR  84



>ref|XP_008463444.1| PREDICTED: probable galacturonosyltransferase 12 [Cucumis melo]
Length=534

 Score =   154 bits (390),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 97/120 (81%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPET-PQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LG +LE  +P+V+Y +L++  ++ E+Q   +  PQTLED +AE K  +PDAKTFA KL+ 
Sbjct  82    LGSRLEPKVPDVMYQILDKTMSKDELQGRLDNIPQTLEDFMAEIKEIKPDAKTFALKLRE  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M++ +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  142   MVSLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  201


 Score = 77.0 bits (188),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+E+IK ++ SRRVS R++ YSLL FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREYIKVKVGSRRVSCRMLIYSLLFFTFLLRFVFVLTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS +GC G+K+ P + 
Sbjct  61   IDGESKCSTLGCLGKKLGPRLL  82



>ref|XP_010694261.1| PREDICTED: probable galacturonosyltransferase 12 [Beta vulgaris 
subsp. vulgaris]
Length=534

 Score =   157 bits (398),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANET-EIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR   S++PEV+Y V EEP+    E   G + PQ+LE+ +AE +  RPDA+TFA KLK 
Sbjct  82    LGRTSPSSVPEVLYEVFEEPSRVIDEKNPGSDIPQSLEEFMAEMRDSRPDARTFAVKLKT  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+N+LEQ TRTAKIQEYLYRHVAS+SIPKQL+CL+L LANEHS N+ ARLQLP+PE VP
Sbjct  142   MVNYLEQRTRTAKIQEYLYRHVASSSIPKQLYCLTLRLANEHSMNSAARLQLPNPEQVP  200


 Score = 72.4 bits (176),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK +  S+R S+R+V YSLL FTFLLRFVF+ TAV+T
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVKAGSKRFSYRMVLYSLLFFTFLLRFVFVMTAVET  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDG+  CS +GC G+++ P I 
Sbjct  61   IDGQRNCSSLGCLGKRLAPRIL  82



>gb|KHG21333.1| putative galacturonosyltransferase 12 -like protein [Gossypium 
arboreum]
Length=534

 Score =   162 bits (411),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR++ES +PEVIY +LEEP ++ E+    + PQTL++ ++E K  R DAK FA +L+ M
Sbjct  83    LGRRIESIVPEVIYRILEEPVSKDEVLGKTDVPQTLQEFMSEMKQSRSDAKAFALRLREM  142

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             I  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  143   IVLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSNNAAARLQLPSAELVPA  201


 Score = 67.4 bits (163),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SR+VS+R++FYSLL FTFLLRF+F+ + +D+
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRKVSYRMLFYSLLFFTFLLRFIFVLSTIDS  60

Query  810  IDGES-KCSGIGCFGRKIRPSIF  875
            IDG+  KCS IGC G++I P I 
Sbjct  61   IDGDHPKCSTIGCLGKRIGPRIL  83



>ref|XP_009355580.1| PREDICTED: probable galacturonosyltransferase 12 [Pyrus x bretschneideri]
Length=532

 Score =   155 bits (392),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR  ES +PEVIY +LEEP  + E+Q   + PQTL++ + E K  + DA TFA KL+ M
Sbjct  82    LGRT-ESRVPEVIYQILEEPIGKHELQGRSDIPQTLDEFMVEIKDGKSDATTFAVKLREM  140

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEY YRHVAS+SIPKQLHCL+L LANEH+SNA ARLQLPS ELVP+
Sbjct  141   VTLLEQRTRNAKIQEYFYRHVASSSIPKQLHCLALRLANEHASNAAARLQLPSAELVPA  199


 Score = 74.3 bits (181),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P K V+EFIK ++ SRR+S+R++FYS+L FTFLLRFVF+ T VDT
Sbjct  1    MQLHISPSLRHVTVFPGKEVREFIKVKVGSRRLSYRMLFYSILFFTFLLRFVFVMTVVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS IGC G+++ P I 
Sbjct  61   IDGESKCSSIGCLGKRLGPKIL  82



>ref|XP_004505434.1| PREDICTED: probable galacturonosyltransferase 12-like isoform 
X1 [Cicer arietinum]
Length=533

 Score =   159 bits (403),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+LEST+PE IY +L++P  + E++   + PQTLE+ + E K    DA+TFA KL+ M
Sbjct  82    LGRKLESTVPEEIYGILDQPIGKDELERRSDIPQTLEEFMTEMKKGGYDARTFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             + F+EQ TR AKIQEYLYRHVAS+SIPKQLHCL L LANEH++NA ARLQLPS ELVP+
Sbjct  142   VTFMEQRTRMAKIQEYLYRHVASSSIPKQLHCLDLRLANEHTNNAEARLQLPSAELVPA  200


 Score = 70.5 bits (171),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M L ISPSLRHVT+LP KG++EFIK RI SRR+S+R++FY LL FTFLLRFVF+ TAVD 
Sbjct  1    MLLQISPSLRHVTLLPGKGLREFIKVRIASRRLSYRILFYLLLFFTFLLRFVFVLTAVDG  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS IGC G K+RP I 
Sbjct  61   IDGENKCSTIGCLGIKLRPKIL  82



>ref|XP_011048284.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
Length=533

 Score =   157 bits (398),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+L+S +PEV++ VLE+P    E++   + PQTLE+ + E K  R DAKTFA KL+ M
Sbjct  82    LGRRLDSAVPEVMFQVLEQPLGNDELKGRSDIPQTLEEFMDEVKNTRLDAKTFALKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+NA ARLQLP PELVP+
Sbjct  142   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLASEHSTNAAARLQLPLPELVPA  200


 Score = 71.6 bits (174),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK R+ +RRVS+R++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVRVGARRVSYRMLFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS +GC G+++ P I 
Sbjct  61   IDGETKCSTLGCLGKRLGPRIL  82



>ref|XP_012070727.1| PREDICTED: probable galacturonosyltransferase 12 [Jatropha curcas]
 gb|KDP39045.1| hypothetical protein JCGZ_00802 [Jatropha curcas]
Length=532

 Score =   154 bits (388),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 97/119 (82%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+++S +P+V+Y VL+EP  + +++   + PQTLE+ + E K  + DAK+FA KL+ M
Sbjct  82    LGRRIDS-VPDVMYQVLQEPLGQDDLKGRNDIPQTLEEFMEEVKETKLDAKSFALKLREM  140

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLP+PELVP+
Sbjct  141   VTLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPTPELVPA  199


 Score = 75.5 bits (184),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++  +RVS+R++FYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGGKRVSYRMLFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGESKCS +GC G+++ P I 
Sbjct  61   IDGESKCSSLGCLGKRLGPRIL  82



>ref|XP_006370613.1| hypothetical protein POPTR_0001s44250g [Populus trichocarpa]
 gb|ERP67182.1| hypothetical protein POPTR_0001s44250g [Populus trichocarpa]
Length=533

 Score =   157 bits (397),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+L+S +PEV++ VLE+P    E++   + PQTLE+ + E K  R DAKTFA KL+ M
Sbjct  82    LGRRLDSAVPEVMFQVLEQPLGNDELKGRSDIPQTLEEFMDEVKNTRLDAKTFALKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+NA ARLQLP PELVP+
Sbjct  142   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLASEHSTNAAARLQLPLPELVPA  200


 Score = 71.6 bits (174),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK R+ +RRVS+R++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVRVGARRVSYRMLFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS +GC G+++ P I 
Sbjct  61   IDGETKCSTLGCLGKRLGPRIL  82



>gb|AFK39430.1| unknown [Medicago truncatula]
Length=541

 Score =   151 bits (381),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ EST+PEVIY  L+EP    E++   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  91    LGRRPESTVPEVIYQTLDEPLGNDELKGRFDIPQTLEEFMVKMKEGGYDAKTFAVKLREM  150

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR AKIQEYLYRHVAS+SIPKQLHCL L LA+EH++NA ARLQLPS ELVP+
Sbjct  151   VTLMEQRTRLAKIQEYLYRHVASSSIPKQLHCLDLRLAHEHTNNAAARLQLPSAELVPA  209


 Score = 77.8 bits (190),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  624  SEMQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            ++MQLHISPSLRHVTVLP KG+KEFIK ++ SRR+S+R++FYSLL FTFLLRFVF+ TAV
Sbjct  8    NKMQLHISPSLRHVTVLPGKGLKEFIKVKVASRRLSYRMLFYSLLFFTFLLRFVFVLTAV  67

Query  804  DTIDGESKCSGIGCFGRKIRPSIF  875
            D IDG++KCS IGC G+K+ P I 
Sbjct  68   DGIDGQNKCSSIGCLGKKLGPRIL  91



>ref|XP_003596615.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES66866.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=541

 Score =   151 bits (381),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ EST+PEVIY  L+EP    E++   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  91    LGRRPESTVPEVIYQTLDEPLGNDELKGRFDIPQTLEEFMVKMKEGGYDAKTFAVKLREM  150

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR AKIQEYLYRHVAS+SIPKQLHCL L LA+EH++NA ARLQLPS ELVP+
Sbjct  151   VTLMEQRTRLAKIQEYLYRHVASSSIPKQLHCLDLRLAHEHTNNAAARLQLPSAELVPA  209


 Score = 77.8 bits (190),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  624  SEMQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            ++MQLHISPSLRHVTVLP KG+KEFIK ++ SRR+S+R++FYSLL FTFLLRFVF+ TAV
Sbjct  8    NKMQLHISPSLRHVTVLPGKGLKEFIKVKVASRRLSYRMLFYSLLFFTFLLRFVFVLTAV  67

Query  804  DTIDGESKCSGIGCFGRKIRPSIF  875
            D IDG++KCS IGC G+K+ P I 
Sbjct  68   DGIDGQNKCSSIGCLGKKLGPRIL  91



>ref|XP_008775923.1| PREDICTED: probable galacturonosyltransferase 12 isoform X2 [Phoenix 
dactylifera]
Length=531

 Score =   156 bits (395),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  865   RVYLGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             R++ GR+LEST+PE IY VLEE   E   + G + PQTLED +AE K +R DAKTFA +L
Sbjct  80    RIW-GRRLESTVPEEIYRVLEEGEIEEPER-GSDIPQTLEDFVAEMKSNRSDAKTFALRL  137

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELV  1224
             KAM++ LEQ TRTAKIQEYLYRHVAS SIPKQL+CL+L LA EHS+N+ ARL+LP+PE V
Sbjct  138   KAMVSLLEQRTRTAKIQEYLYRHVASTSIPKQLYCLALKLAQEHSTNSGARLRLPAPEWV  197

Query  1225  PS  1230
             P+
Sbjct  198   PA  199


 Score = 68.2 bits (165),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+RHVTVLP KGV++FIK +  SR++S+++VFYSLL  TFLLRFVF+  A+DT
Sbjct  1    MQLQISPSMRHVTVLPGKGVRDFIKVKGTSRKLSYKMVFYSLLFVTFLLRFVFVLMAMDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            I+GE++CS +GC G+K+ P I+
Sbjct  61   IEGETECSSLGCVGKKLGPRIW  82



>gb|ACJ85767.1| unknown [Medicago truncatula]
Length=206

 Score =   146 bits (369),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ EST+PEVIY  L+EP    E++   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  91    LGRRPESTVPEVIYQTLDEPLGNDELKGRFDIPQTLEEFMVKMKEGGYDAKTFAVKLREM  150

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             +  +EQ TR AKIQEYLYRHVAS+SIPKQLHCL L LA+EH++NA ARLQLPS EL
Sbjct  151   VTLMEQRTRLAKIQEYLYRHVASSSIPKQLHCLDLRLAHEHTNNAAARLQLPSAEL  206


 Score = 77.8 bits (190),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  624  SEMQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            ++MQLHISPSLRHVTVLP KG+KEFIK ++ SRR+S+R++FYSLL FTFLLRFVF+ TAV
Sbjct  8    NKMQLHISPSLRHVTVLPGKGLKEFIKVKVASRRLSYRMLFYSLLFFTFLLRFVFVLTAV  67

Query  804  DTIDGESKCSGIGCFGRKIRPSIF  875
            D IDG++KCS IGC G+K+ P I 
Sbjct  68   DGIDGQNKCSSIGCLGKKLGPRIL  91



>emb|CAN78125.1| hypothetical protein VITISV_028754 [Vitis vinifera]
Length=553

 Score =   166 bits (421),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG + ES +PEV+Y +L+EPA++ EIQ   + PQTLE+  AE K  R DA+ FA KL+AM
Sbjct  102   LGGRHESPVPEVMYQILDEPASKDEIQGRDDIPQTLEEFTAEVKESRSDARAFAIKLRAM  161

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NANARLQLPS ELVP
Sbjct  162   VTLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNANARLQLPSAELVP  219


 Score = 57.8 bits (138),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 69/102 (68%), Gaps = 20/102 (20%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SRRVS+R+VFYSLL FTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRRVSYRMVFYSLLFFTFLLRFVFVLTAVDT  60

Query  810  IDGESK--------------------CSGIGCFGRKIRPSIF  875
            IDGE+                      +  GC G+++ P I 
Sbjct  61   IDGETNKMAANMRKXSPENESFSRETVNXSGCLGKRLGPRIL  102



>ref|XP_004487615.1| PREDICTED: probable galacturonosyltransferase 12-like [Cicer 
arietinum]
Length=533

 Score =   150 bits (379),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR  EST+PEVIY  L+EP    E++   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  82    LGRLPESTVPEVIYQTLDEPLGNDELKGRSDIPQTLEEFMVKMKEGGYDAKTFAVKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR AKIQEYLYRHVAS+SIPKQLHCL L LA+EH++NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTRLAKIQEYLYRHVASSSIPKQLHCLDLRLAHEHTNNAAARLQLPSAELVPA  200


 Score = 72.8 bits (177),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVL  KG+KEF+K ++ SRRVS+R++FYSLL FTFLLRFVF+ TAVD 
Sbjct  1    MQLHISPSLRHVTVLQGKGLKEFMKVKVASRRVSYRMLFYSLLFFTFLLRFVFVLTAVDG  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS IGC G+K+ P I 
Sbjct  61   IDGENKCSTIGCLGKKLGPRIL  82



>gb|KJB81833.1| hypothetical protein B456_013G164000 [Gossypium raimondii]
Length=446

 Score =   152 bits (385),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR +ES +PEVIY +L+E  +E E++   + PQTL D +A+ K   PDAK FA KL+ M
Sbjct  83    LGR-MESNVPEVIYQILDEAISEEEVEPKSDIPQTLHDFMADIKQTTPDAKAFALKLRQM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPK LHCL+L LANEHS+NA ARLQLPS +LVP+
Sbjct  142   VLLLEQKTRKAKIQEYLYRHVASSSIPKHLHCLALKLANEHSNNAAARLQLPSTDLVPT  200


 Score = 69.3 bits (168),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPSLRHVTV P KGV+EFIK RI SR VS+R++FYSLL FTFLLRF+F+F+ VDT
Sbjct  1    MQLHVSPSLRHVTVFPGKGVREFIKVRIGSRWVSYRMLFYSLLFFTFLLRFIFVFSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF  875
            IDG+ SKCS IGC G++I P I 
Sbjct  61   IDGDLSKCSTIGCLGKRIGPRIL  83



>ref|XP_008800493.1| PREDICTED: probable galacturonosyltransferase 12 [Phoenix dactylifera]
Length=532

 Score =   149 bits (376),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = +1

Query  865   RVYLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAK  1041
             R++ GR+LES  +PE IY VLEE   E       + PQTLED +AE K +R DAKTFA +
Sbjct  80    RIW-GRRLESLKVPEEIYRVLEEGEIEEPEPGS-DIPQTLEDFVAEMKSNRSDAKTFALR  137

Query  1042  LKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             LK+MI+ LEQ TRTAKIQEYLYRHVAS SIPKQLHCL+L LA EHS+NA ARLQLP+PE 
Sbjct  138   LKSMISLLEQRTRTAKIQEYLYRHVASTSIPKQLHCLALRLAQEHSTNAGARLQLPAPER  197

Query  1222  VPS  1230
             VP+
Sbjct  198   VPA  200


 Score = 72.4 bits (176),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+RHVTV P KGV++FIK ++  R++S+R+VFYSLL  T LLRFVF+ TA+DT
Sbjct  1    MQLHISPSMRHVTVFPGKGVRDFIKVKVAPRKLSYRMVFYSLLFVTLLLRFVFVLTAIDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            I+GE++CS +GC G+K+ P I+
Sbjct  61   IEGETECSSLGCVGKKVGPRIW  82



>gb|KHG10223.1| putative galacturonosyltransferase 12 -like protein [Gossypium 
arboreum]
Length=534

 Score =   152 bits (385),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR +ES +PEVIY +L+E  +E E++   + PQTL+D +A+ K   PDAK FA KL+ M
Sbjct  83    LGR-MESNVPEVIYQILDEAISEEEVEPKSDIPQTLQDFMADIKQTTPDAKAFALKLRQM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPK LHCL+L LANEHS+NA ARLQLPS +LVP+
Sbjct  142   VLLLEQRTRKAKIQEYLYRHVASSSIPKHLHCLALKLANEHSNNAAARLQLPSADLVPT  200


 Score = 68.9 bits (167),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPSLRHVTV P KGV+EFIK RI SR +S+R++FYSLL FTFLLRF+F+F+ VDT
Sbjct  1    MQLHVSPSLRHVTVFPGKGVREFIKVRIGSRWISYRMLFYSLLFFTFLLRFIFVFSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF  875
            IDG+ SKCS IGC G++I P I 
Sbjct  61   IDGDPSKCSTIGCLGKRIGPRIL  83



>ref|XP_010908149.1| PREDICTED: probable galacturonosyltransferase 12 [Elaeis guineensis]
Length=532

 Score =   150 bits (378),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = +1

Query  865   RVYLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAK  1041
             R++ GR+LEST +PE IY +LEE   E       + PQTLED IAE K +R DAKTFA +
Sbjct  80    RIW-GRRLESTKVPEEIYRILEEGEIEEPEPGS-DIPQTLEDFIAEMKSNRSDAKTFALR  137

Query  1042  LKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             LK+MI+ LEQ TRTAKIQEYLYRHVAS SIPKQLHCL+L LA EHS+NA ARLQLP PE 
Sbjct  138   LKSMISLLEQRTRTAKIQEYLYRHVASASIPKQLHCLALRLAQEHSTNAGARLQLPVPER  197

Query  1222  VPS  1230
             VP+
Sbjct  198   VPA  200


 Score = 71.6 bits (174),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+RHVTV P KGV++FIK ++  R++S+R+VFYSLL  T LLRFVF+ TA+DT
Sbjct  1    MQLHISPSMRHVTVFPGKGVRDFIKVKVTPRKLSYRMVFYSLLFVTLLLRFVFVLTAIDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            I+GE+ CS +GC G+K+ P I+
Sbjct  61   IEGETDCSSLGCVGKKLGPRIW  82



>gb|KJB81832.1| hypothetical protein B456_013G164000 [Gossypium raimondii]
Length=533

 Score =   152 bits (384),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR +ES +PEVIY +L+E  +E E++   + PQTL D +A+ K   PDAK FA KL+ M
Sbjct  83    LGR-MESNVPEVIYQILDEAISEEEVEPKSDIPQTLHDFMADIKQTTPDAKAFALKLRQM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPK LHCL+L LANEHS+NA ARLQLPS +LVP+
Sbjct  142   VLLLEQKTRKAKIQEYLYRHVASSSIPKHLHCLALKLANEHSNNAAARLQLPSTDLVPT  200


 Score = 69.3 bits (168),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 1/83 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPSLRHVTV P KGV+EFIK RI SR VS+R++FYSLL FTFLLRF+F+F+ VDT
Sbjct  1    MQLHVSPSLRHVTVFPGKGVREFIKVRIGSRWVSYRMLFYSLLFFTFLLRFIFVFSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF  875
            IDG+ SKCS IGC G++I P I 
Sbjct  61   IDGDLSKCSTIGCLGKRIGPRIL  83



>ref|XP_008775922.1| PREDICTED: probable galacturonosyltransferase 12 isoform X1 [Phoenix 
dactylifera]
Length=532

 Score =   152 bits (383),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  865   RVYLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAK  1041
             R++ GR+LEST +PE IY VLEE   E   + G + PQTLED +AE K +R DAKTFA +
Sbjct  80    RIW-GRRLESTKVPEEIYRVLEEGEIEEPER-GSDIPQTLEDFVAEMKSNRSDAKTFALR  137

Query  1042  LKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             LKAM++ LEQ TRTAKIQEYLYRHVAS SIPKQL+CL+L LA EHS+N+ ARL+LP+PE 
Sbjct  138   LKAMVSLLEQRTRTAKIQEYLYRHVASTSIPKQLYCLALKLAQEHSTNSGARLRLPAPEW  197

Query  1222  VPS  1230
             VP+
Sbjct  198   VPA  200


 Score = 68.2 bits (165),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+RHVTVLP KGV++FIK +  SR++S+++VFYSLL  TFLLRFVF+  A+DT
Sbjct  1    MQLQISPSMRHVTVLPGKGVRDFIKVKGTSRKLSYKMVFYSLLFVTFLLRFVFVLMAMDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            I+GE++CS +GC G+K+ P I+
Sbjct  61   IEGETECSSLGCVGKKLGPRIW  82



>ref|XP_002317564.1| hypothetical protein POPTR_0011s13600g [Populus trichocarpa]
 gb|EEE98176.1| hypothetical protein POPTR_0011s13600g [Populus trichocarpa]
Length=532

 Score =   147 bits (372),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+L+S +PEV+Y VLE+P +  E++   + PQTLE+ + E K    DAK FA KL+ M
Sbjct  82    LGRRLDSAVPEVMYQVLEQPLDNDELKGRDDIPQTLEEFMDEVKNSIFDAKAFALKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TR AKIQEYLYRHVAS+SIPKQL CL+L LA+EHS+NA AR QLP PELVP+
Sbjct  142   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLLCLALRLAHEHSTNAAARRQLPLPELVPA  200


 Score = 69.7 bits (169),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP  GV+EFIK ++ +RRVS+R++FYSLL FTFLLRFVFL +  DT
Sbjct  1    MQLHISPSLRHVTVLPGNGVREFIKVKVRARRVSYRMLFYSLLFFTFLLRFVFLLSTADT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ID E+KCS +GC G+++ P I 
Sbjct  61   IDAETKCSTLGCLGKRLGPRIL  82



>ref|XP_011030886.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
 ref|XP_011030887.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
 ref|XP_011030888.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
 ref|XP_011030889.1| PREDICTED: probable galacturonosyltransferase 12 [Populus euphratica]
Length=533

 Score =   148 bits (373),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+L S +PEVIY VLE+P +  E++   + PQTLE+ + E K    DAK+FA KL+ M
Sbjct  82    LGRRLASAVPEVIYQVLEQPLDNDELKGRDDIPQTLEEFMDEVKNSIFDAKSFALKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             +  LEQ TR AKIQEYLYRHVAS+SIPKQL CL+L LA+EHS+NA AR QLP PELVP
Sbjct  142   VTLLEQRTRNAKIQEYLYRHVASSSIPKQLLCLALRLAHEHSTNAAARRQLPLPELVP  199


 Score = 68.6 bits (166),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPSLRHVTVLP  GV+EFIK ++ +RRVS+R++FYSLL FTF+LRFVFL +  DT
Sbjct  1    MQLHVSPSLRHVTVLPGNGVREFIKVKVRARRVSYRMLFYSLLFFTFILRFVFLLSTADT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ID E+KCS +GC G+++ P + 
Sbjct  61   IDAETKCSTLGCLGKRLGPRLL  82



>ref|XP_006401545.1| hypothetical protein EUTSA_v10013202mg [Eutrema salsugineum]
 gb|ESQ42998.1| hypothetical protein EUTSA_v10013202mg [Eutrema salsugineum]
Length=537

 Score =   152 bits (383),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +1

Query  874   LGRQL--ESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR++     +PE +Y VLE+P NE E++   + PQTL+D ++E K  + DA+ FA KLK
Sbjct  83    LGRRVVESGNVPEAMYQVLEQPLNEQELKGRSDIPQTLQDFMSEVKRSKSDAREFAQKLK  142

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
              M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP
Sbjct  143   EMVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAAARLQLPDAELVP  202

Query  1228  S  1230
             +
Sbjct  203   T  203


 Score = 61.6 bits (148),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF  875
            IDG+ S CS + C G++++P + 
Sbjct  61   IDGDPSPCSSLACLGKRLKPKLL  83



>ref|XP_010931276.1| PREDICTED: probable galacturonosyltransferase 12 [Elaeis guineensis]
Length=532

 Score =   144 bits (362),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  865   RVYLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAK  1041
             R++ GR+LEST +PE IY VLEE   E       + PQTLED +AE K +  DAKTFA +
Sbjct  80    RIW-GRRLESTKVPEEIYRVLEEGEIEEPEPGS-DIPQTLEDFVAEMKNNISDAKTFALR  137

Query  1042  LKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             LKAMI+ LE+ TRTAKIQEYLYRHVAS SIPKQLHCL+L LA EHS+N+ ARLQLP+P  
Sbjct  138   LKAMISLLERRTRTAKIQEYLYRHVASASIPKQLHCLALRLAQEHSTNSGARLQLPAPAR  197

Query  1222  VPS  1230
             VP+
Sbjct  198   VPA  200


 Score = 69.3 bits (168),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+RHVTV P KGV++FIK ++ SR++S++VVFYSLL  TFLLRFVF+ TA+DT
Sbjct  1    MQLQISPSMRHVTVFPGKGVRDFIKVKVTSRKLSYKVVFYSLLFVTFLLRFVFVLTAIDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            I+GE++CS +GC G+K+ P I+
Sbjct  61   IEGETECSSLGCVGKKLGPRIW  82



>gb|EYU33598.1| hypothetical protein MIMGU_mgv1a004326mg [Erythranthe guttata]
Length=533

 Score =   172 bits (437),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ E+ +PEVIY VLE PA++ E Q  PE  QTLED IA+ K +RPDAKTFA KLK+M
Sbjct  82    LGRRFETDVPEVIYQVLENPADQNEKQSEPEIHQTLEDFIAQMKEERPDAKTFAIKLKSM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             + FLEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANE+S+NA ARL+LPS   VP+
Sbjct  142   VTFLEQKTRTAKIQEYLYRHVASSSIPKQLHCLTLKLANEYSTNAKARLKLPSANYVPA  200


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KG +EFIK +  SR++S+R+VFYSLLL TFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVLPAKGFREFIKVKNGSRKLSYRMVFYSLLLVTFLLRFVFVLTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPRSDIQCIGGTSKRNRDTS  956
            IDGE KCS IGC G+K+ P I  +    + P    Q +   + +N   S
Sbjct  61   IDGERKCSTIGCLGKKLGPRILGRRFETDVPEVIYQVLENPADQNEKQS  109



>gb|KJB13572.1| hypothetical protein B456_002G082100 [Gossypium raimondii]
Length=348

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR++ES +PEVIY +LEEP ++ E+    + PQTL++ ++E K  R DAK FA +L+ M
Sbjct  83    LGRRIESNVPEVIYRILEEPVSKDEVLGKTDVPQTLQEFMSEMKQSRSDAKAFALRLREM  142

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             I  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  143   IVLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSNNAAARLQLPSAELVPA  201


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SR+VS+R++FYSLL FTFLLRFVF+ + +D+
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRKVSYRMLFYSLLFFTFLLRFVFVLSTIDS  60

Query  810  IDGES-KCSGIGCFGRKIRPSIFRKAA*INTP  902
            IDG+  KCS IGC G++I P I  +    N P
Sbjct  61   IDGDHPKCSTIGCLGKRIGPRILGRRIESNVP  92



>ref|XP_007021085.1| Glycosyltransferase, CAZy family GT8 [Theobroma cacao]
 gb|EOY12610.1| Glycosyltransferase, CAZy family GT8 [Theobroma cacao]
Length=533

 Score =   167 bits (422),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR++ES +PEVIY VL EP ++ E+Q   + PQTLE+ +AE K  R DAK FA +L+ M
Sbjct  82    LGRRIESNVPEVIYQVLNEPVSKDEVQGKTDVPQTLEEFMAEMKESRSDAKAFALRLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  142   VVLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSTNAAARLQLPSAELVPA  200


 Score = 77.0 bits (188),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SRRVS+R++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRRVSYRMLFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPRSDIQCIG  926
            IDGE+KCS IGC G++I P I  +    N P    Q + 
Sbjct  61   IDGETKCSTIGCLGKRIGPRILGRRIESNVPEVIYQVLN  99



>gb|KDO46375.1| hypothetical protein CISIN_1g007529mg [Citrus sinensis]
Length=474

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ +ST+PEVIY +LEEP ++ E++   + PQTLE+ +A+ K  + DAKTFA KL+ M
Sbjct  23    LGRRPQSTVPEVIYQILEEPMSKDELKGRSDIPQTLEEFMADMKESKSDAKTFAIKLRDM  82

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  83    VTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  141



>gb|KJB13573.1| hypothetical protein B456_002G082100 [Gossypium raimondii]
Length=455

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR++ES +PEVIY +LEEP ++ E+    + PQTL++ ++E K  R DAK FA +L+ M
Sbjct  83    LGRRIESNVPEVIYRILEEPVSKDEVLGKTDVPQTLQEFMSEMKQSRSDAKAFALRLREM  142

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             I  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  143   IVLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSNNAAARLQLPSAELVPA  201


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SR+VS+R++FYSLL FTFLLRFVF+ + +D+
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRKVSYRMLFYSLLFFTFLLRFVFVLSTIDS  60

Query  810  IDGES-KCSGIGCFGRKIRPSIFRKAA*INTPR  905
            IDG+  KCS IGC G++I P I  +    N P 
Sbjct  61   IDGDHPKCSTIGCLGKRIGPRILGRRIESNVPE  93



>ref|XP_010092313.1| putative galacturonosyltransferase 12 [Morus notabilis]
 gb|EXB50947.1| putative galacturonosyltransferase 12 [Morus notabilis]
Length=533

 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ ES +PEVI+ VLEEP ++ E+Q   + PQTLE+ +A+ K  + DAK+FA KL+ M
Sbjct  82    LGRRHESNVPEVIFEVLEEPISKDELQGRSDIPQTLEEFMADIKDSKIDAKSFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEH++NANARLQLP  ELVP+
Sbjct  142   VTLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHTTNANARLQLPPAELVPA  200


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK ++ SRRVS+R++FY+LLLFTFLLRFVF+ TAVDT
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVKVGSRRVSYRMLFYALLLFTFLLRFVFVMTAVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPR  905
            IDGE+KCS IGC G+K+ P I  +    N P 
Sbjct  61   IDGETKCSSIGCLGKKLGPKILGRRHESNVPE  92



>gb|KJB13571.1| hypothetical protein B456_002G082100 [Gossypium raimondii]
Length=534

 Score =   162 bits (411),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR++ES +PEVIY +LEEP ++ E+    + PQTL++ ++E K  R DAK FA +L+ M
Sbjct  83    LGRRIESNVPEVIYRILEEPVSKDEVLGKTDVPQTLQEFMSEMKQSRSDAKAFALRLREM  142

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             I  LEQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  143   IVLLEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSNNAAARLQLPSAELVPA  201


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTVLP KGV+EFIK ++ SR+VS+R++FYSLL FTFLLRFVF+ + +D+
Sbjct  1    MQLHISPSLRHVTVLPGKGVREFIKVKVGSRKVSYRMLFYSLLFFTFLLRFVFVLSTIDS  60

Query  810  IDGES-KCSGIGCFGRKIRPSIFRKAA*INTPR  905
            IDG+  KCS IGC G++I P I  +    N P 
Sbjct  61   IDGDHPKCSTIGCLGKRIGPRILGRRIESNVPE  93



>ref|XP_004505435.1| PREDICTED: probable galacturonosyltransferase 12-like isoform 
X2 [Cicer arietinum]
Length=476

 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+LEST+PE IY +L++P  + E++   + PQTLE+ + E K    DA+TFA KL+ M
Sbjct  25    LGRKLESTVPEEIYGILDQPIGKDELERRSDIPQTLEEFMTEMKKGGYDARTFAIKLREM  84

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             + F+EQ TR AKIQEYLYRHVAS+SIPKQLHCL L LANEH++NA ARLQLPS ELVP+
Sbjct  85    VTFMEQRTRMAKIQEYLYRHVASSSIPKQLHCLDLRLANEHTNNAEARLQLPSAELVPA  143



>gb|KCW67211.1| hypothetical protein EUGRSUZ_F00995 [Eucalyptus grandis]
Length=465

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             L R+LE  +PEVIY +L++P +E E++   E PQTLED + E K  R DAK FA +L+ M
Sbjct  14    LHRRLEPAVPEVIYQILDKPVSEDELKGKSEIPQTLEDFVTEMKESRSDAKAFALRLREM  73

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  LEQ TRTAKIQEYLYRHVAS+SIPKQL+CL+L LANEHS+NA ARLQLPS E VP+
Sbjct  74    VTLLEQRTRTAKIQEYLYRHVASSSIPKQLYCLTLKLANEHSTNAAARLQLPSAEFVPA  132



>gb|EPS70108.1| hypothetical protein M569_04651 [Genlisea aurea]
Length=533

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LG   +ST+PE IY VL+EPAN +  + G E PQ+L+D +   +  +PDAKTFA++LK+M
Sbjct  82    LGTTQKSTVPEAIYQVLKEPANRSLPENGQEIPQSLQDFMILMEHKKPDAKTFASELKSM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             I  LE+ TRTAKI EYLYRHVAS+SIPKQLHCL L LANEHS+NANARLQLPS EL+P+
Sbjct  142   IKLLEERTRTAKIHEYLYRHVASSSIPKQLHCLMLRLANEHSTNANARLQLPSAELIPA  200


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 3/111 (3%)
 Frame = +3

Query  630  MQLHISPSLR-HVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVD  806
            M+LH+SPSLR H+ VLPTKG+KEF+K +    R       +   LF  L+        + 
Sbjct  2    MKLHMSPSLRKHIGVLPTKGLKEFVKVKAGGSRRWSYGAAFYSFLFFVLVLRFMFL--LT  59

Query  807  TIDGESKCSGIGCFGRKIRPSIFRKAA*INTPRSDIQCIGGTSKRNRDTSG  959
             +DGE+KCS IGC G+++ P I         P +  Q +   + R+   +G
Sbjct  60   AVDGETKCSVIGCLGQRLGPRILGTTQKSTVPEAIYQVLKEPANRSLPENG  110



>gb|ABP65660.1| secondary wall-associated glycosyltransferase family 8D [Populus 
tremula x Populus alba]
Length=533

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +1

Query  844   ALEEKYDRVYLGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDA  1023
              L E+     LGR+L+S +PEV++ VLE+P    E++   + PQTLE+ + E K  R DA
Sbjct  72    CLGERLGPRILGRRLDSAVPEVMFQVLEQPLGNDELKGRSDIPQTLEEFMDEVKNTRLDA  131

Query  1024  KTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KTFA KL+ M+  LEQ TR AKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+NA ARLQ
Sbjct  132   KTFAVKLREMVTLLEQRTRNAKIQEYLYRHVASSSIPKQLHCLALRLASEHSTNAAARLQ  191

Query  1204  LPSPELVPS  1230
             LP PELVP+
Sbjct  192   LPLPELVPA  200


 Score = 70.9 bits (172),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P KGV+EFIK R+ +RRVS+R++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVFPGKGVREFIKVRVGARRVSYRMLFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            IDGE+KCS +GC G ++ P I 
Sbjct  61   IDGETKCSTLGCLGERLGPRIL  82



>ref|XP_010475659.1| PREDICTED: probable galacturonosyltransferase 12 [Camelina sativa]
Length=247

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+++S  +PE +Y VL++P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRVDSGNVPEAMYQVLQQPLSEQELKGRTDIPQTLQDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLASEHSINAAARLQLPEAELVPT  202


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SR+ S++++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRKFSYQMMFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDGE S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGEPSPCSSLACLGKRLKPKLLGRRVDSGNVPEAMYQVL  100



>ref|XP_007132980.1| hypothetical protein PHAVU_011G141200g [Phaseolus vulgaris]
 gb|ESW04974.1| hypothetical protein PHAVU_011G141200g [Phaseolus vulgaris]
Length=533

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR LES +PEVIY +L++P  + E++   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  82    LGRSLESNVPEVIYGILDQPLGKDELEQRTDIPQTLEEFMVQIKEGGYDAKTFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR AK+QEYLYRHVAS+SIPKQLHCL L LANEH++NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTREAKVQEYLYRHVASSSIPKQLHCLGLKLANEHTNNAAARLQLPSAELVPA  200


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M L ISPSLRHVTVLP KG+KEFIK ++ SRR+S+R++FYSLL FTFLLRFVF+  AVD 
Sbjct  1    MLLQISPSLRHVTVLPGKGLKEFIKVKVASRRLSYRMLFYSLLFFTFLLRFVFVLKAVDN  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPR  905
            ID E+KCS IGC G+K+RP I  ++   N P 
Sbjct  61   IDRENKCSSIGCLGKKLRPKILGRSLESNVPE  92



>ref|XP_010539273.1| PREDICTED: probable galacturonosyltransferase 12 [Tarenaya hassleriana]
Length=535

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLE-STLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR++E S +PEV+Y VLEEP ++ E++   + PQTLED +++ K  + DA+ FA KL+ 
Sbjct  83    LGRRVEPSNVPEVMYHVLEEPLSQEELKGRSDVPQTLEDFMSQVKRTKSDAREFALKLRE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP+ ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSVNAAARLQLPAAELVPA  202


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M+L ISPSLR VTV+  KGV+EFIK ++ SR+ S++++FYSLL FTFLLRFVF+ ++VD+
Sbjct  1    MKLQISPSLRQVTVVTGKGVREFIKVKVGSRKFSYQMMFYSLLFFTFLLRFVFVLSSVDS  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPR  905
            ID + S CS + C G+++RP +  R+    N P 
Sbjct  61   IDADPSPCSSLACLGKRLRPKLLGRRVEPSNVPE  94



>ref|XP_003543290.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN36732.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR+ ES++PEVIY  L+E   + E+Q   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  82    LGRRPESSVPEVIYQTLDENLGKNELQGRSDIPQTLEEFMTDMKKGGYDAKTFAVKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR AKIQEYLYRHVAS+SIPKQLHCLSL LANEH++NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTRMAKIQEYLYRHVASSSIPKQLHCLSLSLANEHTNNAAARLQLPSAELVPA  200


 Score = 77.0 bits (188),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV P+KG KEFIK ++ S+RVS+R++FYSLL+FTFLLRFVF+ TAVD 
Sbjct  1    MQLHISPSLRHVTVFPSKGFKEFIKVKVASKRVSYRMLFYSLLVFTFLLRFVFVLTAVDG  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPRSDIQCIGGTSKRNR  947
            IDGE+KC+ IGC G+K+ P I  +    + P    Q +     +N 
Sbjct  61   IDGENKCTTIGCLGKKLGPRILGRRPESSVPEVIYQTLDENLGKNE  106



>emb|CDY41005.1| BnaA02g27950D [Brassica napus]
Length=534

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR++E+  +PE +Y VLE+P +E E++   + PQTLED I+E K  + DA+ FA KLK 
Sbjct  82    LGRRVETGNVPEAMYQVLEQPLSEEELKGRSDIPQTLEDFISEVKRSKSDAREFAQKLKE  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP+
Sbjct  142   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAAARLQLPEAELVPT  201


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLR VFL + VDT
Sbjct  1    MQLHISPSLRHVTVVKGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRLVFLLSTVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGASPCSSLACLGKRLKPKLLGRRVETGNVPEAMYQVL  99



>gb|KFK27082.1| hypothetical protein AALP_AA8G331600 [Arabis alpina]
Length=535

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+++S  +PE +Y VLE+P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRVDSGNVPEAMYQVLEQPLSEQELKGRSDIPQTLQDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAGARLQLPEAELVPT  202


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG+ S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGDPSPCSSLACLGKRLKPKLLGRRVDSGNVPEAMYQVL  100



>emb|CDY28757.1| BnaA02g09490D [Brassica napus]
Length=534

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR++E+  +PE +Y VLE+P  E E++   + PQTLED ++E K  + DA+ FA KLK 
Sbjct  82    LGRRVETGNVPEAMYQVLEQPLREEELKGRSDIPQTLEDFMSEVKRSKSDAREFAQKLKE  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP+
Sbjct  142   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAAARLQLPEAELVPT  201


 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLR VF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVKGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRLVFVLSTVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGASPCSSLACLGKRLKPKLLGRRVETGNVPEAMYQVL  99



>ref|XP_002866055.1| GAUT12/IRX8/LGT6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42314.1| GAUT12/IRX8/LGT6 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+++S  +PE +Y VLE+P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRVDSGNVPEAMYQVLEQPLSEQELKGRSDIPQTLQDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAAARLQLPEAELVP  201


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG+ S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGDPSPCSSLACLGKRLKPQLLGRRVDSGNVPEAMYQVL  100



>ref|NP_200280.1| probable galacturonosyltransferase 12 [Arabidopsis thaliana]
 sp|Q9FH36.1|GAUTC_ARATH RecName: Full=Probable galacturonosyltransferase 12; AltName: 
Full=Like glycosyl transferase 6; AltName: Full=Protein IRREGULAR 
XYLEM 8 [Arabidopsis thaliana]
 dbj|BAB09935.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAZ23921.1| At5g54690 [Arabidopsis thaliana]
 dbj|BAF01430.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96527.1| probable galacturonosyltransferase 12 [Arabidopsis thaliana]
 gb|AHL38578.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=535

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+++S  +PE +Y VLE+P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRVDSGNVPEAMYQVLEQPLSEQELKGRSDIPQTLQDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAAARLQLPEAELVP  201


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S+++VFYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMVFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG+ S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGDPSPCSSLACLGKRLKPKLLGRRVDSGNVPEAMYQVL  100



>ref|XP_003540035.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN20439.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   151 bits (381),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR LES +PEVIY +L++P  + E++   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  82    LGRSLESNVPEVIYGILDQPLGKDELEGRSDIPQTLEEFMTQMKEGGYDAKTFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR A +QEYLYRHVAS+ IPKQLHCL+L LANEH++NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTREAIVQEYLYRHVASSGIPKQLHCLALRLANEHTNNAAARLQLPSAELVPA  200


 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M L ISPSLRHVTVLP KG+KEFIK ++ SR++S+R++FYSLL FTFLLRFVF+ TAVD 
Sbjct  1    MLLQISPSLRHVTVLPGKGLKEFIKVKVASRKLSYRMLFYSLLFFTFLLRFVFVLTAVDN  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPR  905
            IDGE+KCS +GC G+K+RP I  ++   N P 
Sbjct  61   IDGENKCSSLGCLGKKLRPKILGRSLESNVPE  92



>ref|XP_006281668.1| hypothetical protein CARUB_v10027804mg [Capsella rubella]
 gb|EOA14566.1| hypothetical protein CARUB_v10027804mg [Capsella rubella]
Length=535

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+++S  +PE +Y VLE+P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRVDSGNVPEGMYQVLEQPLSEQELKGRTDIPQTLQDFMSEVKRSKADAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAAARLQLPEAELVPT  202


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDGE S CS + C G++++P +  R+    N P    Q +
Sbjct  61   IDGEPSPCSSLACLGKRLKPKLLGRRVDSGNVPEGMYQVL  100



>ref|XP_006582240.1| PREDICTED: probable galacturonosyltransferase 12-like [Glycine 
max]
 gb|KHN47844.1| Putative galacturonosyltransferase 12 [Glycine soja]
Length=533

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR LES +PEVIY +L++P  + E++   + PQTLE+ + + K    DAKTFA KL+ M
Sbjct  82    LGRSLESNVPEVIYGILDQPLGKEELEGRSDIPQTLEEFMTQLKEGGYDAKTFAIKLREM  141

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +  +EQ TR A +QEYLYRHVAS+ IPKQLHCL+L LANEH++NA ARLQLPS ELVP+
Sbjct  142   VTLMEQRTREAIVQEYLYRHVASSGIPKQLHCLALRLANEHTNNAAARLQLPSAELVPA  200


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M L ISPSLRHVTVLP KG+KEFIK ++ SR++S+R++FYSLL FTFLLRFVF+ TAVD 
Sbjct  1    MLLQISPSLRHVTVLPGKGLKEFIKVKVASRKLSYRMLFYSLLFFTFLLRFVFVLTAVDN  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPR  905
            IDG +KCS IGC G+K+RP I  ++   N P 
Sbjct  61   IDGANKCSSIGCLGKKLRPKILGRSLESNVPE  92



>ref|XP_009127073.1| PREDICTED: probable galacturonosyltransferase 12 [Brassica rapa]
Length=534

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR++E+  +PE +Y VLE+P +E E++   + PQTLED ++E K  + DA+ FA KLK 
Sbjct  82    LGRRVETGNVPEAMYQVLEQPLSEEELKGRSDIPQTLEDFMSEVKRSKSDAREFAQKLKE  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEH  NA ARLQLP  ELVP+
Sbjct  142   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHPINAAARLQLPEAELVPT  201


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLR VTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLR VF+ + VDT
Sbjct  1    MQLHISPSLRQVTVVKGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRLVFVLSTVDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGASPCSSLACLGKRLKPKLLGRRVETGNVPEAMYQVL  99



>emb|CDY42476.1| BnaA10g08520D [Brassica napus]
Length=515

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+ E+  +PE +Y VLE+P +E E++   + PQTL D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRTETGNVPEAMYQVLEQPLSEQELKGRSDIPQTLHDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLANEHSINAAARLQLPEAELVPT  202


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG+ S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGDPSPCSSLACLGKRLKPKLLGRRTETGNVPEAMYQVL  100



>emb|CDY47455.1| BnaC09g31020D [Brassica napus]
Length=535

 Score =   149 bits (375),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+ E+  +PE +Y VLE+P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRTETGNVPEAMYQVLEQPLSEQELKGRSDIPQTLQDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLAHEHSINAAARLQLPEAELVPT  202


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMLFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG+ S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGDPSPCSSLACLGKRLKPKLLGRRTETGNVPEAMYQVL  100



>ref|XP_009120000.1| PREDICTED: probable galacturonosyltransferase 12 [Brassica rapa]
Length=535

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+ E+  +PE +Y VLE+P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRAETGNVPEAMYQVLEQPLSEQELKGRSDIPQTLQDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLAHEHSINAAARLQLPEAELVPT  202


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SRR S++++FYSLL FTFLLRFVF+ + VDT
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRRFSYQMMFYSLLFFTFLLRFVFVLSTVDT  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDG+ S CS + C G++++P +  R+A   N P +  Q +
Sbjct  61   IDGDPSPCSSLACLGKRLKPKLLGRRAETGNVPEAMYQVL  100



>ref|XP_010443047.1| PREDICTED: probable galacturonosyltransferase 12 [Camelina sativa]
Length=535

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+++S  +PE +Y VL++P +E E++   + PQTL+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRVDSGNVPEAMYQVLQQPLSEQELKGRTDIPQTLQDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLASEHSINAAARLQLPEAELVPT  202


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SR+ S++++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRKFSYQMMFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDGE S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGEPSPCSSLACLGKRLKPKLLGRRVDSGNVPEAMYQVL  100



>ref|XP_010240964.1| PREDICTED: probable galacturonosyltransferase 12 [Nelumbo nucifera]
Length=534

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 94/122 (77%), Gaps = 2/122 (2%)
 Frame = +1

Query  865   RVYLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAK  1041
             R++ GR+ ES  +PE IY VLEE  +  + Q   E PQ+LE+ IAE K ++ D +TF  +
Sbjct  80    RIW-GRRPESMNVPEEIYRVLEENQDPEDTQEASEVPQSLEEFIAEMKSNKSDLRTFTLR  138

Query  1042  LKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             LK+M++ +EQ TR AKIQEYLYRH+AS+SIPKQLHCL+L LANEHS+NA ARLQLP+PE 
Sbjct  139   LKSMVSVMEQRTRAAKIQEYLYRHIASSSIPKQLHCLALKLANEHSTNAGARLQLPAPEC  198

Query  1222  VP  1227
             VP
Sbjct  199   VP  200


 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 6/136 (4%)
 Frame = +3

Query  630   MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
             MQL ISPSLRHVTVLP KGV++FIK ++ +RRVS+R+VFYSLL  TFLLRFVF+ TA+DT
Sbjct  1     MQLQISPSLRHVTVLPGKGVRDFIKVKVGTRRVSYRMVFYSLLFMTFLLRFVFVLTAMDT  60

Query  810   IDGESKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCIGGTSKRNRDTSGTRNSSD-PR  983
             IDGE+KCS IGC G+++ P I+ R+   +N P    + +    + N+D   T+ +S+ P+
Sbjct  61    IDGENKCSTIGCVGKRLGPRIWGRRPESMNVPEEIYRVL----EENQDPEDTQEASEVPQ  116

Query  984   RLNCRIQRR*TRCKDL  1031
              L   I    +   DL
Sbjct  117   SLEEFIAEMKSNKSDL  132



>ref|XP_011650538.1| PREDICTED: probable galacturonosyltransferase 12 isoform X2 [Cucumis 
sativus]
Length=441

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 1/108 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPET-PQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTA  1086
             +Y +L++P ++ E+Q   +  PQTLED +AE K  +PDAKTFA KL+ M++ +EQ TRTA
Sbjct  1     MYQILDKPMSKDELQGRLDNIPQTLEDFMAEIKEIKPDAKTFALKLRKMVSLMEQRTRTA  60

Query  1087  KIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             KIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  61    KIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  108



>ref|XP_010267797.1| PREDICTED: probable galacturonosyltransferase 12 [Nelumbo nucifera]
Length=535

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = +1

Query  865   RVYLGRQLE-STLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGD-RPDAKTFAA  1038
             R++ GR  E   +PE +Y VLEE   E E QVG E P +LE+L+AE K + + D +TF  
Sbjct  80    RIW-GRSPEPMNVPEEMYRVLEEKVGEEETQVGSEVPLSLEELVAEAKSNNKSDLRTFTL  138

Query  1039  KLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPE  1218
             KLKAM+  LEQ TR AKIQEYLYRHVAS+SIPKQLHC +L LANEHS+NA ARLQLP+PE
Sbjct  139   KLKAMVTLLEQKTRAAKIQEYLYRHVASSSIPKQLHCFALTLANEHSNNAAARLQLPAPE  198

Query  1219  LVP  1227
              VP
Sbjct  199   HVP  201


 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL +SPSLRHVTVLP KG++EFIK ++ +RRVS+R++FYSLLL  FLLR VF+ TA+DT
Sbjct  1    MQLLLSPSLRHVTVLPGKGLREFIKVKVGARRVSYRMIFYSLLLLAFLLRLVFVMTAMDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF-RKAA*INTPR  905
            IDGE+KCS IGC G+++ P I+ R    +N P 
Sbjct  61   IDGETKCSTIGCVGKRLGPRIWGRSPEPMNVPE  93



>ref|XP_010482877.1| PREDICTED: probable galacturonosyltransferase 12 [Camelina sativa]
Length=535

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 93/120 (78%), Gaps = 1/120 (1%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR+++S  +PE +Y VL++P +E E++   + PQ L+D ++E K  + DA+ FA KLK 
Sbjct  83    LGRRVDSGNVPEAMYQVLQQPLSEQELKGRTDIPQRLDDFMSEVKRSKSDAREFAQKLKE  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M+  +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS NA ARLQLP  ELVP+
Sbjct  143   MVTLMEQRTRTAKIQEYLYRHVASSSIPKQLHCLALKLASEHSINAAARLQLPEAELVPT  202


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPSLRHVTV+  KG++EFIK ++ SR+ S++++FYSLL FTFLLRFVF+ + VD+
Sbjct  1    MQLHISPSLRHVTVVTGKGLREFIKVKVGSRKFSYQMMFYSLLFFTFLLRFVFVLSTVDS  60

Query  810  IDGE-SKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCI  923
            IDGE S CS + C G++++P +  R+    N P +  Q +
Sbjct  61   IDGEPSPCSSLACLGKRLKPKLLGRRVDSGNVPEAMYQVL  100



>ref|XP_009402871.1| PREDICTED: probable galacturonosyltransferase 12 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             + R+L+S  +PE IY VLEE A   E     + PQTLE  +AE K +R DAKTFA +LKA
Sbjct  81    MWRRLDSVRVPEEIYQVLEE-AEIQEAMPRADVPQTLEAFVAEMKSNRSDAKTFALRLKA  139

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M++ +EQ TR AKIQEYLYRHVAS+SIPK LHCL+L LA EHS+NA ARLQLP+PE VP+
Sbjct  140   MVSLMEQKTRVAKIQEYLYRHVASSSIPKPLHCLALRLAQEHSTNAGARLQLPAPERVPA  199


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL+ISPS+R VTV P KGV+EFIK ++ SRR+S ++V YSLL  TFLLRF+F+ TA+DT
Sbjct  1    MQLYISPSMRQVTVFPGKGVREFIKVKVTSRRLSCKMVIYSLLFLTFLLRFIFVLTAMDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPRSDIQCI  923
            I+GE++CS +GC G+++ P ++R+   +  P    Q +
Sbjct  61   IEGETRCSSLGCIGKRLDPRMWRRLDSVRVPEEIYQVL  98



>ref|XP_006830459.2| PREDICTED: probable galacturonosyltransferase 12 [Amborella trichopoda]
Length=533

 Score =   142 bits (358),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +1

Query  865   RVYLGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             R++  R+  + +PE +Y VLE       + V  E PQ+LE  +AE K +R +AKTFA KL
Sbjct  80    RLWGRRRGSAMVPEEMYQVLEGSDGGKALDVA-EIPQSLEKFVAEMKSNRSNAKTFAFKL  138

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELV  1224
             KAM+  LEQ TR AKIQEYLYRHVAS SIPK LHCL+L LA EHS+N+ ARLQLP PE V
Sbjct  139   KAMVELLEQKTRAAKIQEYLYRHVASTSIPKNLHCLALRLAAEHSTNSGARLQLPVPESV  198

Query  1225  PS  1230
             PS
Sbjct  199   PS  200


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPSLRHVT+   KG KEFIK ++ SRRVS++ +FY+LL  TFLLRF F+ TA+D+
Sbjct  1    MQLHVSPSLRHVTLSTGKGFKEFIKVKVGSRRVSYKTLFYTLLFITFLLRFAFVITAIDS  60

Query  810  IDGESKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCIGGT  932
            +DGE KCS +GC GR++ P ++ R+      P    Q + G+
Sbjct  61   LDGEDKCSSLGCMGRRLGPRLWGRRRGSAMVPEEMYQVLEGS  102



>gb|ERM97875.1| hypothetical protein AMTR_s00115p00091320 [Amborella trichopoda]
Length=548

 Score =   142 bits (358),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +1

Query  865   RVYLGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             R++  R+  + +PE +Y VLE       + V  E PQ+LE  +AE K +R +AKTFA KL
Sbjct  95    RLWGRRRGSAMVPEEMYQVLEGSDGGKALDVA-EIPQSLEKFVAEMKSNRSNAKTFAFKL  153

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELV  1224
             KAM+  LEQ TR AKIQEYLYRHVAS SIPK LHCL+L LA EHS+N+ ARLQLP PE V
Sbjct  154   KAMVELLEQKTRAAKIQEYLYRHVASTSIPKNLHCLALRLAAEHSTNSGARLQLPVPESV  213

Query  1225  PS  1230
             PS
Sbjct  214   PS  215


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = +3

Query  618  RVSEMQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfT  797
            R +EMQLH+SPSLRHVT+   KG KEFIK ++ SRRVS++ +FY+LL  TFLLRF F+ T
Sbjct  12   RETEMQLHVSPSLRHVTLSTGKGFKEFIKVKVGSRRVSYKTLFYTLLFITFLLRFAFVIT  71

Query  798  AVDTIDGESKCSGIGCFGRKIRPSIF-RKAA*INTPRSDIQCIGGT  932
            A+D++DGE KCS +GC GR++ P ++ R+      P    Q + G+
Sbjct  72   AIDSLDGEDKCSSLGCMGRRLGPRLWGRRRGSAMVPEEMYQVLEGS  117



>ref|XP_009397165.1| PREDICTED: probable galacturonosyltransferase 12 [Musa acuminata 
subsp. malaccensis]
Length=533

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +1

Query  895   TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQT  1074
             T+PE IY VLE  A   E   G + PQTLE+ I E K DR DAKTFA +L+AM++ L+Q 
Sbjct  91    TVPEEIYRVLEG-AEPDEPTAGSDVPQTLEEFIEEMKSDRTDAKTFALRLRAMVSLLDQK  149

Query  1075  TRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             TR AKIQEYLYRHVAS+SIPK LHCL+L LA EHS+N  AR QLP+PE VP+
Sbjct  150   TRVAKIQEYLYRHVASSSIPKPLHCLALRLAQEHSTNVGARHQLPAPERVPA  201


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+RHVTV P KGV+EFIKF++ SRR+S+++V YSLL  TFLLRF+F+ TA+DT
Sbjct  1    MQLHISPSMRHVTVFPGKGVREFIKFKVTSRRLSYKMVIYSLLFMTFLLRFIFVLTAMDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK--AA*INTPRSDIQCIGGTSKRNRDTSGT  962
            I+GE++CS +GC G+++ P ++R+  +A +  P    + + G ++ +  T+G+
Sbjct  61   IEGETQCSSLGCIGKRLGPRMWRRPDSASVTVPEEIYRVLEG-AEPDEPTAGS  112



>ref|XP_006837044.1| PREDICTED: probable galacturonosyltransferase 13 [Amborella trichopoda]
 gb|ERM99897.1| hypothetical protein AMTR_s00110p00049110 [Amborella trichopoda]
Length=533

 Score =   119 bits (299),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L   +Y +L +  N  E+  G + P +  D +AE K ++ DAKTFA KLK
Sbjct  82    FLGRGDDSERLVRDLYKLLNQ-VNAEEVPDGLKVPASFGDFVAEMKANQYDAKTFAVKLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+  LE+ TR AK+QE+LY+H A++ IPK ++CLSL L +E+SSNANAR QLP PE++P
Sbjct  141   AMVEHLEKETRAAKLQEFLYKHFAASGIPKGIYCLSLRLTDEYSSNANARRQLPPPEMLP  200

Query  1228  S  1230
             +
Sbjct  201   T  201


 Score = 44.3 bits (103),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPT-KGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVD  806
            MQ+HISPS+R +T+  T  G+ +F+K ++ +R +S+R +F+++L+  FLL F+F+ TAV 
Sbjct  1    MQVHISPSMRSITISTTSNGLLDFMKIKVAARHISYRTLFHTMLILAFLLPFIFILTAVM  60

Query  807  TIDGESKCSGIGCFGRKIRP  866
            T++G +KCS + C GR++ P
Sbjct  61   TLEGVNKCSSLDCLGRRLGP  80



>ref|XP_009402872.1| PREDICTED: probable galacturonosyltransferase 12 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=525

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 86/120 (72%), Gaps = 8/120 (7%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             + R+L+S  +PE IY VLEE A   E     + PQTLE  +AE K +R DAKTFA +LKA
Sbjct  81    MWRRLDSVRVPEEIYQVLEE-AEIQEAMPRADVPQTLEAFVAEMKSNRSDAKTFALRLKA  139

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             M       TR AKIQEYLYRHVAS+SIPK LHCL+L LA EHS+NA ARLQLP+PE VP+
Sbjct  140   M------KTRVAKIQEYLYRHVASSSIPKPLHCLALRLAQEHSTNAGARLQLPAPERVPA  193


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL+ISPS+R VTV P KGV+EFIK ++ SRR+S ++V YSLL  TFLLRF+F+ TA+DT
Sbjct  1    MQLYISPSMRQVTVFPGKGVREFIKVKVTSRRLSCKMVIYSLLFLTFLLRFIFVLTAMDT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKAA*INTPRSDIQCI  923
            I+GE++CS +GC G+++ P ++R+   +  P    Q +
Sbjct  61   IEGETRCSSLGCIGKRLDPRMWRRLDSVRVPEEIYQVL  98



>gb|KJB40881.1| hypothetical protein B456_007G081500 [Gossypium raimondii]
Length=453

 Score =   103 bits (257),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y +  +   E EI  G + P +   L+AE K ++ DAKTFA  L+
Sbjct  81    FLGRVDDSGKLVRDFYKIFNQVITE-EIPDGLKLPDSFSQLVAELKNNQYDAKTFAFSLR  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+  LE+  R +K+ E + RH A++SIPK +HC SL L +E+SSNA AR QLPSPEL+P
Sbjct  140   AMMEKLEREIRESKVSELMNRHFAASSIPKGIHCFSLRLTDEYSSNAYARRQLPSPELLP  199


 Score = 47.4 bits (111),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHISPSMRSITISSNNGFTDLMKIKVAARHISYRTLFHTILIVAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   CFGR+  P
Sbjct  61   LEGANKCSSFDCFGRRFGP  79



>gb|KJB40880.1| hypothetical protein B456_007G081500 [Gossypium raimondii]
Length=449

 Score =   103 bits (257),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y +  +   E EI  G + P +   L+AE K ++ DAKTFA  L+
Sbjct  81    FLGRVDDSGKLVRDFYKIFNQVITE-EIPDGLKLPDSFSQLVAELKNNQYDAKTFAFSLR  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+  LE+  R +K+ E + RH A++SIPK +HC SL L +E+SSNA AR QLPSPEL+P
Sbjct  140   AMMEKLEREIRESKVSELMNRHFAASSIPKGIHCFSLRLTDEYSSNAYARRQLPSPELLP  199


 Score = 47.4 bits (111),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHISPSMRSITISSNNGFTDLMKIKVAARHISYRTLFHTILIVAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   CFGR+  P
Sbjct  61   LEGANKCSSFDCFGRRFGP  79



>gb|KJB40879.1| hypothetical protein B456_007G081500 [Gossypium raimondii]
Length=533

 Score =   103 bits (256),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y +  +   E EI  G + P +   L+AE K ++ DAKTFA  L+
Sbjct  81    FLGRVDDSGKLVRDFYKIFNQVITE-EIPDGLKLPDSFSQLVAELKNNQYDAKTFAFSLR  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+  LE+  R +K+ E + RH A++SIPK +HC SL L +E+SSNA AR QLPSPEL+P
Sbjct  140   AMMEKLEREIRESKVSELMNRHFAASSIPKGIHCFSLRLTDEYSSNAYARRQLPSPELLP  199


 Score = 47.4 bits (111),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHISPSMRSITISSNNGFTDLMKIKVAARHISYRTLFHTILIVAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   CFGR+  P
Sbjct  61   LEGANKCSSFDCFGRRFGP  79



>gb|KHG03530.1| putative galacturonosyltransferase 14 -like protein [Gossypium 
arboreum]
Length=533

 Score =   102 bits (253),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y +  +   E EI  G + P +   L+AE K +  DAKTFA  L+
Sbjct  81    FLGRVDDSGKLVRDFYKIFNQVITE-EIPDGLKLPDSFSQLVAEMKNNHYDAKTFAFSLR  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+  LE+  R +K  E + RH A++SIPK +HC SL L +E+SSNA+AR QLPSPEL+P
Sbjct  140   AMMEKLEREIRESKASELMNRHFAASSIPKGIHCFSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 47.8 bits (112),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+    G+ + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHISPSMRSITISSNNGLTDLMKIKVAARHISYRTLFHTILIVAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   CFGR+  P
Sbjct  61   LEGANKCSSFDCFGRRFGP  79



>ref|XP_010258139.1| PREDICTED: probable galacturonosyltransferase 14 [Nelumbo nucifera]
Length=533

 Score =   101 bits (252),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L   +Y VL +  N  EI    E P++   L++E K ++ DAKTFA KLK
Sbjct  81    FLGRADDSIRLVRDLYKVLNQ-VNSEEIPPNLELPESFSQLVSEMKNNQYDAKTFAIKLK  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   ++  + +K  E + +H A+++IPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  140   AMMEKFDREAKASKFAELINKHFAASAIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 46.6 bits (109),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS++ +T+  T G  +F+K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMKSITISSTNGFLDFMKIKVAARHISYRTLFHTVLILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKA  884
            ++G +KCS + C GR++ P    +A
Sbjct  61   LEGVNKCSSLDCLGRRLGPRFLGRA  85



>ref|XP_002983680.1| galacturonosyltransferase GAUT12/13/14/15-like protein [Selaginella 
moellendorffii]
 ref|XP_002990530.1| galacturonosyltransferase GAUT12/13/14/15-like protein [Selaginella 
moellendorffii]
 gb|EFJ08407.1| galacturonosyltransferase GAUT12/13/14/15-like protein [Selaginella 
moellendorffii]
 gb|EFJ15176.1| galacturonosyltransferase GAUT12/13/14/15-like protein [Selaginella 
moellendorffii]
Length=531

 Score =   106 bits (265),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
             ++S++ + A+++++  G   P++  + +AE + +R D KT   KLKAM+   EQ TRTAK
Sbjct  94    VHSIVMQ-ASKSDLPAGENVPESFSEFVAEVEANRYDGKTCILKLKAMLELQEQRTRTAK  152

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             +QE +YRH AS+ IPK +HCL+L L  E+SSNANAR +LPSPEL
Sbjct  153   LQEAVYRHFASSGIPKSMHCLALKLTAEYSSNANARRELPSPEL  196


 Score = 40.0 bits (92),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+HISPS+R +T+  + G  + +K ++ +R +S R +F+S+L   FLL F+F+ TA+ T
Sbjct  1    MQVHISPSMRRITISTSNGFLDPLKIKVAARYLSHRCLFWSILFLAFLLPFIFITTALIT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKA  884
            ++  +KCS + C GRKI P +  ++
Sbjct  61   LEEVNKCSSMYCLGRKIGPKLHWRS  85



>ref|XP_010551820.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score = 99.8 bits (247),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLVRDFYKILNEVSTQ-EIPDGWKLPDSFSQLVSDMKDNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             MI   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MIEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 46.2 bits (108),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  + G  + +K +I +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNGFIDLMKIKIAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  61   LEGVNKCSSIDCLGRRLGPRLL  82



>ref|XP_010551819.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Tarenaya 
hassleriana]
Length=533

 Score = 99.8 bits (247),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+
Sbjct  82    LGRVDDSEQRLVRDFYKILNEVSTQ-EIPDGWKLPDSFSQLVSDMKDNHYDAKTFALVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AMI   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   AMIEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  200


 Score = 46.2 bits (108),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  + G  + +K +I +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNGFIDLMKIKIAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  61   LEGVNKCSSIDCLGRRLGPRLL  82



>ref|XP_006297411.1| hypothetical protein CARUB_v10013435mg [Capsella rubella]
 gb|EOA30309.1| hypothetical protein CARUB_v10013435mg [Capsella rubella]
Length=532

 Score = 99.8 bits (247),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRIDDSERLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MVEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 45.1 bits (105),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   CFGR++ P + 
Sbjct  61   LEGVNKCSSFDCFGRRLGPRLL  82



>ref|XP_010485435.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Camelina 
sativa]
Length=532

 Score = 99.8 bits (247),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 45.1 bits (105),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   CFGR++ P + 
Sbjct  61   LEGVNKCSSFDCFGRRLGPRLL  82



>ref|XP_010417209.1| PREDICTED: probable galacturonosyltransferase 13 [Camelina sativa]
Length=771

 Score = 99.8 bits (247),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 44.7 bits (104),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   CFGR++ P + 
Sbjct  61   LEGVNKCSSFDCFGRRLGPRLL  82


 Score = 87.4 bits (215),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = +1

Query  988   LIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLA  1167
             L ++ K +  DAKTFA  L+AM+   E+  R +K  E + +H A++SIPK +HCLSL L 
Sbjct  359   LXSDMKNNHYDAKTFALVLRAMVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLT  418

Query  1168  NEHSSNANARLQLPSPELVP  1227
             +E+SSNA+AR QLPSPEL+P
Sbjct  419   DEYSSNAHARRQLPSPELLP  438



>ref|XP_010485434.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Camelina 
sativa]
Length=533

 Score = 99.8 bits (247),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+
Sbjct  82    LGRVDDSEQRLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFALVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   AMVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  200


 Score = 44.7 bits (104),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   CFGR++ P + 
Sbjct  61   LEGVNKCSSFDCFGRRLGPRLL  82



>ref|XP_002884297.1| GAUT13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60556.1| GAUT13 [Arabidopsis lyrata subsp. lyrata]
Length=533

 Score = 99.4 bits (246),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+
Sbjct  82    LGRIDDSEQRLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFALVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   AMVEKFERELRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  200


 Score = 45.1 bits (105),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   CFGR++ P + 
Sbjct  61   LEGVNKCSSFDCFGRRLGPRLL  82



>gb|KHG04367.1| putative galacturonosyltransferase 13 -like protein [Gossypium 
arboreum]
Length=534

 Score =   100 bits (249),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S   L +  Y +L +  N  EI  G + P +   L++E K ++ DAKTFA  L+
Sbjct  82    LGRVDDSGQRLVKDFYKILNQ-VNAEEIPDGIKLPDSFNQLVSEMKNNQYDAKTFALMLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+  LE+  R +K  E + +H A++SIPK L+CLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   AMMEKLEREIRESKFSELMNKHFAASSIPKGLYCLSLRLTDEYSSNAHARRQLPSPELLP  200


 Score = 43.5 bits (101),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHVSPSMRSLTISSNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAIVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>emb|CDY43026.1| BnaA03g11730D [Brassica napus]
Length=264

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +1

Query  991   IAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLAN  1170
             ++E K  + DA+ FA KLK M+  +EQ TRTAKIQEYLYRHVAS+SI KQLHCL+L LAN
Sbjct  1     MSEVKRSKSDAREFAQKLKEMVTLMEQRTRTAKIQEYLYRHVASSSILKQLHCLALKLAN  60

Query  1171  EHSSNANARLQLPSPELVPS  1230
             EHS NA ARLQLP  ELVP+
Sbjct  61    EHSINAAARLQLPEAELVPT  80



>ref|NP_186753.2| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
 sp|Q0WV13.1|GAUTD_ARATH RecName: Full=Probable galacturonosyltransferase 13 [Arabidopsis 
thaliana]
 dbj|BAE99035.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABO09884.1| At3g01040 [Arabidopsis thaliana]
 gb|AEE73598.1| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
Length=533

 Score = 99.0 bits (245),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P++   L+++ K +  DAKTFA   +
Sbjct  82    LGRIDDSEQRLVRDFYKILNEVSTQ-EIPDGLKLPESFSQLVSDMKNNHYDAKTFALVFR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   AMVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  200


 Score = 45.1 bits (105),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   CFGR++ P + 
Sbjct  61   LEGVNKCSSFDCFGRRLGPRLL  82



>ref|NP_001118545.1| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
 gb|AEE73599.1| putative galacturonosyltransferase 13 [Arabidopsis thaliana]
 gb|AHL38789.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=532

 Score = 98.6 bits (244),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P++   L+++ K +  DAKTFA   +A
Sbjct  82    LGRIDDSERLVRDFYKILNEVSTQ-EIPDGLKLPESFSQLVSDMKNNHYDAKTFALVFRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 45.1 bits (105),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   CFGR++ P + 
Sbjct  61   LEGVNKCSSFDCFGRRLGPRLL  82



>gb|KJB75647.1| hypothetical protein B456_012G049900 [Gossypium raimondii]
Length=549

 Score = 99.4 bits (246),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  N  EI  G + P +   L+++ K ++ DAKTFA  L+A
Sbjct  82    LGRVDDSGRLVKDFYKILNQ-VNAEEIPDGIKLPDSFNQLVSKMKNNQYDAKTFALMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK L+CLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MMEKLEREIRESKFSELMNKHFAASSIPKGLYCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 44.3 bits (103),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHVSPSMRSLTISSNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAIVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>ref|NP_197051.2| probable galacturonosyltransferase 14 [Arabidopsis thaliana]
 sp|Q8GWT1.1|GAUTE_ARATH RecName: Full=Probable galacturonosyltransferase 14 [Arabidopsis 
thaliana]
 dbj|BAC43247.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64834.1| At5g15470 [Arabidopsis thaliana]
 gb|AED92165.1| probable galacturonosyltransferase 14 [Arabidopsis thaliana]
 gb|AHL38629.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=532

 Score = 98.6 bits (244),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLARDFYKILNEVSTQ-EIPDGLKLPNSFSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MMEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 44.7 bits (104),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR+I P + 
Sbjct  61   LEGVNKCSSIDCLGRRIGPRLL  82



>gb|KJB75644.1| hypothetical protein B456_012G049900 [Gossypium raimondii]
Length=533

 Score = 99.4 bits (246),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  N  EI  G + P +   L+++ K ++ DAKTFA  L+A
Sbjct  82    LGRVDDSGRLVKDFYKILNQ-VNAEEIPDGIKLPDSFNQLVSKMKNNQYDAKTFALMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK L+CLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MMEKLEREIRESKFSELMNKHFAASSIPKGLYCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 43.5 bits (101),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHVSPSMRSLTISSNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAIVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>gb|KJB75645.1| hypothetical protein B456_012G049900 [Gossypium raimondii]
Length=557

 Score = 99.4 bits (246),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  N  EI  G + P +   L+++ K ++ DAKTFA  L+A
Sbjct  82    LGRVDDSGRLVKDFYKILNQ-VNAEEIPDGIKLPDSFNQLVSKMKNNQYDAKTFALMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK L+CLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MMEKLEREIRESKFSELMNKHFAASSIPKGLYCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 43.5 bits (101),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHVSPSMRSLTISSNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAIVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>ref|XP_007032682.1| Galacturonosyltransferase 13 isoform 2, partial [Theobroma cacao]
 gb|EOY03608.1| Galacturonosyltransferase 13 isoform 2, partial [Theobroma cacao]
Length=447

 Score = 99.8 bits (247),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  N  EI    + P + + L++E K ++ DAKTFA  L+A
Sbjct  82    LGRVDDSGRLVKDFYKILNQ-VNTEEIPDDLKLPDSFDQLVSEMKNNQYDAKTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MMEKLEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 43.1 bits (100),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHVSPSMRSITISSNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>ref|XP_007032681.1| Galacturonosyltransferase 13 isoform 1 [Theobroma cacao]
 gb|EOY03607.1| Galacturonosyltransferase 13 isoform 1 [Theobroma cacao]
Length=533

 Score = 99.8 bits (247),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  N  EI    + P + + L++E K ++ DAKTFA  L+A
Sbjct  82    LGRVDDSGRLVKDFYKILNQ-VNTEEIPDDLKLPDSFDQLVSEMKNNQYDAKTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   MMEKLEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  199


 Score = 43.1 bits (100),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHVSPSMRSITISSNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>ref|XP_006287475.1| hypothetical protein CARUB_v10000686mg [Capsella rubella]
 gb|EOA20373.1| hypothetical protein CARUB_v10000686mg [Capsella rubella]
Length=532

 Score = 98.2 bits (243),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLARDFYKILNEVSTQ-EIPDGLKLPYSFSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MMEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 44.7 bits (104),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR+I P + 
Sbjct  61   LEGVNKCSSIDCLGRRIGPRLL  82



>gb|KJB75646.1| hypothetical protein B456_012G049900 [Gossypium raimondii]
Length=534

 Score = 99.0 bits (245),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S   L +  Y +L +  N  EI  G + P +   L+++ K ++ DAKTFA  L+
Sbjct  82    LGRVDDSGQRLVKDFYKILNQ-VNAEEIPDGIKLPDSFNQLVSKMKNNQYDAKTFALMLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+  LE+  R +K  E + +H A++SIPK L+CLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  141   AMMEKLEREIRESKFSELMNKHFAASSIPKGLYCLSLRLTDEYSSNAHARRQLPSPELLP  200


 Score = 43.5 bits (101),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH+SPS+R +T+    G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHVSPSMRSLTISSNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAIVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>ref|XP_010525101.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Tarenaya 
hassleriana]
Length=533

 Score = 98.2 bits (243),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+
Sbjct  82    LGRVDDSEQRLVREFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFALVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   AMMEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  200


 Score = 44.7 bits (104),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  + G  + +K ++ +R +S+R +F+ +L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNGFIDLMKIKVAARHISYRTLFHPILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G + CS I C GR++ P + 
Sbjct  61   LEGVNNCSSIDCLGRRLGPRLL  82



>ref|XP_010525102.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score = 97.8 bits (242),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLVREFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MMEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 44.7 bits (104),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  + G  + +K ++ +R +S+R +F+ +L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNGFIDLMKIKVAARHISYRTLFHPILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G + CS I C GR++ P + 
Sbjct  61   LEGVNNCSSIDCLGRRLGPRLL  82



>ref|XP_006400067.1| hypothetical protein EUTSA_v10013218mg [Eutrema salsugineum]
 gb|ESQ41520.1| hypothetical protein EUTSA_v10013218mg [Eutrema salsugineum]
Length=532

 Score = 98.2 bits (243),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  +    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERIARDFYRILNEVSTQ-EIPDGLKLPDSYNQLVSDMKNNHYDAKTFAIVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MMEKLERDIRESKFSELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 43.9 bits (102),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  61   LEGVNKCSSIDCLGRRLGPRLL  82



>ref|XP_010492387.1| PREDICTED: probable galacturonosyltransferase 14 [Camelina sativa]
Length=532

 Score = 96.7 bits (239),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLARDFYKILNEVSTQ-EIPDGLKLPNSYSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R  K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MMEKFERDMRELKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 44.7 bits (104),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR+I P + 
Sbjct  61   LEGVNKCSSIDCLGRRIGPRLL  82



>ref|XP_010420207.1| PREDICTED: probable galacturonosyltransferase 14 [Camelina sativa]
Length=532

 Score = 97.1 bits (240),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLARDFYKILNEVSTQ-EIPDGLKLPNSYSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R  K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MMEKFERDMRELKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 44.7 bits (104),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVGT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G  KCS I C GR+I P + 
Sbjct  61   LEGVKKCSSIDCLGRRIGPRLL  82



>ref|XP_006408454.1| hypothetical protein EUTSA_v10020487mg [Eutrema salsugineum]
 gb|ESQ49907.1| hypothetical protein EUTSA_v10020487mg [Eutrema salsugineum]
Length=533

 Score = 97.4 bits (241),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P +   L+++ K +  DAKTF+  L+
Sbjct  82    LGRIDDSEQRLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDAKTFSLVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AMI   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   AMIEKFERDIRESKFAELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  200


 Score = 43.9 bits (102),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  61   LEGVNKCSSIDCLGRRLGPRLL  82



>ref|XP_003596616.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES66867.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=412

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  1018  DAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANAR  1197
             DAKTFA KL+ M+  +EQ TR AKIQEYLYRHVAS+SIPKQLHCL L LA+EH++NA AR
Sbjct  10    DAKTFAVKLREMVTLMEQRTRLAKIQEYLYRHVASSSIPKQLHCLDLRLAHEHTNNAAAR  69

Query  1198  LQLPSPELVPS  1230
             LQLPS ELVP+
Sbjct  70    LQLPSAELVPA  80



>ref|XP_010453684.1| PREDICTED: probable galacturonosyltransferase 14 [Camelina sativa]
Length=532

 Score = 95.9 bits (237),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + +  I  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  82    LGRVDDSERLARDFYKILNEVSTQV-IPDGLKLPNSFSQLVSDMKNNHYDAKTFALVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R  K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MMEKFERDMRELKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 44.7 bits (104),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR+I P + 
Sbjct  61   LEGVNKCSSIDCLGRRIGPRLL  82



>emb|CDX78631.1| BnaA03g05430D [Brassica napus]
Length=533

 Score =   100 bits (248),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y++L E + + EI  G + P +   L+++ K +  DAKTFA  L+
Sbjct  82    FLGRVDDSERLARDFYNILNEVSTQ-EIPDGLKLPDSFNHLVSDMKNNHYDAKTFALVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   AMMEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  200


 Score = 38.1 bits (87),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVK-EFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVD  806
            MQLH+SPS+R +T+  +     + +K ++ +R +S R +F+++L+  FLL FVF+ TA+ 
Sbjct  1    MQLHVSPSMRSITISSSNEFTTDLMKIKLAARHISSRTLFHTILILAFLLPFVFILTALV  60

Query  807  TIDGESKCSGIGCFGRKIRP  866
            T++G +KCS I C GR++ P
Sbjct  61   TLEGVNKCSSIDCLGRRLGP  80



>ref|XP_011035850.1| PREDICTED: probable galacturonosyltransferase 14 [Populus euphratica]
Length=536

 Score =   102 bits (253),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  NE EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  84    LGRVDDSGRLVKDFYKILNQVKNE-EIPDGVKLPASFSHLVSEMKNNQYDARTFAFMLRA  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  143   MMEKLEREIRESKFSELMNKHFAASSIPKSIHCLSLRLTDEYSSNAHARKQLPSPEFLP  201


 Score = 35.4 bits (80),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPT--KGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLHIS S+R +T+  +   G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+
Sbjct  1    MQLHISRSMRSITISSSCNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAL  60

Query  804  DTIDGESKCSGIGCFGRKIRPSIF  875
             T++G +KCS   C GR++ P + 
Sbjct  61   VTLEGVNKCSSFDCLGRRLGPRLL  84



>ref|XP_009147387.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Brassica 
rapa]
 ref|XP_009147388.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Brassica 
rapa]
 emb|CDY37548.1| BnaA05g34130D [Brassica napus]
Length=533

 Score = 97.1 bits (240),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P +   L+++ K +  DAKTF+  L+
Sbjct  82    LGRVDDSEQRLVRDFYKILNEVSTQ-EIPDGLKLPNSFRQLVSDMKNNHYDAKTFSLVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AMI   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   AMIEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPERLP  200


 Score = 40.0 bits (92),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++    +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHISPSMRSLTISSSNEFFDSMKIKVAPPLISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  61   LEGVNKCSSIDCLGRRLGPRLL  82



>ref|XP_009147389.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Brassica 
rapa]
 emb|CDY43264.1| BnaC05g48570D [Brassica napus]
Length=532

 Score = 96.7 bits (239),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTF+  L+A
Sbjct  82    LGRVDDSERLVRDFYKILNEVSTQ-EIPDGLKLPNSFRQLVSDMKNNHYDAKTFSLVLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             MI   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   MIEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPERLP  199


 Score = 40.0 bits (92),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++    +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHISPSMRSLTISSSNEFFDSMKIKVAPPLISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  61   LEGVNKCSSIDCLGRRLGPRLL  82



>ref|XP_010550021.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score = 94.7 bits (234),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y +L E + + EI  G + P +   L+++ K +  DA+TF   L+AMI   E+  R  K
Sbjct  95    FYKILNEVSTQ-EIPDGLKLPDSFSQLVSDVKNNNYDARTFGLVLRAMIEKFERDIRETK  153

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
               E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  154   FAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  199


 Score = 41.6 bits (96),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M LHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MHLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  61   LEGVNKCSSIDCLGRRLGPRLL  82



>ref|XP_002873726.1| hypothetical protein ARALYDRAFT_326001 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49985.1| hypothetical protein ARALYDRAFT_326001 [Arabidopsis lyrata subsp. 
lyrata]
Length=573

 Score = 99.8 bits (247),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 77/119 (65%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  123   LGRVDDSERLARDFYKILNEVSTQ-EIPDGLKLPNSFSQLVSDMKNNHYDAKTFALVLRA  181

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M++  E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  182   MMDKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  240


 Score = 36.6 bits (83),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +3

Query  615  SRVSEMQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflf  794
            S V  MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ 
Sbjct  40   SDVGRMQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFIL  99

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G +KCS I   GR+I P + 
Sbjct  100  TALVTLEGVNKCSSI---GRRIGPRLL  123



>ref|XP_001753633.1| predicted protein [Physcomitrella patens]
 gb|EDQ81385.1| predicted protein [Physcomitrella patens]
Length=533

 Score = 94.4 bits (233),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = +1

Query  913   YSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKI  1092
             YS L E  NE E+    + P T+E L+ E +  + D  T   ++K+M+   E+  R A++
Sbjct  97    YSALLEYKNEKELT---DVPDTIEALLTEARNRQYDMATLLRRMKSMVEVNEEKVRAARL  153

Query  1093  QEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             QE LYRH AS+ +PK LHCL+L L  E+SSNA AR  LPSP+L P
Sbjct  154   QEALYRHYASSGVPKGLHCLALKLTGEYSSNARARQDLPSPDLAP  198


 Score = 41.6 bits (96),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+HISPS+R +T+  + G  E +K +  +R +S+R +F+++L   F L F+F+ +A+ T
Sbjct  1    MQVHISPSMRRITISTSPGFLEPLKMKGAARYLSYRCIFWTVLFLAFFLPFLFITSALIT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            ++G   C+ + CFGRK+ P +  K
Sbjct  61   LEGVHNCTSLDCFGRKLGPKLSWK  84



>emb|CDX70612.1| BnaC03g06960D [Brassica napus]
Length=533

 Score = 96.7 bits (239),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 77/120 (64%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +L R  +S  L    Y++L E + + EI  G + P +   L+++ K +  DAKTFA  L+
Sbjct  82    FLSRVDDSERLARDFYNILNEVSTQ-EIPDGLKLPDSFNHLLSDMKNNHYDAKTFALILR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   AMMEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  200


 Score = 38.5 bits (88),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVK-EFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVD  806
            MQLH+SPS+R +T+  +     + +K ++ +R +S R +F+++L+  FLL FVF+ TA+ 
Sbjct  1    MQLHVSPSMRSITISSSNEFTTDLMKIKLAARHISSRTLFHTILILAFLLPFVFILTALV  60

Query  807  TIDGESKCSGIGCFGRKIRPSIFRK  881
            T++G +KCS I C GR++ P    +
Sbjct  61   TLEGVNKCSSIDCLGRRLGPRFLSR  85



>ref|XP_010259116.1| PREDICTED: probable galacturonosyltransferase 14 [Nelumbo nucifera]
Length=533

 Score = 90.1 bits (222),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  871   YLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L + +Y +L + ++E EI    + P++  +L++E K ++ DAKTFA KLK
Sbjct  81    FLGRADDSVRLVKDLYKILNQVSSE-EIPADLKLPESFSELVSEMKNNQYDAKTFAIKLK  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+   ++  R +K  E + +H A+++IPK +HCLSL L +E+SSNA+AR Q
Sbjct  140   AMMEKFDREVRASKFAELMNKHFAASAIPKGIHCLSLRLTDEYSSNAHARRQ  191


 Score = 44.7 bits (104),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS++ +T+  + G  +F+  ++ +R +S+R +F+S+L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMKSITISSSNGFLDFMNIKVAARHISYRTLFHSILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKA  884
            ++G +KCS + C GR++ P    +A
Sbjct  61   LEGVNKCSSLDCLGRRLGPRFLGRA  85



>ref|XP_009131467.1| PREDICTED: probable galacturonosyltransferase 14 [Brassica rapa]
Length=533

 Score = 98.6 bits (244),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +1

Query  871   YLGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y++L E + + +I  G + P +   L+++ K +  DAKTFA  L+
Sbjct  82    FLGRVDDSERLARDFYNILNEVSTQ-DIPDGLKLPDSFNHLLSDMKNNHYDAKTFALVLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  141   AMMEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  200


 Score = 36.2 bits (82),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVK-EFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVD  806
            MQLH+SPS+R +T+  +     + +K ++ +R +S R +F+++L+  FLL FVF+ TA+ 
Sbjct  1    MQLHVSPSMRSITISSSNDFTTDLMKIKLAARHISSRTLFHTILILAFLLPFVFILTALV  60

Query  807  TIDGESKCSGIGCFGRKIRP  866
             ++G +KCS I C GR++ P
Sbjct  61   PLEGVNKCSSIDCLGRRLGP  80



>emb|CAC01746.1| putative protein [Arabidopsis thaliana]
Length=572

 Score = 98.6 bits (244),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  122   LGRVDDSERLARDFYKILNEVSTQ-EIPDGLKLPNSFSQLVSDMKNNHYDAKTFALVLRA  180

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  181   MMEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  239


 Score = 35.4 bits (80),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +    + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  44   MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  103

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I   GR+I P + 
Sbjct  104  LEGVNKCSSI---GRRIGPRLL  122



>ref|XP_011013393.1| PREDICTED: probable galacturonosyltransferase 14 [Populus euphratica]
Length=536

 Score =   102 bits (253),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  NE EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  84    LGRVDDSGRLVKDFYKILNQVKNE-EIPDGVKLPASFNHLVSEMKNNQYDARTFAFMLRA  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  143   MMEKLEREIRESKFAELMNKHFAASSIPKSIHCLSLRLTDEYSSNAHARTQLPSPEFLP  201


 Score = 32.0 bits (71),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TAV T++G +KCS   C GR++ P + 
Sbjct  58   TAVVTLEGVNKCSSFDCLGRRLGPRLL  84



>gb|AAF26170.1|AC008261_27 unknown protein [Arabidopsis thaliana]
Length=510

 Score = 99.0 bits (245),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    E  L    Y +L E + + EI  G + P++   L+++ K +  DAKTFA   +
Sbjct  59    LGRIDDSEQRLVRDFYKILNEVSTQ-EIPDGLKLPESFSQLVSDMKNNHYDAKTFALVFR  117

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPEL+P
Sbjct  118   AMVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPELLP  177


 Score = 34.3 bits (77),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TAV T++G +KCS   CFGR++ P + 
Sbjct  33   TAVVTLEGVNKCSSFDCFGRRLGPRLL  59



>ref|XP_002305374.1| hypothetical protein POPTR_0004s12340g [Populus trichocarpa]
 gb|EEE85885.1| hypothetical protein POPTR_0004s12340g [Populus trichocarpa]
Length=528

 Score =   102 bits (254),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  NE EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  76    LGRVDDSGRLVKDFYKILNQVKNE-EIPDGVKLPASFNHLVSEMKNNQYDARTFAFMLRA  134

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  135   MMEKLEREIRESKFAELMNKHFAASSIPKSIHCLSLRLTDEYSSNAHARTQLPSPEFLP  193


 Score = 30.8 bits (68),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G +KCS   C GR++ P + 
Sbjct  50   TALVTLEGVNKCSSFDCLGRRLGPRLL  76



>ref|XP_002324094.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|EEF04227.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
Length=536

 Score =   102 bits (253),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y +L +  NE EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  84    LGRVDDSGRLVKDFYKILNQVKNE-EIPDGVKLPASFSHLVSEMKNNQYDARTFAFMLRA  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  143   MMEKLEREIRESKFSELMNKHFAASSIPKSIHCLSLRLTDEYSSNAHARKQLPSPEFLP  201


 Score = 30.8 bits (68),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G +KCS   C GR++ P + 
Sbjct  58   TALVTLEGVNKCSSFDCLGRRLGPRLL  84



>gb|KFK25790.1| hypothetical protein AALP_AA8G160800 [Arabis alpina]
Length=524

 Score = 99.8 bits (247),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  ES  L    Y +L E + + EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  74    LGRVDESEKLARDFYKILNEVSTQ-EIPDGLKLPDSFSHLVSDMKNNHYDAKTFALVLRA  132

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  133   MMEKFERDIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  191


 Score = 32.3 bits (72),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G +KCS I C GR++ P + 
Sbjct  48   TALVTLEGVNKCSSIDCLGRRLGPRLL  74



>ref|XP_001755223.1| predicted protein [Physcomitrella patens]
 gb|EDQ80167.1| predicted protein [Physcomitrella patens]
Length=531

 Score = 90.9 bits (224),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = +1

Query  913   YSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKI  1092
             YS L +  +E E+    + P T+E L+ E +  + D  T   ++K+M+   E+  R AK+
Sbjct  95    YSALLQYRSEKELT---DIPDTIEALLIEARSKQYDMPTLLRRMKSMVEVNEEKVRAAKL  151

Query  1093  QEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             QE LYRH AS+ +PK LHCL+L L  E+SSNA AR  LPSP+L P
Sbjct  152   QEALYRHYASSGVPKGLHCLALKLTGEYSSNARARQDLPSPDLAP  196


 Score = 40.4 bits (93),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+HISPS+R + +  + G  + +K +  +R +S+R +F++ L   F L F+F+ +A+ T
Sbjct  1    MQVHISPSMRQIIISTSPGFLDPLKMKGAARYLSYRCIFWTFLFLAFSLPFLFITSALIT  60

Query  810  IDGESKCSGIGCFGRKIRPSI-FRKAA  887
            +DG   C+ + CFGRK+ P + +R+ A
Sbjct  61   LDGVHNCTSLDCFGRKLGPKLSWRRHA  87



>ref|XP_008661159.1| PREDICTED: probable galacturonosyltransferase 13 [Zea mays]
Length=538

 Score = 90.9 bits (224),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  V  +Y +L+E  N  E  +  + P+T ++ I + K +  D ++FA KLK
Sbjct  82    LGRGNDGSMRLVRDLYVMLDE-VNSEEAPLNLKVPETFDEFIWDMKNNDYDLRSFAFKLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  R++++ E L +H A+ +IPK L+CLSL L +E+SSNA AR QLP PELVP
Sbjct  141   ATMESMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDEYSSNALARKQLPPPELVP  200

Query  1228  S  1230
             S
Sbjct  201   S  201


 Score = 40.0 bits (92),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + ++F++ +R  S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRLSPSMRSITISTSHGLLDLMRFKVAARHFSYRTVFHTVLILAFLLPFVFILTAVMT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGFNKCSSLDCLGRRLGPRLL  82



>ref|XP_004149844.2| PREDICTED: probable galacturonosyltransferase 14 [Cucumis sativus]
 gb|KGN58112.1| hypothetical protein Csa_3G516510 [Cucumis sativus]
Length=534

 Score = 84.7 bits (208),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR   S  L    Y +L +   E EI  G + P +   L++E + ++ DAKTFA  LKA
Sbjct  83    LGRVDGSGRLVSDFYKILNQVKTE-EIPDGLKLPDSFTQLVSEMQNNQYDAKTFAIMLKA  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E +++H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  142   MMEKFEKDIRESKFAELMHKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  192


 Score = 46.2 bits (108),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  +F+K ++ +R +S+R +F++ LL  FLL FVF+ TAV T
Sbjct  2    MQLHFSPSMRSITISTNNGFIDFMKIKVAARHISYRTIFHTFLLLAFLLPFVFILTAVVT  61

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  62   LEGVNKCSSFDCLGRRLGPRLL  83



>gb|KFK37569.1| hypothetical protein AALP_AA3G000200 [Arabis alpina]
Length=524

 Score = 96.7 bits (239),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DA+TF+  L+A
Sbjct  74    LGRVDDSERLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDARTFSLVLRA  132

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             MI   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  133   MIEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  191


 Score = 34.3 bits (77),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TAV T++G +KCS I C GR+I P + 
Sbjct  48   TAVVTLEGVNKCSSIDCLGRRIGPRLL  74



>ref|XP_008450151.1| PREDICTED: probable galacturonosyltransferase 14 [Cucumis melo]
Length=534

 Score = 84.7 bits (208),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR   S  L    Y +L +   E EI  G + P +   L++E + ++ DAKTFA  LKA
Sbjct  83    LGRVDGSGRLVSDFYKILNQVKTE-EIPDGLKLPNSFTQLVSEMQNNQYDAKTFAIMLKA  141

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E +++H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  142   MMEKFEKDIRESKFAELMHKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  192


 Score = 46.2 bits (108),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  +F+K ++ +R +S+R +F++ LL  FLL FVF+ TAV T
Sbjct  2    MQLHFSPSMRSITISTNNGFIDFMKIKVAARHISYRTIFHTFLLLAFLLPFVFILTAVVT  61

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  62   LEGVNKCSSFDCLGRRLGPRLL  83



>ref|XP_004962991.1| PREDICTED: probable galacturonosyltransferase 13-like [Setaria 
italica]
Length=535

 Score = 90.1 bits (222),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  V  +YS+L+E  N  E  V  + P++ ++ I + K +  D ++FA KLK
Sbjct  82    LGRGNDGSMRLVRDLYSMLDE-INSEEGPVDLKVPESFDEFIWDMKNNDYDLRSFAFKLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  R++++ E L +H A+ +IPK L+CLSL L +E+SSNA AR QLP PELVP
Sbjct  141   ATMESMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDEYSSNALARKQLPPPELVP  200


 Score = 40.4 bits (93),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + ++ +  +R  S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRLSPSMRSITISTSHGLLDLMRLKAAARHFSYRTVFHTVLILAFLLPFVFILTAVMT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGFNKCSSLDCLGRRLGPRLL  82



>emb|CDX69522.1| BnaA10g18710D [Brassica napus]
Length=524

 Score = 91.3 bits (225),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E A+  +I  G + P +   L+++ K +  D KTFA  L+A
Sbjct  74    LGRVDDSERLARDFYKILNE-ASTQDIPDGLKLPDSFNHLVSDTKNNHYDPKTFALVLRA  132

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R  K  E   +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  133   MMEKFERDIRQTKFAELTNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPERLP  191


 Score = 38.9 bits (89),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (49%), Gaps = 9/82 (11%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +K     I +R +   +         +            TA+ T
Sbjct  2    MQLHISPSMRSITISSSKVAARHISYRTLFHTILILAFLLPFVFIL---------TALVT  52

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  53   LEGANKCSSIDCLGRRLGPRLL  74



>ref|XP_009360554.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Pyrus 
x bretschneideri]
Length=533

 Score = 86.7 bits (213),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y VL +  N  EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  82    LGRVDDSARLVRDFYKVLNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   MMENFEKEVRESKFSELMNKHYAASSVPKSIHCLSLRLTDEYSSNAHARKQ  191


 Score = 43.1 bits (100),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVGARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>ref|XP_008341636.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Malus 
domestica]
Length=533

 Score = 86.7 bits (213),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y VL +  N  EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  82    LGRVDDSARLVRDFYKVLNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   MMENFEKEVRESKFSELMNKHYAASSVPKSIHCLSLRLTDEYSSNAHARKQ  191


 Score = 43.1 bits (100),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVGARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>gb|KJB40878.1| hypothetical protein B456_007G081500 [Gossypium raimondii]
Length=525

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 6/134 (4%)
 Frame = +1

Query  841   VALEEKYDRVY----LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFK  1005
             V LE+ + R +    LGR  +S  L    Y +  +   E EI  G + P +   L+AE K
Sbjct  59    VTLEDCFGRRFGPRFLGRVDDSGKLVRDFYKIFNQVITE-EIPDGLKLPDSFSQLVAELK  117

Query  1006  GDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSN  1185
              ++ DAKTFA  L+AM+  LE+  R +K+ E + RH A++SIPK +HC SL L +E+SSN
Sbjct  118   NNQYDAKTFAFSLRAMMEKLEREIRESKVSELMNRHFAASSIPKGIHCFSLRLTDEYSSN  177

Query  1186  ANARLQLPSPELVP  1227
             A AR QLPSPEL+P
Sbjct  178   AYARRQLPSPELLP  191



>gb|EPS71758.1| hypothetical protein M569_02993, partial [Genlisea aurea]
Length=538

 Score = 89.7 bits (221),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = +1

Query  871   YLGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             +LGR+ +S      +  +    N  ++    + P +   L++E K ++ ++K FA  LK 
Sbjct  86    FLGRKDDSGRLVKEFVKMLNQVNSEKVPDTLKLPYSFSQLVSEMKSNKYNSKDFALILKG  145

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E   RH A++SIPK LHCLSL L +E+SSNANAR QLPSPE +P
Sbjct  146   MMEKYEREMRESKFSELTNRHFAASSIPKGLHCLSLRLTDEYSSNANARKQLPSPEFLP  204


 Score = 39.7 bits (91),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +3

Query  627  EMQLHISPSLRHVTVLPTKGV--KEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            +MQLH SPSLR +T+  +     ++ +K ++ +R++S+R + Y++L   FLL FVF+ TA
Sbjct  3    KMQLHFSPSLRSITISSSSSGGGRDLMKIKVAARQISYRTLLYTILFLAFLLPFVFILTA  62

Query  801  VDTIDGESKCSGIGCFGRKIRP  866
            + T++G +KCS I C GR++ P
Sbjct  63   LVTLEGVNKCSSIDCLGRRLGP  84



>ref|XP_009360552.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=534

 Score = 86.3 bits (212),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 69/112 (62%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S   L    Y VL +  N  EI  G + P +   L++E K ++ DA+TFA  L+
Sbjct  82    LGRVDDSAQRLVRDFYKVLNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFAFMLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   AMMENFEKEVRESKFSELMNKHYAASSVPKSIHCLSLRLTDEYSSNAHARKQ  192


 Score = 43.1 bits (100),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVGARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>ref|XP_004304247.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=533

 Score = 85.5 bits (210),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L +  N  EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  82    LGRVDDSGRLVRDFYKILNQ-VNTEEIPAGLKLPNSFNKLVSEMKNNQYDARTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   MMENFEKEIRESKFSELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARKQ  191


 Score = 43.9 bits (102),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVAARHISYRTVFHTILVLAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>ref|XP_010661124.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Vitis 
vinifera]
Length=533

 Score = 84.3 bits (207),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L +  N  E+  G + P T   L++E K  + DAKTFA  L+A
Sbjct  82    LGRADDSGRLVRDFYKILNQ-VNTEELPDGLKLPDTFSQLVSEMKNKQYDAKTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
             M+  LE+  R +K  E + +H A+++IPK +HCLSL L +E+SSNA+AR QLPS
Sbjct  141   MMEKLERDIRESKFAELMNKHFAASAIPKGIHCLSLRLTDEYSSNAHARKQLPS  194


 Score = 45.1 bits (105),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKA  884
            ++G +KCS   C GR++ P +  +A
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLLGRA  85



>ref|XP_008341635.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Malus 
domestica]
Length=534

 Score = 86.3 bits (212),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 69/112 (62%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S   L    Y VL +  N  EI  G + P +   L++E K ++ DA+TFA  L+
Sbjct  82    LGRVDDSAQRLVRDFYKVLNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFAFMLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   AMMENFEKEVRESKFSELMNKHYAASSVPKSIHCLSLRLTDEYSSNAHARKQ  192


 Score = 43.1 bits (100),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVGARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>ref|XP_007217256.1| hypothetical protein PRUPE_ppa004045mg [Prunus persica]
 gb|EMJ18455.1| hypothetical protein PRUPE_ppa004045mg [Prunus persica]
Length=533

 Score = 85.5 bits (210),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L +  N  EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  82    LGRVDDSGRLVRDFYKILNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   MMENFEREIRESKFSELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARKQ  191


 Score = 43.9 bits (102),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVAARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>ref|XP_008230851.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
14 [Prunus mume]
Length=527

 Score = 85.5 bits (210),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L +  N  EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  82    LGRVDDSGRLVRDFYKILNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   MMENFEREIRESKFSELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARKQ  191


 Score = 43.9 bits (102),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVAARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>ref|XP_002443426.1| hypothetical protein SORBIDRAFT_08g019260 [Sorghum bicolor]
 gb|EES17264.1| hypothetical protein SORBIDRAFT_08g019260 [Sorghum bicolor]
Length=535

 Score = 89.0 bits (219),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  V  +Y +L+E  N  E  +  + P+T ++ I + K +  D ++FA KLK
Sbjct  82    LGRGNDGSMRLVRDLYVMLDE-VNSEEAPLDLKVPETFDEFIWDMKNNDYDLRSFAFKLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  R++++ E L +H A+ +IPK L+CLSL L +E+SSNA AR QLP PELVP
Sbjct  141   ATMESMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDEYSSNALARKQLPPPELVP  200


 Score = 40.0 bits (92),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + ++ ++ +R  S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRLSPSMRSITISTSHGLLDLMRLKVAARHFSYRTVFHTVLILAFLLPFVFILTAVMT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGFNKCSSLDCLGRRLGPRLL  82



>emb|CDY26424.1| BnaC09g42440D [Brassica napus]
Length=523

 Score = 90.1 bits (222),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + +  I  G + P +   L+++ K +  D KTFA  L+A
Sbjct  73    LGRVDDSERLARDFYKILNEASTQA-IPDGLKLPDSFNHLVSDTKNNHYDPKTFALVLRA  131

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R  K  E   +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  132   MMEKFERDIRETKFAELTNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPERLP  190


 Score = 38.9 bits (89),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (49%), Gaps = 9/82 (11%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +K     I +R +   +         +            TA+ T
Sbjct  1    MQLHISPSMRSITISSSKVAARHISYRTLFHTILILAFLLPFVFIL---------TALVT  51

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  52   LEGANKCSSIDCLGRRLGPRLL  73



>ref|XP_002284273.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Vitis 
vinifera]
Length=534

 Score = 83.6 bits (205),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S   L    Y +L +  N  E+  G + P T   L++E K  + DAKTFA  L+
Sbjct  82    LGRADDSGQRLVRDFYKILNQ-VNTEELPDGLKLPDTFSQLVSEMKNKQYDAKTFAFMLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
             AM+  LE+  R +K  E + +H A+++IPK +HCLSL L +E+SSNA+AR QLPS
Sbjct  141   AMMEKLERDIRESKFAELMNKHFAASAIPKGIHCLSLRLTDEYSSNAHARKQLPS  195


 Score = 45.1 bits (105),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKA  884
            ++G +KCS   C GR++ P +  +A
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLLGRA  85



>ref|XP_009121571.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Brassica 
rapa]
Length=524

 Score = 89.7 bits (221),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    + +L E A+  +I  G + P +   L+++ K +  D KTFA  L+A
Sbjct  74    LGRVDDSERLARDFFKILNE-ASTQDIPDGLKLPDSFNHLVSDTKNNHYDPKTFALVLRA  132

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R  K  E   +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  133   MMEKFERDIRQTKFAELTNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPERLP  191


 Score = 38.9 bits (89),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (49%), Gaps = 9/82 (11%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLHISPS+R +T+  +K     I +R +   +         +            TA+ T
Sbjct  2    MQLHISPSMRSITISSSKVAARHISYRTLFHTILILAFLLPFVFIL---------TALVT  52

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS I C GR++ P + 
Sbjct  53   LEGANKCSSIDCLGRRLGPRLL  74



>ref|XP_010936345.1| PREDICTED: probable galacturonosyltransferase 13 [Elaeis guineensis]
Length=534

 Score = 86.7 bits (213),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR+ + +  L   +Y +L +  N  EI VG + P++  + + E K ++ DA+TFA  LK
Sbjct  82    LGRRGDDSARLVRDLYKILNQ-VNSEEIPVGLKVPESFNEFLTEMKNNQYDARTFAITLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+  +++  + +++ E L +H A+++IPK +HCLSL L +E+SSNA+AR Q
Sbjct  141   AMMENMDRDIKRSRLAEQLNKHFAASAIPKGIHCLSLRLTDEYSSNAHARKQ  192


 Score = 42.4 bits (98),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+R +T+  + G  + +K R+ +R + +R +F+++L   FLL FVF+ TAV T
Sbjct  1    MQLRISPSMRSITISSSNGFLDSMKVRVAARHIPYRTLFHTILALAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P I 
Sbjct  61   LEGVNKCSSLDCLGRRLGPRIL  82



>gb|EMS53278.1| putative galacturonosyltransferase 13 [Triticum urartu]
Length=535

 Score = 86.3 bits (212),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  V  +Y +L+E  N  E+ V  +  ++ +D I + K +  D K+FA +LK
Sbjct  82    LGRGEDGSMRLVRDLYRMLDE-INSEEVPVDLKVAESFDDFIWDTKNNDYDLKSFALRLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  R++++ E L +H A+ +IPK L+CLSL L + +SSNA AR QLP PELVP
Sbjct  141   ATMETMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDVYSSNALARKQLPPPELVP  200


 Score = 42.0 bits (97),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + +K +  +R  S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRLSPSMRSITISSSNGLLDLMKLKTAARHFSYRTVFHTVLILAFLLPFVFILTAVMT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGFNKCSSLDCLGRRLGPRLL  82



>ref|XP_008792744.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Phoenix 
dactylifera]
Length=534

 Score = 85.5 bits (210),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LG++ + +  L   +Y +L +  N  EI VG + P++  + + E K ++ DA+TFA  LK
Sbjct  82    LGKRSDDSARLVRDLYKILNQ-VNSEEIPVGLKVPESFNEFLIEMKNNQYDARTFAITLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+  +++  + +++ E L +H A+++IPK +HCLSL L +E+SSNA+AR Q
Sbjct  141   AMMENMDRVVKRSRLAEQLNKHFAASAIPKGIHCLSLRLTDEYSSNAHARKQ  192


 Score = 42.7 bits (99),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+R +T+  + G  + +K R+ +R + +R VF+++L   FLL FVF+ TAV T
Sbjct  1    MQLRISPSMRSITISSSNGFLDSMKVRVAARLIPYRTVFHTILALAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            ++G +KCS + C GR++ P I  K
Sbjct  61   LEGVNKCSSLDCLGRRLGPRILGK  84



>ref|XP_001755587.1| predicted protein [Physcomitrella patens]
 gb|EDQ79647.1| predicted protein [Physcomitrella patens]
Length=537

 Score = 89.4 bits (220),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = +1

Query  913   YSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKI  1092
             YS L E  +E    V    P T+E L+ E +  + D  T   ++K+M+   E+  R A++
Sbjct  102   YSALLEYRSEESTDV----PDTIEALLVEARNKQYDMPTLLRRMKSMVEVNEEKVRAARL  157

Query  1093  QEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             QE LYRH AS+ +PK LHCL+L L  E+SSNA AR  LPSP+L P
Sbjct  158   QEALYRHYASSGVPKGLHCLALKLTGEYSSNARARQDLPSPDLAP  202


 Score = 38.9 bits (89),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+HISP +R +T+  + G  + +K ++ +R +S+R VF+++L   FLL F+F+ +A+ T
Sbjct  1    MQVHISPGMRRITISTSPGFLDPLKMKVAARYLSYRCVFWTVLSLAFLLPFLFITSALIT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            ++G   C+ + CFGRK+ P +  K
Sbjct  61   LEGVHNCTSLDCFGRKLGPKLSWK  84



>ref|XP_008459373.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Cucumis 
melo]
Length=534

 Score = 83.6 bits (205),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y V  + + E EI  G + P +   L++E K +R DAKTFA  LKAM+   E+  R +K
Sbjct  96    FYKVFNQVSTE-EIPDGLKLPDSFSQLVSEMKDNRHDAKTFAFILKAMMERFEKEIRESK  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++SIPK +HCLSL L +E+SSN +AR Q
Sbjct  155   YAELMNKHFAASSIPKGIHCLSLRLTDEYSSNVHARNQ  192


 Score = 43.9 bits (102),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M+LH SPS+R +TV  + G  +F+K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MRLHFSPSMRSITVSSSNGFIDFMKIKVAARHISYRTLFHTILVLAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G + CS + CFGR   P +
Sbjct  61   LEGVNDCSSLDCFGRTWGPRL  81



>ref|XP_011656007.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Cucumis 
sativus]
 gb|KGN52500.1| hypothetical protein Csa_5G638390 [Cucumis sativus]
Length=534

 Score = 84.0 bits (206),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y V  + + E EI  G + P +   L++E K +R DAKTFA  LKAM+   E+  R +K
Sbjct  95    FYKVFNQVSTE-EIPDGLKLPDSFSQLVSEMKDNRHDAKTFAFILKAMMERFEKEIRESK  153

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++SIPK +HCLSL L +E+SSN +AR Q
Sbjct  154   YAELMNKHFAASSIPKGIHCLSLRLTDEYSSNVHARNQ  191


 Score = 43.9 bits (102),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M+LH SPS+R +TV  + G  +F+K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MRLHFSPSMRSITVSSSNGFIDFMKIKVAARHISYRTLFHTILVLAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G + CS + CFGR   P +
Sbjct  61   LEGVNDCSSLDCFGRTWGPRL  81



>ref|XP_008459374.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Cucumis 
melo]
Length=533

 Score = 83.6 bits (205),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y V  + + E EI  G + P +   L++E K +R DAKTFA  LKAM+   E+  R +K
Sbjct  95    FYKVFNQVSTE-EIPDGLKLPDSFSQLVSEMKDNRHDAKTFAFILKAMMERFEKEIRESK  153

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++SIPK +HCLSL L +E+SSN +AR Q
Sbjct  154   YAELMNKHFAASSIPKGIHCLSLRLTDEYSSNVHARNQ  191


 Score = 43.9 bits (102),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M+LH SPS+R +TV  + G  +F+K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MRLHFSPSMRSITVSSSNGFIDFMKIKVAARHISYRTLFHTILVLAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G + CS + CFGR   P +
Sbjct  61   LEGVNDCSSLDCFGRTWGPRL  81



>gb|EPS67977.1| hypothetical protein M569_06796, partial [Genlisea aurea]
Length=446

 Score = 92.0 bits (227),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = +1

Query  871   YLGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             +LGR+ +S      +  +    N  ++  G + P +   L++E K ++  +K FA  LK 
Sbjct  88    FLGRKDDSGKLFRDFVKMLNQVNSEKVPDGLKLPGSFSQLVSEMKNNKYSSKDFALILKG  147

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R +K  E + +H A++S+PK LHCLSL L  E+SSNA+AR QLPSPEL+P
Sbjct  148   MMEKFEREIRESKFAELMNKHFAASSVPKSLHCLSLRLTGEYSSNAHARTQLPSPELLP  206


 Score = 35.8 bits (81),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 56/86 (65%), Gaps = 7/86 (8%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGV-------KEFIKfrivsrrvsfrvvfyslllftfllrfvf  788
            MQLH SPS+R +T+  +          ++ +K ++  R++S+R +FY++L   FLL FVF
Sbjct  1    MQLHFSPSMRSITISSSNSGGNGNNGGRDLMKIKVAPRQISYRTLFYAILFLAFLLPFVF  60

Query  789  lfTAVDTIDGESKCSGIGCFGRKIRP  866
            + TA+ T++G +KCS I C GR++ P
Sbjct  61   ILTALVTLEGVNKCSSIDCLGRRLGP  86



>ref|XP_006452148.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 gb|ESR65388.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
Length=313

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  1063  LEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  1     MEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  56



>dbj|BAJ97300.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score = 85.5 bits (210),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  V  +Y +L+E  N  ++ V  +  ++ +D I + K +  D K+FA +LK
Sbjct  82    LGRGEDGSMRLVRDLYRMLDE-INSEDVPVDLKVAESFDDFIWDTKNNDYDLKSFALRLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  R++++ E L +H A+ +IPK L+CLSL L + +SSNA AR QLP PELVP
Sbjct  141   ATMETMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDVYSSNALARKQLPPPELVP  200


 Score = 42.0 bits (97),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + +K +  +R  S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRLSPSMRSITISSSNGLLDLMKLKTAARHFSYRTVFHTVLILAFLLPFVFILTAVMT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGFNKCSSLDCLGRRLGPRLL  82



>ref|XP_004141462.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Cucumis 
sativus]
Length=535

 Score = 83.6 bits (205),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y V  + + E EI  G + P +   L++E K +R DAKTFA  LKAM+   E+  R +K
Sbjct  96    FYKVFNQVSTE-EIPDGLKLPDSFSQLVSEMKDNRHDAKTFAFILKAMMERFEKEIRESK  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++SIPK +HCLSL L +E+SSN +AR Q
Sbjct  155   YAELMNKHFAASSIPKGIHCLSLRLTDEYSSNVHARNQ  192


 Score = 43.9 bits (102),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M+LH SPS+R +TV  + G  +F+K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MRLHFSPSMRSITVSSSNGFIDFMKIKVAARHISYRTLFHTILVLAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G + CS + CFGR   P +
Sbjct  61   LEGVNDCSSLDCFGRTWGPRL  81



>ref|XP_008379400.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Malus 
domestica]
Length=533

 Score = 84.3 bits (207),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y VL +  N  EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  82    LGRVDDSGRLVRDFYKVLNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFALMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK ++CLSL L +E+SSNA+AR Q
Sbjct  141   MMENFEREIRESKFSELMNKHFAASSIPKGIYCLSLRLTDEYSSNAHARKQ  191


 Score = 43.1 bits (100),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVGARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>ref|XP_007151295.1| hypothetical protein PHAVU_004G034200g [Phaseolus vulgaris]
 gb|ESW23289.1| hypothetical protein PHAVU_004G034200g [Phaseolus vulgaris]
Length=534

 Score = 80.9 bits (198),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 67/112 (60%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S+  L    Y +L E     E+    + P + E L+ + K ++ DAKTFA  L+
Sbjct  82    LGRVDDSSKILVRDFYKILNE-VKTGEVPPALDMPDSFEQLVTDMKSNQYDAKTFAFMLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
              M+   E+ TR AK  E + +H A++S+PK +HCL+L L +E+SSNA AR Q
Sbjct  141   GMMEKFERDTREAKFAELMNKHFAASSVPKGIHCLTLRLTDEYSSNALARKQ  192


 Score = 46.6 bits (109),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+L   G+ + +K ++ +  +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMRSITILSNNGIIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGANKCSSFDCLGRRLGPRL  81



>ref|NP_001145771.1| uncharacterized protein LOC100279278 [Zea mays]
 gb|ACL52558.1| unknown [Zea mays]
 gb|ACN25858.1| unknown [Zea mays]
 tpg|DAA55152.1| TPA: hypothetical protein ZEAMMB73_453640 [Zea mays]
Length=535

 Score = 87.8 bits (216),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  V  +Y +L++  N  E  +  + P+T ++ I + K +  D ++FA KLK
Sbjct  82    LGRGNDGSMRLVRDLYVMLDK-VNSEEAPLDLKVPETFDEFIWDMKNNDYDLRSFAFKLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  R++++ E L +H A+ +IPK L+CLSL L +E+SSNA AR QLP PELVP
Sbjct  141   ATMESMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDEYSSNALARKQLPPPELVP  200


 Score = 39.7 bits (91),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + ++ ++ +R  S+R VF+++L+  FLL FVF+ TA+ T
Sbjct  1    MQIRLSPSMRSITISTSHGLLDLMRLKVAARHFSYRTVFHTVLILAFLLPFVFILTAIMT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGFNKCSSLDCLGRRLGPRLL  82



>ref|XP_009397278.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=534

 Score = 90.1 bits (222),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGR  + ++  V  +Y +L++  N  EI VG + P++  + +++ K ++ DA TFA +L
Sbjct  81    FLGRGGDDSMKLVKDLYKILDQ-VNSEEIPVGLKLPESFSEFLSDMKNNQYDADTFAVRL  139

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KAM+  +++  + +++ E L++H A+ ++PK +HCLSL L +E+SSNA AR Q
Sbjct  140   KAMMEHMDREVKRSRLAEQLHKHFAATAVPKGIHCLSLRLTDEYSSNAQARKQ  192


 Score = 37.0 bits (84),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+  SP +R +T+  T G  + +K +  +R +S+R +F+++L   FLL FVF+ TAV T
Sbjct  1    MQIRFSPGMRSITISSTNGFLDLMKLKDAARHISYRTLFHTVLALAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++  +KCS   C GR++ P
Sbjct  61   LESVNKCSSFDCLGRRLGP  79



>ref|XP_009397279.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=498

 Score = 89.7 bits (221),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 76/113 (67%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGR  + ++  V  +Y +L++  N  EI VG + P++  + +++ K ++ DA TFA +L
Sbjct  81    FLGRGGDDSMKLVKDLYKILDQ-VNSEEIPVGLKLPESFSEFLSDMKNNQYDADTFAVRL  139

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KAM+  +++  + +++ E L++H A+ ++PK +HCLSL L +E+SSNA AR Q
Sbjct  140   KAMMEHMDREVKRSRLAEQLHKHFAATAVPKGIHCLSLRLTDEYSSNAQARKQ  192


 Score = 37.0 bits (84),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+  SP +R +T+  T G  + +K +  +R +S+R +F+++L   FLL FVF+ TAV T
Sbjct  1    MQIRFSPGMRSITISSTNGFLDLMKLKDAARHISYRTLFHTVLALAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++  +KCS   C GR++ P
Sbjct  61   LESVNKCSSFDCLGRRLGP  79



>ref|XP_008785954.1| PREDICTED: probable galacturonosyltransferase 13 [Phoenix dactylifera]
Length=534

 Score = 86.3 bits (212),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
             +Y +L++  N  EI VG + P++  + ++E K ++ DAK+FA +LKA +  +++  + ++
Sbjct  96    LYKILDQ-VNSEEIPVGLKLPESFSEFLSEMKNNQYDAKSFAIRLKATMETMDKEVKRSR  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             + E L++H A+ +IPK LHCLSL L +E+SSNA+AR Q
Sbjct  155   LAEQLHKHFAATAIPKGLHCLSLRLTDEYSSNAHARKQ  192


 Score = 40.0 bits (92),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+  SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRFSPSMRSITISSSNGFLDLMKVKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   C GR++ P
Sbjct  61   LEGVNKCSSFNCLGRRLGP  79



>ref|XP_009365847.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=533

 Score = 82.8 bits (203),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y VL +  N  EI  G + P +   L++E K ++ DA+TFA  L+A
Sbjct  82    LGRVDDSGRLVRDFYKVLNQ-VNTEEIPAGLKLPDSFNQLVSEMKNNQYDARTFAFMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK ++CLS+ L +E+SSNA+AR Q
Sbjct  141   MMENFEREIRESKFSELMNKHFAASSVPKGIYCLSMRLTDEYSSNAHARKQ  191


 Score = 43.1 bits (100),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVGARHISYRTVFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRL  81



>ref|XP_006452153.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
 gb|ESR65393.1| hypothetical protein CICLE_v10007975mg [Citrus clementina]
Length=389

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  1063  LEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             +EQ TRTAKIQEYLYRHVAS+SIPKQLHCL+L LANEHS+NA ARLQLPS ELVP+
Sbjct  1     MEQRTRTAKIQEYLYRHVASSSIPKQLHCLALRLANEHSTNAAARLQLPSAELVPA  56



>ref|XP_009399119.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=539

 Score = 85.1 bits (209),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
             +Y +L++  N  E+ VG + P +  + +++ K ++  AKTFA +LKAM+ ++++  + ++
Sbjct  96    LYKILDQ-VNSEELPVGLKVPGSFSEFLSDMKNNQDGAKTFAVRLKAMMEYMDREVKRSR  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANAR  1197
             + E L+++ A+ SIPK +HCLSL L +E+SSNA AR
Sbjct  155   LAEQLHKYFAATSIPKGMHCLSLRLTDEYSSNAQAR  190


 Score = 40.8 bits (94),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + +K ++ +R +S+R +FY++L+  FLL FVF+ TA+ T
Sbjct  1    MQIRLSPSMRSITISNSNGLLDLMKVKVAARHISYRTLFYTVLILAFLLPFVFILTAIVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            ++G +KCS   C GR++ P    +
Sbjct  61   LEGVNKCSSFDCLGRRLGPRFLSR  84



>ref|XP_009398279.1| PREDICTED: probable galacturonosyltransferase 13 [Musa acuminata 
subsp. malaccensis]
Length=534

 Score = 86.3 bits (212),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGR  + ++  V  +Y +L++  N  EI V  + P++  + +++ K ++ DAKTFA +L
Sbjct  81    FLGRGGDDSVKLVKDLYKILDQ-VNSEEILVDQKLPESFGEFLSDMKNNKYDAKTFAVRL  139

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  + +  + +++ E L++H A+ SIPK +HCLSL L +E+SSNA AR Q
Sbjct  140   KATMENMAREVKRSRLAEQLHKHFAATSIPKGIHCLSLRLTDEYSSNAQARKQ  192


 Score = 39.7 bits (91),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+  SPS+R +T+  + G  + +K ++ +R  S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRFSPSMRSITISSSNGFLDLMKVKVAARHFSYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   C GR++ P
Sbjct  61   LEGVNKCSSFDCLGRRLGP  79



>ref|XP_006593688.1| PREDICTED: probable galacturonosyltransferase 14-like isoform 
X2 [Glycine max]
Length=533

 Score = 83.6 bits (205),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLE-STLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  + + L   +Y++L E     EI    E P + + L+++ K ++ DAKTFA  L+ 
Sbjct  82    LGRVDDPARLVRDLYNILNE-VKTGEIPSALELPDSFDQLVSDMKNNQYDAKTFAFMLRG  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNANAR Q
Sbjct  141   MMQKFEREIRESKFSELMNKHFAASSVPKGIHCLSLRLTDEYSSNANARKQ  191


 Score = 42.0 bits (97),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMRSITISSNNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPKL  81



>emb|CDX90990.1| BnaC02g06070D [Brassica napus]
Length=535

 Score = 86.7 bits (213),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y++L + A+  EI  G + P +   LI++ K +R DAKTFA  L+A
Sbjct  85    LGRVDDSERLARDFYTILND-ASTQEIPHGLKLPDSFRHLISDIKNNRYDAKTFALVLRA  143

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E   +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  144   MMEKFERDIRESKFAELTNKHFAASSIPKGIHCLSLKLTDEYSSNAHARRQ  194


 Score = 39.3 bits (90),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKG---VKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            MQLH+SPS+R +T+  +       + +K ++ +R +S+R +F+++L+  FLL FVF+ TA
Sbjct  1    MQLHVSPSMRSITISSSSNEFTTSDLMKIKLAARHISYRTLFHTILILAFLLPFVFILTA  60

Query  801  VDTIDGESKCSGIGCFGRKIRPSIF  875
            + T++G +KCS I C GR++ P + 
Sbjct  61   LVTLEGANKCSSIDCLGRRLGPRLL  85



>ref|XP_003543923.1| PREDICTED: probable galacturonosyltransferase 14-like isoform 
X1 [Glycine max]
 gb|KHN07148.1| Putative galacturonosyltransferase 13 [Glycine soja]
Length=534

 Score = 83.6 bits (205),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
             +Y++L E     EI    E P + + L+++ K ++ DAKTFA  L+ M+   E+  R +K
Sbjct  96    LYNILNE-VKTGEIPSALELPDSFDQLVSDMKNNQYDAKTFAFMLRGMMQKFEREIRESK  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++S+PK +HCLSL L +E+SSNANAR Q
Sbjct  155   FSELMNKHFAASSVPKGIHCLSLRLTDEYSSNANARKQ  192


 Score = 42.0 bits (97),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMRSITISSNNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPKL  81



>ref|XP_009126048.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Brassica 
rapa]
Length=535

 Score = 85.9 bits (211),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y++L E A+  EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  85    LGRVDDSERLARDFYTILNE-ASTQEIPHGLKLPDSFRHLVSDIKNNHYDAKTFALVLRA  143

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   EQ  R +K  E   +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  144   MMEKFEQDIRESKFAELTNKHFAASSIPKGIHCLSLKLTDEYSSNAHARRQ  194


 Score = 39.3 bits (90),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKG---VKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            MQLH+SPS+R +T+  +       + +K ++ +R +S+R +F+++L+  FLL FVF+ TA
Sbjct  1    MQLHVSPSMRSITISSSSNEFTTSDLMKIKLAARHISYRTLFHTILILAFLLPFVFILTA  60

Query  801  VDTIDGESKCSGIGCFGRKIRPSIF  875
            + T++G +KCS I C GR++ P + 
Sbjct  61   LVTLEGANKCSSIDCLGRRLGPRLL  85



>gb|KHF97963.1| putative galacturonosyltransferase 14 -like protein [Gossypium 
arboreum]
Length=532

 Score = 94.4 bits (233),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L + +Y +L +  N  EI  G + P +   L+++ K ++ DAKTF   L+A
Sbjct  82    LGRVDDSGRLVKDLYMILNQ-VNSEEIPEGLKLPDSFSHLVSDMKNNQYDAKTFGLMLRA  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
              I  LE     ++  E + +H A++SIP+ +HCLSL L NE+SSNA+AR QLPSPEL+P
Sbjct  141   TIMKLETEIMESRFSELMNKHFAASSIPRGIHCLSLRLTNEYSSNAHARRQLPSPELLP  199


 Score = 30.8 bits (68),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA  T++G  KCS   C GR++ P I 
Sbjct  56   TAFFTLEGVDKCSSFDCLGRRLGPRIL  82



>emb|CDX85550.1| BnaA02g02630D [Brassica napus]
Length=537

 Score = 85.9 bits (211),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y++L E A+  EI  G + P +   L+++ K +  DAKTFA  L+A
Sbjct  85    LGRVDDSERLARDFYTILNE-ASTQEIPHGLKLPDSFRHLVSDIKNNHYDAKTFALVLRA  143

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   EQ  R +K  E   +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  144   MMEKFEQDIRESKFAELTNKHFAASSIPKGIHCLSLKLTDEYSSNAHARRQ  194


 Score = 39.3 bits (90),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKG---VKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            MQLH+SPS+R +T+  +       + +K ++ +R +S+R +F+++L+  FLL FVF+ TA
Sbjct  1    MQLHVSPSMRSITISSSSNEFTTSDLMKIKLAARHISYRTLFHTILILAFLLPFVFILTA  60

Query  801  VDTIDGESKCSGIGCFGRKIRPSIF  875
            + T++G +KCS I C GR++ P + 
Sbjct  61   LVTLEGANKCSSIDCLGRRLGPRLL  85



>ref|XP_006664673.1| PREDICTED: probable galacturonosyltransferase 13-like [Oryza 
brachyantha]
Length=534

 Score = 93.6 bits (231),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  V  +Y VL+E  N  E+ V  + P + ++ I + K +  D ++FA +LK
Sbjct  81    LGRGNDGSMRIVRDLYRVLDE-INSEEVPVDLKVPDSFDEFIWDMKNNDYDLRSFAFRLK  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  RT+++ E L +H A+ +IPK LHCLSL L +E+SSNA AR QLP PEL+P
Sbjct  140   ATMESMDRELRTSRLSEQLNKHYAAIAIPKGLHCLSLRLTDEYSSNALARKQLPPPELIP  199


 Score = 31.2 bits (69),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G +KCS + C GR++ P + 
Sbjct  55   TALVTLEGFNKCSSLDCLGRRLGPRLL  81



>ref|XP_009388912.1| PREDICTED: probable galacturonosyltransferase 13 [Musa acuminata 
subsp. malaccensis]
Length=534

 Score = 85.5 bits (210),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGR  + ++  V  +Y +L++  N  EI  G +  ++  + ++  K ++ DAKTFA +L
Sbjct  81    FLGRGGDDSMKLVKELYEILDQ-VNSEEIPAGLKLTESFSEFLSHMKNNQYDAKTFAVRL  139

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +E+  R +++ E L++H A+ +IPK +HCLSL L +E+SSNA AR Q
Sbjct  140   KATMENMEREVRRSRLAEQLHKHFAATAIPKGIHCLSLRLTDEYSSNAQARKQ  192


 Score = 39.3 bits (90),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+  SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQISFSPSMRSITISSSNGFLDLMKVKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   C GR++ P
Sbjct  61   LEGVNKCSSFDCLGRRLGP  79



>gb|AFJ12115.1| glycosyltransferase, partial [Nicotiana tabacum]
Length=223

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  1075  TRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVPS  1230
             TRTAKIQEYLYRHVAS+SIPKQLHCL+L LA+EHS+N+NARLQLP PELVP+
Sbjct  1     TRTAKIQEYLYRHVASSSIPKQLHCLALKLAHEHSTNSNARLQLPLPELVPA  52



>ref|XP_010467967.1| PREDICTED: probable galacturonosyltransferase 13 [Camelina sativa]
Length=525

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 82/135 (61%), Gaps = 7/135 (5%)
 Frame = +1

Query  841   VALEEKYDRVY----LGR--QLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEF  1002
             V LE+ + R      LGR    E  L    Y +L E + + EI  G + P +   L+++ 
Sbjct  59    VTLEDCFGRRLGPRLLGRVDDSEQRLLRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDM  117

Query  1003  KGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSS  1182
             K +  DAKTFA  L+AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SS
Sbjct  118   KNNHYDAKTFALVLRAMVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSS  177

Query  1183  NANARLQLPSPELVP  1227
             NA+AR QLPSPEL+P
Sbjct  178   NAHARRQLPSPELLP  192



>ref|XP_006482685.1| PREDICTED: probable galacturonosyltransferase 14-like [Citrus 
sinensis]
 gb|KDO72666.1| hypothetical protein CISIN_1g009348mg [Citrus sinensis]
Length=537

 Score = 84.7 bits (208),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y VL +   E EI  G + P +  +L++E K ++ DAKTF   L+A
Sbjct  86    LGRVDDSERLVKDFYKVLNQVDTE-EIPDGLKLPDSFSELVSEMKNNQYDAKTFGFMLRA  144

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  145   MMEKFEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQ  195


 Score = 39.3 bits (90),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK----GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfT  797
            MQLH SPS+R +T+L +     G  + +K ++ +R +S+R +F+++L+  FLL FVF+ T
Sbjct  1    MQLHFSPSMRSITILSSNSNNGGFIDLMKIKVAARHLSYRTLFHTILILAFLLPFVFILT  60

Query  798  AVDTIDGESKCSGIGCFGRKIRPSIF  875
            A+ T++G  KCS   C GR++ P + 
Sbjct  61   ALVTLEGVDKCSSFDCLGRRLGPRLL  86



>ref|XP_006431227.1| hypothetical protein CICLE_v10011444mg [Citrus clementina]
 gb|ESR44467.1| hypothetical protein CICLE_v10011444mg [Citrus clementina]
Length=537

 Score = 84.7 bits (208),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +  Y VL +   E EI  G + P +  +L++E K ++ DAKTF   L+A
Sbjct  86    LGRVDDSERLVKDFYKVLNQVDTE-EIPDGLKLPDSFSELVSEMKNNQYDAKTFGFMLRA  144

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  145   MMEKFEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQ  195


 Score = 39.3 bits (90),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK----GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfT  797
            MQLH SPS+R +T+L +     G  + +K ++ +R +S+R +F+++L+  FLL FVF+ T
Sbjct  1    MQLHFSPSMRSITILSSNSNNGGFIDLMKIKVAARHLSYRTLFHTILILAFLLPFVFILT  60

Query  798  AVDTIDGESKCSGIGCFGRKIRPSIF  875
            A+ T++G  KCS   C GR++ P + 
Sbjct  61   ALVTLEGVDKCSSFDCLGRRLGPRLL  86



>gb|KFK37568.1| hypothetical protein AALP_AA3G000200 [Arabis alpina]
Length=538

 Score = 96.7 bits (239),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E + + EI  G + P +   L+++ K +  DA+TF+  L+A
Sbjct  88    LGRVDDSERLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDMKNNHYDARTFSLVLRA  146

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             MI   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  147   MIEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPEFLP  205


 Score = 26.9 bits (58),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 20/41 (49%), Gaps = 14/41 (34%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIG--------------CFGRKIRPSIF  875
            TAV T++G +KCS IG              C GR+I P + 
Sbjct  48   TAVVTLEGVNKCSSIGKPLSLKVWILSPVYCLGRRIGPRLL  88



>ref|XP_010089605.1| putative galacturonosyltransferase 14 [Morus notabilis]
 gb|EXB38076.1| putative galacturonosyltransferase 14 [Morus notabilis]
Length=534

 Score = 82.8 bits (203),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 69/112 (62%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S   L    Y+VL +  N   I    + P +   L++E K ++ DAKTFA  L+
Sbjct  82    LGRVDDSGQRLVRDFYNVLNQ-VNTEVIPADLKLPDSFSQLVSEMKNNQYDAKTFAIMLR  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  141   AMMEKLEREMRESKFSELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  192


 Score = 40.4 bits (93),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL  SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLRFSPSMRSITISSSNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P + 
Sbjct  61   LEGVNKCSSFDCLGRRLGPRLL  82



>ref|NP_001067123.1| Os12g0578500 [Oryza sativa Japonica Group]
 gb|ABA99070.1| Glycosyl transferase family 8 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30142.1| Os12g0578500 [Oryza sativa Japonica Group]
 gb|EAZ20994.1| hypothetical protein OsJ_36645 [Oryza sativa Japonica Group]
 dbj|BAG89538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=554

 Score = 91.7 bits (226),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 78/120 (65%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + ++  +  +Y +L+E  N  E+ V  + P + ++ I + K +  D ++FA +LK
Sbjct  101   LGRGNDGSMRVMRDLYRMLDE-INSEEVPVDLKVPDSFDEFIWDMKNNDYDLRSFAFRLK  159

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  RT+++ E L +H A+ +IPK LHCLSL L +E+SSNA AR QLP PEL+P
Sbjct  160   ATMESMDRELRTSRLSEQLNKHYAAIAIPKGLHCLSLRLTDEYSSNALARKQLPPPELIP  219


 Score = 31.2 bits (69),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G +KCS + C GR++ P + 
Sbjct  75   TALVTLEGFNKCSSLDCLGRRLGPRLL  101



>ref|XP_003554778.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X1 [Glycine max]
 gb|KHN48809.1| Putative galacturonosyltransferase 13 [Glycine soja]
Length=534

 Score = 80.9 bits (198),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y++L E     EI    E P + + L+++ K ++ DAKTFA  L+ M+   E+  R +K
Sbjct  96    FYNILNE-VKTREIPSALELPDSFDQLVSDMKSNQYDAKTFAFMLRGMMQKFEREIRESK  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  155   FSELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARKQ  192


 Score = 41.2 bits (95),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMRSITISSKNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPKL  81



>ref|XP_006603902.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X4 [Glycine max]
Length=533

 Score = 80.9 bits (198),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLE-STLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  + + L    Y++L E     EI    E P + + L+++ K ++ DAKTFA  L+ 
Sbjct  82    LGRVDDPARLVRDFYNILNE-VKTREIPSALELPDSFDQLVSDMKSNQYDAKTFAFMLRG  140

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  141   MMQKFEREIRESKFSELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARKQ  191


 Score = 41.2 bits (95),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMRSITISSKNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIGCFGRKIRPSI  872
            ++G +KCS   C GR++ P +
Sbjct  61   LEGVNKCSSFDCLGRRLGPKL  81



>ref|XP_012084795.1| PREDICTED: probable galacturonosyltransferase 14 isoform X3 [Jatropha 
curcas]
 gb|KDP27214.1| hypothetical protein JCGZ_19913 [Jatropha curcas]
Length=535

 Score = 87.0 bits (214),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +1

Query  871   YLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR   S  L +  Y +L +  NE EI  G + P +   L++E K  + DAKTFA  L+
Sbjct  83    FLGRADASGRLVKDFYKILNQVNNE-EIPEGLKLPDSFNQLVSEMKSSQYDAKTFAFMLR  141

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  142   AMMEKFEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  193


 Score = 34.3 bits (77),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK--GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLHISPS+R +T+      G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+
Sbjct  1    MQLHISPSMRSITISSNSSNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAL  60

Query  804  DTIDGESKCSGIGCFGRKIRPSIFRKA  884
             T++G +KCS   C GR++ P    +A
Sbjct  61   VTLEGVNKCSSFDCLGRRLGPRFLGRA  87



>ref|XP_008805098.1| PREDICTED: probable galacturonosyltransferase 14 [Phoenix dactylifera]
Length=534

 Score = 80.1 bits (196),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGR  + +  L   +Y +L +  +  EI VG   P++  + + E K ++ DA+TFA  L
Sbjct  81    FLGRGGDDSAKLVRDLYKILNQ-VDSKEIPVGLVLPESFSEFLTEMKNNQYDARTFAITL  139

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  + +  + A++ E L +H A+++IPK +HCL+L L +E+SSNA+AR Q
Sbjct  140   KATMENMNREVKRARLAEQLNKHFAASAIPKGIHCLALRLTDEYSSNAHARKQ  192


 Score = 41.2 bits (95),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+R +T+  + G  + +K R+ +R V +R +F+++L   FLL FVF+ TAV T
Sbjct  1    MQLRISPSMRSITISSSNGFLDSMKVRVAARHVPYRTLFHTILALAFLLPFVFILTAVIT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS + C GR++ P
Sbjct  61   LEGVNKCSSLDCLGRRLGP  79



>ref|XP_002526079.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF36273.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=540

 Score = 84.7 bits (208),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 69/119 (58%), Gaps = 10/119 (8%)
 Frame = +1

Query  874   LGRQL---------ESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAK  1026
             LGR+L            L +  Y +L +  N+ EI  G + P +   L+ E K +  DAK
Sbjct  81    LGRRLGPRFGIGDDSGRLVKDFYKILNQ-VNKEEIPDGLKLPDSFNQLVFEMKSNHYDAK  139

Query  1027  TFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             TFA  L+AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  140   TFAFMLRAMMEKFEREIRESKFSELMNKHFAASSIPKSIHCLSLRLTDEYSSNAHARKQ  198


 Score = 36.2 bits (82),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 57/87 (66%), Gaps = 8/87 (9%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK--------GVKEFIKfrivsrrvsfrvvfyslllftfllrfv  785
            MQLHISPS+R +T+  +         G  + +K ++ +R +S+R +F+++L+  FLL FV
Sbjct  1    MQLHISPSMRSITISSSNSSSSNNNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFV  60

Query  786  flfTAVDTIDGESKCSGIGCFGRKIRP  866
            F+ TA+ T++G +KCS   C GR++ P
Sbjct  61   FILTALVTLEGVNKCSSFDCLGRRLGP  87



>ref|XP_010032534.1| PREDICTED: probable galacturonosyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW51923.1| hypothetical protein EUGRSUZ_J01378 [Eucalyptus grandis]
Length=533

 Score = 73.9 bits (180),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +1

Query  970   PQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHC  1149
             P + + L+ E + ++ DA+TFA KL+AM+   E+  R +K  E + +H A++S+PK ++C
Sbjct  114   PDSFDQLVLEIQNNQYDARTFALKLRAMMEKFEREIRESKFAELMNKHFAASSVPKGIYC  173

Query  1150  LSLMLANEHSSNANARLQLPS  1212
             LSL L +E+SSNA+AR QLPS
Sbjct  174   LSLRLTDEYSSNAHARKQLPS  194


 Score = 47.0 bits (110),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFVDLMKIKVAARHISYRTLFHTILVLAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            ++G +KCS   C GR+  P I R+
Sbjct  61   LEGVNKCSSFDCLGRRFGPRILRR  84



>ref|XP_012084794.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Jatropha 
curcas]
Length=536

 Score = 86.3 bits (212),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGR   S   L +  Y +L +  NE EI  G + P +   L++E K  + DAKTFA  L
Sbjct  83    FLGRADASGQRLVKDFYKILNQVNNE-EIPEGLKLPDSFNQLVSEMKSSQYDAKTFAFML  141

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             +AM+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  142   RAMMEKFEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  194


 Score = 34.3 bits (77),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK--GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLHISPS+R +T+      G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+
Sbjct  1    MQLHISPSMRSITISSNSSNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAL  60

Query  804  DTIDGESKCSGIGCFGRKIRPSIFRKA  884
             T++G +KCS   C GR++ P    +A
Sbjct  61   VTLEGVNKCSSFDCLGRRLGPRFLGRA  87



>ref|XP_007139505.1| hypothetical protein PHAVU_008G035400g [Phaseolus vulgaris]
 gb|ESW11499.1| hypothetical protein PHAVU_008G035400g [Phaseolus vulgaris]
Length=535

 Score = 82.8 bits (203),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E     EI    + P + E L+++ K ++ DAKTFA  L+ 
Sbjct  84    LGRVDDSGRLVRDFYKILNE-VKAGEIPPDLKLPDSFEQLVSDMKNNQYDAKTFAIMLRG  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+  L++  R +K  E + +H A++SIPK +HCLSL L +E+SSNANAR Q
Sbjct  143   MMEKLQREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNANARKQ  193


 Score = 37.7 bits (86),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK--GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLH SPS+R +T+  +   G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+
Sbjct  1    MQLHFSPSMRSITISSSNNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAL  60

Query  804  DTIDGESKCSGIGCFGRKIRPSIF  875
             T++G +KCS   C GR++ P + 
Sbjct  61   VTLEGVNKCSSFDCLGRRLGPRLL  84



>ref|XP_003578583.1| PREDICTED: probable galacturonosyltransferase 13 [Brachypodium 
distachyon]
Length=535

 Score = 77.8 bits (190),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + +  L   +Y +L+E  N  ++    +  ++ ++ I + K +  + K+FA +LK
Sbjct  82    LGRGDDGSMRLTRDLYRMLDE-INSEDVPGDLKGAESFDEFILDMKNNDYNLKSFAFRLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             A +  +++  R++++ E L +H A+ +IPK L+CLSL L + +SSNA AR QLP PELVP
Sbjct  141   ATMESMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDVYSSNALARKQLPPPELVP  200


 Score = 42.0 bits (97),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + +K +  +R  S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRLSPSMRSITISSSNGLLDLMKLKAAARHFSYRTVFHTVLILAFLLPFVFILTAVMT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGFNKCSSLDCLGRRLGPRLL  82



>ref|XP_010550020.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Tarenaya 
hassleriana]
Length=533

 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 12/129 (9%)
 Frame = +1

Query  874   LGRQL-----------ESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPD  1020
             LGR+L           E  L    Y +L E + + EI  G + P +   L+++ K +  D
Sbjct  73    LGRRLGPRLLGRVDGSEQRLVRDFYKILNEVSTQ-EIPDGLKLPDSFSQLVSDVKNNNYD  131

Query  1021  AKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARL  1200
             A+TF   L+AMI   E+  R  K  E + +H A++SIPK +HCLSL L +E+SSNA+AR 
Sbjct  132   ARTFGLVLRAMIEKFERDIRETKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARR  191

Query  1201  QLPSPELVP  1227
             QLPSPE +P
Sbjct  192   QLPSPEFLP  200



>ref|XP_010923584.1| PREDICTED: probable galacturonosyltransferase 13 [Elaeis guineensis]
Length=534

 Score = 79.7 bits (195),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
             +Y +L++  N  EI  G + P++  + ++E K ++ DAK+FA +LKA +  +++  + ++
Sbjct  96    LYKILDQ-LNSEEIPPGLKLPESFSEFLSEMKNNQYDAKSFAIRLKATMENMDREVKRSR  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             + E L++H A+ +IPK L+CLSL L +E+SSNA+AR Q
Sbjct  155   LAEQLHKHFAATAIPKGLYCLSLRLTDEYSSNAHARKQ  192


 Score = 40.0 bits (92),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+  SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+   LL FVF+ TAV T
Sbjct  1    MQIRFSPSMRSITISSSNGFLDLMKVKVAARHISYRTLFHTILILALLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS   C GR++ P
Sbjct  61   LEGVNKCSSFNCLGRRLGP  79



>emb|CAN68963.1| hypothetical protein VITISV_019278 [Vitis vinifera]
Length=548

 Score = 84.7 bits (208),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 3/120 (3%)
 Frame = +1

Query  859   YDRVYLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTF  1032
             +D+ +L  Q+ S   L    Y +L +  N  E+  G + P T   L++E K  + DAKTF
Sbjct  91    WDQGFLVEQMISGQRLVRDFYKILNQ-VNTEELPDGLKLPDTFSQLVSEMKNKQYDAKTF  149

Query  1033  AAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
             A  L+AM+  LE+  R +K  E + +H A+++IPK +HCLSL L +E+SSNA+AR QLPS
Sbjct  150   AFMLRAMMEKLERDIRESKFAELMNKHFAASAIPKGIHCLSLRLTDEYSSNAHARKQLPS  209


 Score = 35.0 bits (79),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+  + G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLHFSPSMRSITISSSNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIG  842
            ++G +KCS  G
Sbjct  61   LEGVNKCSSFG  71



>ref|XP_010904951.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Elaeis 
guineensis]
Length=534

 Score = 78.2 bits (191),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 69/112 (62%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  + +  L   +Y +L +  +E EI  G E P +    + E K ++ DA+TFA  LK
Sbjct  82    LGRGGDDSAKLVRDLYKILNQVDSE-EIPGGLELPASFSGFLTEMKNNQYDARTFAITLK  140

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             A +  + +  + A++ E L +H A+++IPK +HCL+L L +E+SSNA+AR Q
Sbjct  141   ATMENMNREVKRARLAEQLNKHFAASAIPKGIHCLALRLTDEYSSNAHARKQ  192


 Score = 41.6 bits (96),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+R +T+  + G  + +K ++ +R V +R +F+++L   FLL FVF+ TAV T
Sbjct  1    MQLRISPSMRSITISSSNGFLDSMKVKVAARHVPYRTLFHTILALAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS + C GR++ P + 
Sbjct  61   LEGVNKCSSLDCLGRRLGPRLL  82



>ref|XP_012084793.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Jatropha 
curcas]
Length=547

 Score = 84.7 bits (208),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y +L +  NE EI  G + P +   L++E K  + DAKTFA  L+AM+   E+  R +K
Sbjct  109   FYKILNQVNNE-EIPEGLKLPDSFNQLVSEMKSSQYDAKTFAFMLRAMMEKFEREIRESK  167

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  168   FAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  205


 Score = 34.7 bits (78),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 58/87 (67%), Gaps = 2/87 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK--GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLHISPS+R +T+      G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+
Sbjct  1    MQLHISPSMRSITISSNSSNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAL  60

Query  804  DTIDGESKCSGIGCFGRKIRPSIFRKA  884
             T++G +KCS   C GR++ P    +A
Sbjct  61   VTLEGVNKCSSFDCLGRRLGPRFLGRA  87



>gb|AES74845.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=533

 Score = 78.2 bits (191),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +1

Query  871   YLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y++L E     E+    + P + + ++++ K ++ DAKTFA  LK
Sbjct  81    FLGRADDSARLVRDFYNILNE-VKTGEVPSSLKLPDSFDQMVSDMKNNQYDAKTFAFMLK  139

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
              M+   E   R +K  E + +H A++SIPK ++CLSL L +E+SSNA+AR Q
Sbjct  140   RMMEKFENEIRESKFAELMNKHFAASSIPKGINCLSLRLTDEYSSNAHARKQ  191


 Score = 40.4 bits (93),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL  SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLQFSPSMRSITISSNNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIGCFGRKIRPSIFRKA  884
            ++G +KCS   C GR++ P    +A
Sbjct  61   LEGVNKCSSFDCLGRRLGPRFLGRA  85



>gb|EPS70077.1| hypothetical protein M569_04673 [Genlisea aurea]
Length=543

 Score = 84.7 bits (208),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = +1

Query  874   LGRQLESTLPEV------IYSVLEEPANETEIQVGPET---PQTLEDLIAEFKGDRPDAK  1026
             LGR+L S           +   L +  N+   +  PE+   P +   L++E K +   +K
Sbjct  81    LGRRLGSKFLGTSDDSGRLVKDLSKMLNQVSSEKIPESLRLPNSFHQLVSEMKANSYSSK  140

Query  1027  TFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQL  1206
              FA  LK M+   E   R AK  E + +H AS +IPK +HCL L L +E+SSNA AR QL
Sbjct  141   EFALLLKGMVERFESEIREAKFAELMNKHFASTAIPKSIHCLMLRLTDEYSSNAYARRQL  200

Query  1207  PSPELVP  1227
             PSPEL+P
Sbjct  201   PSPELLP  207


 Score = 33.5 bits (75),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVK--------EFIKfrivsrrvsfrvvfyslllftfllrfv  785
            MQLH SPS+R +T+               + +K ++ +R++S+R  F+++L+ +FLL FV
Sbjct  1    MQLHFSPSMRSITISSGSSRGNGNGGGSGDLMKIKLAARQLSYRAFFHTILVLSFLLPFV  60

Query  786  flfTAVDTIDGESKCSGIGCFGRKI  860
            F+ TA+ T++G +KCS + C GR++
Sbjct  61   FILTAIITLEGANKCSSLDCLGRRL  85



>ref|XP_010939106.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Elaeis 
guineensis]
Length=548

 Score = 80.9 bits (198),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
             +Y +L++  +E E+ +G + P++  + ++E K ++ +AK+FA +LKA +  ++   +T++
Sbjct  96    LYKILDQVYSE-EVPIGLKLPESFREFLSEMKNNQYNAKSFAIRLKATMENMDSEVKTSR  154

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E L++HVA+ +IPK LHCLSL L +E+ SNA+AR Q
Sbjct  155   QAEQLHKHVAATTIPKGLHCLSLRLTDEYLSNAHARKQ  192


 Score = 37.0 bits (84),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            M++  SPS+R +T+    G+ + +K +  +RR+S+R + +++L+  FLL FVF+ TAV T
Sbjct  1    MRIRFSPSMRSITLSSRNGLLDLMKVKAAARRISYRTLSHTILILAFLLPFVFILTAVIT  60

Query  810  IDGESKCSGIGCFGRKIRPSIF  875
            ++G +KCS   C GR++ P   
Sbjct  61   LEGVNKCSTFNCLGRRLGPKFL  82



>gb|AES77579.2| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=558

 Score = 81.3 bits (199),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E     EI    + P + + L+++ K ++ DAKTFA  L+ 
Sbjct  87    LGRVDDSGRLVRDFYKILHE-VKTGEIPADLKLPDSFDKLVSDMKNNQYDAKTFAFMLRG  145

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  146   MMEKFEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  196


 Score = 36.2 bits (82),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPT-----KGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflf  794
            MQLH SPS+R +T+  +      G  + +K ++ +R +S+R +F+++L+  FLL FVF+ 
Sbjct  1    MQLHFSPSMRSITISSSTNNHQNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFIL  60

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G +KCS   C GR++ P + 
Sbjct  61   TALVTLEGVNKCSSFDCLGRRLGPRLL  87



>gb|KEH21641.1| CAZy family GT8 glycosyltransferase [Medicago truncatula]
Length=458

 Score = 81.3 bits (199),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E     EI    + P + + L+++ K ++ DAKTFA  L+ 
Sbjct  87    LGRVDDSGRLVRDFYKILHE-VKTGEIPADLKLPDSFDKLVSDMKNNQYDAKTFAFMLRG  145

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  146   MMEKFEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  196


 Score = 36.6 bits (83),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPT-----KGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflf  794
            MQLH SPS+R +T+  +      G  + +K ++ +R +S+R +F+++L+  FLL FVF+ 
Sbjct  1    MQLHFSPSMRSITISSSTNNHQNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFIL  60

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSI  872
            TA+ T++G +KCS   C GR++ P +
Sbjct  61   TALVTLEGVNKCSSFDCLGRRLGPRL  86



>emb|CBI22287.3| unnamed protein product [Vitis vinifera]
Length=511

 Score = 83.6 bits (205),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR  +S   L    Y +L +  N  E+  G + P T   L++E K  + DAKTFA  L+
Sbjct  59    LGRADDSGQRLVRDFYKILNQ-VNTEELPDGLKLPDTFSQLVSEMKNKQYDAKTFAFMLR  117

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
             AM+  LE+  R +K  E + +H A+++IPK +HCLSL L +E+SSNA+AR QLPS
Sbjct  118   AMMEKLERDIRESKFAELMNKHFAASAIPKGIHCLSLRLTDEYSSNAHARKQLPS  172


 Score = 33.1 bits (74),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIFRKA  884
            TAV T++G +KCS   C GR++ P +  +A
Sbjct  33   TAVVTLEGVNKCSSFDCLGRRLGPRLLGRA  62



>gb|EMT08056.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=537

 Score = 83.2 bits (204),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 74/122 (61%), Gaps = 1/122 (1%)
 Frame = +1

Query  862   DRVYLGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAK  1041
             D  + G   +  L   +Y +L+E  N  +  V  +  ++ +D I + K +  D K+FA +
Sbjct  82    DPTWCGSFKDWRLVRDLYRMLDE-INSEDAPVDLKVAESFDDFIWDTKNNDYDLKSFALR  140

Query  1042  LKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPEL  1221
             LKA +  +++  R++++ E L +H A+ +IPK L+CLSL L + +SSNA AR QLP PEL
Sbjct  141   LKATMETMDKELRSSRLSEQLNKHYAAIAIPKGLYCLSLRLTDVYSSNALARKQLPPPEL  200

Query  1222  VP  1227
             VP
Sbjct  201   VP  202


 Score = 33.9 bits (76),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQ+ +SPS+R +T+  + G+ + +K +  +R  S+R VF+++L+  FLL FVF+ TAV T
Sbjct  1    MQIRLSPSMRSITISSSNGLLDLMKLKTAARHFSYRTVFHTVLILAFLLPFVFILTAVMT  60

Query  810  IDGESKCSGIGCFGRKIRPS  869
            ++G +KCS +G       PS
Sbjct  61   LEGFNKCSSLGVRLASYNPS  80



>ref|XP_006338386.1| PREDICTED: probable galacturonosyltransferase 14-like [Solanum 
tuberosum]
Length=534

 Score = 73.9 bits (180),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  934   ANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRH  1113
              N  E+  G + P++   L+AE K ++  AK FA  LK M+   E+  R +K  E   +H
Sbjct  104   VNTEEVPAGLKLPESFSQLVAEMKNNKYSAKEFALVLKGMMEKSEREIRESKFAELTNKH  163

Query  1114  VASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
              A+++IPK +HCLSL L +E+SSNA+AR QLPS
Sbjct  164   FAASAIPKGIHCLSLRLTDEYSSNAHARRQLPS  196


 Score = 42.7 bits (99),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK--GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLH SPS+R VT+  +   G  + +K ++ +R  S+R VF+++L+  F L FVF+ TAV
Sbjct  1    MQLHFSPSMRSVTISSSSNGGYGDLMKIKVAARHFSYRNVFHTILILAFFLPFVFILTAV  60

Query  804  DTIDGESKCSGIGCFGRKIRPSIF  875
             T++G +KCS I C GR++ PS+ 
Sbjct  61   VTLEGVNKCSSIDCLGRRLGPSLL  84



>ref|XP_004491881.1| PREDICTED: probable galacturonosyltransferase 14-like [Cicer 
arietinum]
Length=535

 Score = 77.8 bits (190),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E     E+    + P + + L+++   ++ DAKTFA  L+ 
Sbjct  84    LGRVDDSGRLVRDFYKILNE-VKTGELPADLKLPDSFDQLVSDMNNNQYDAKTFAFMLRG  142

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  143   MMEKFEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  193


 Score = 38.9 bits (89),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 57/83 (69%), Gaps = 2/83 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPT--KGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLH SPS+R +T+  T   G  + +K ++ +R +S+R +F+++L+  FLL FVF+ TA+
Sbjct  1    MQLHFSPSMRSITISSTTNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAL  60

Query  804  DTIDGESKCSGIGCFGRKIRPSI  872
             T++G +KCS   C GR++ P +
Sbjct  61   VTLEGVNKCSSFDCLGRRLGPRL  83



>emb|CDX91967.1| BnaC03g32690D [Brassica napus]
Length=529

 Score = 81.3 bits (199),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y +L E  +  +I  G + P +   L+++ K +  DAKTF+  L+AMI   E+ TR +K
Sbjct  92    FYKILNE-VSTPDIPDGLKLPASFRQLVSDMKNNHYDAKTFSLVLRAMIEKFERDTRESK  150

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++SIPK +HCLSL L +E++SNA+AR Q
Sbjct  151   FAELMNKHFAASSIPKGIHCLSLRLTDEYTSNAHARRQ  188


 Score = 35.8 bits (81),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+R +T+       + +K ++  R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLQISPSMRSITI---SSSNDLMKIKVAPRHISYRTLFHTILILAFLLPFVFIVTALVT  57

Query  810  IDGESKCSGIGCFGRKIRP  866
            ++G +KCS I C GR++ P
Sbjct  58   LEGVNKCSSIDCLGRRLGP  76



>ref|XP_006603901.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X3 [Glycine max]
Length=539

 Score = 81.3 bits (199),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLE-STLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  + + L    Y++L E     EI    E P + + L+++ K ++ DAKTFA  L+ 
Sbjct  88    LGRVDDPARLVRDFYNILNE-VKTREIPSALELPDSFDQLVSDMKSNQYDAKTFAFMLRG  146

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  147   MMQKFEREIRESKFSELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARKQ  197


 Score = 35.4 bits (80),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMRSITISSKNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIG------CFGRKIRPSI  872
            ++G +KCS         C GR++ P +
Sbjct  61   LEGVNKCSSFAELLWSDCLGRRLGPKL  87



>ref|XP_009134641.1| PREDICTED: probable galacturonosyltransferase 13 isoform X2 [Brassica 
rapa]
Length=529

 Score = 80.5 bits (197),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y +L E + + +I  G + P +   L+++ K +  DAKTF+  L+AMI   E+  R +K
Sbjct  92    FYKILNEVSTQ-DIPDGLKLPASFRQLVSDMKNNHYDAKTFSLVLRAMIEKFERDIRESK  150

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++SIPK +HCLSL L +E++SNA+AR Q
Sbjct  151   FAELMNKHFAASSIPKGIHCLSLRLTDEYTSNAHARRQ  188


 Score = 35.8 bits (81),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL ISPS+R +T+       + +K ++  R +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLQISPSMRSITI---SSSNDLMKIKVAPRHISYRTLFHTILILAFLLPFVFIVTALVT  57

Query  810  IDGESKCSGIGCFGRKIRPSIFRK  881
            ++G +KCS I C GR++ P    +
Sbjct  58   LEGVNKCSSIDCLGRRLGPRFLSR  81



>ref|XP_006603900.1| PREDICTED: probable galacturonosyltransferase 13-like isoform 
X2 [Glycine max]
Length=540

 Score = 80.9 bits (198),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
              Y++L E     EI    E P + + L+++ K ++ DAKTFA  L+ M+   E+  R +K
Sbjct  102   FYNILNE-VKTREIPSALELPDSFDQLVSDMKSNQYDAKTFAFMLRGMMQKFEREIRESK  160

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
               E + +H A++S+PK +HCLSL L +E+SSNA+AR Q
Sbjct  161   FSELMNKHFAASSVPKGIHCLSLRLTDEYSSNAHARKQ  198


 Score = 35.4 bits (80),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQLH SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TA+ T
Sbjct  1    MQLHFSPSMRSITISSKNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTALVT  60

Query  810  IDGESKCSGIG------CFGRKIRPSI  872
            ++G +KCS         C GR++ P +
Sbjct  61   LEGVNKCSSFAELLWSDCLGRRLGPKL  87



>ref|XP_004985228.1| PREDICTED: probable galacturonosyltransferase 14-like [Setaria 
italica]
Length=562

 Score = 86.3 bits (212),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ   +  L + +Y + ++  NE E     + P++  D + E K +  DA+TFA +L
Sbjct  105   FLGRQGGDSTRLVQDLYRIFDQVNNE-EFPSNEKLPESFRDFLLEMKDNHYDARTFAVRL  163

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  + +++ E LY+H A+ +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  164   KATMESMDKEVKRSRLAEQLYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQ  216


 Score = 29.3 bits (64),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +3

Query  816  GESKCSGIGCFGRKIRPSIF  875
            G SKCS I C GR+I PS  
Sbjct  87   GGSKCSSIDCLGRRIGPSFL  106



>ref|XP_003531845.1| PREDICTED: probable galacturonosyltransferase 14-like [Glycine 
max]
 gb|KHM98796.1| Putative galacturonosyltransferase 14 [Glycine soja]
Length=538

 Score = 80.5 bits (197),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E     EI    + P + + L+++ K ++ DAKTFA  L+ 
Sbjct  87    LGRVDDSGRLVRDFYKILNE-VKAGEIPPDLKLPDSFDQLVSDMKNNQYDAKTFAFMLRG  145

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+  LE+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  146   MMEKLEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  196


 Score = 34.7 bits (78),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 55/87 (63%), Gaps = 5/87 (6%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK-----GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflf  794
            MQLH SPS+R +T+         G  + +K ++ +R +S+R +F+++L+  FLL FVF+ 
Sbjct  1    MQLHFSPSMRSITISSNSNNNNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFIL  60

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIF  875
            TA+ T++G + CS   C GR++ P + 
Sbjct  61   TALVTLEGVNNCSSFDCLGRRLGPRLL  87



>ref|XP_010670179.1| PREDICTED: probable galacturonosyltransferase 14 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score = 82.4 bits (202),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 1/110 (1%)
 Frame = +1

Query  874   LGRQLESTLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAM  1053
             LGR     L    Y +L +  N  E+  G + P +   L+ + K ++ DAKTF   L+  
Sbjct  86    LGRDDSGRLVRDFYKILNQ-VNSEELPSGLKLPDSYNQLVTDMKNNQYDAKTFGFILRGT  144

Query  1054  INFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             +  LE+  R AK  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  145   MEKLEREIREAKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  194


 Score = 32.3 bits (72),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 58/86 (67%), Gaps = 4/86 (5%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK----GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfT  797
            MQLH+SPS+R +T+  +     G  + +K ++ +R +S+R +F+++L+  FLL FVF+ T
Sbjct  1    MQLHLSPSMRSITISSSSISNGGFVDLMKIKVAARHISYRTLFHTILILAFLLPFVFILT  60

Query  798  AVDTIDGESKCSGIGCFGRKIRPSIF  875
            A+ T++G +KCS + C GR+  P + 
Sbjct  61   ALVTLEGVNKCSSLDCLGRRFGPRLL  86



>ref|XP_004232177.1| PREDICTED: probable galacturonosyltransferase 14 [Solanum lycopersicum]
Length=534

 Score = 72.0 bits (175),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = +1

Query  934   ANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRH  1113
              N  E+  G + P++   L+AE K ++  AK FA  LK M+   E+  R +K  E   +H
Sbjct  104   VNTEEVPDGLKLPESFSQLVAEMKNNKYSAKEFALVLKGMMEKSEREIRESKFAELTNKH  163

Query  1114  VASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
              A+++IPK +HCLSL L +E+S+NA+AR QLPS
Sbjct  164   FAASAIPKGIHCLSLRLTDEYSTNAHARRQLPS  196


 Score = 42.7 bits (99),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK--GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAV  803
            MQLH SPS+R VT+  +   G  + +K ++ +R  S+R VF+++L+  F L FVF+ TAV
Sbjct  1    MQLHFSPSMRSVTISSSSNGGYGDLMKIKVAARHFSYRNVFHTILILAFFLPFVFILTAV  60

Query  804  DTIDGESKCSGIGCFGRKIRPSIF  875
             T++G +KCS I C GR++ PS+ 
Sbjct  61   VTLEGVNKCSSIDCLGRRLGPSLL  84



>gb|KHN13575.1| Putative galacturonosyltransferase 14 [Glycine soja]
Length=538

 Score = 78.6 bits (192),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E     EI    + P + + L+++ K ++ DAKTFA  L+ 
Sbjct  87    LGRADDSGRLVRDFYKILNE-VKAGEIPPDLQLPDSFDQLVSDMKNNQYDAKTFAFMLRG  145

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  146   MMEKHEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  196


 Score = 35.8 bits (81),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK-----GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflf  794
            MQLH SPS+R +T+         G  + +K ++ +R +S+R +F+++L+  FLL FVF+ 
Sbjct  1    MQLHFSPSMRSITISSNSNNNNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFIL  60

Query  795  TAVDTIDGESKCSGIGCFGRKIRPSIFRKA  884
            TA+ T++G + CS   C GR++ P +  +A
Sbjct  61   TALVTLEGVNNCSSFDCLGRRLGPRLLGRA  90



>gb|EAY83641.1| hypothetical protein OsI_38869 [Oryza sativa Indica Group]
Length=446

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = +1

Query  910   IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAK  1089
             +Y +L+E  N  E+ V  + P + ++ I + K +  D ++FA +LKA +  +++  RT++
Sbjct  7     LYRMLDE-INSEEVPVDLKVPDSFDEFIWDMKNNDYDLRSFAFRLKATMESMDRELRTSR  65

Query  1090  IQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             + E L +H A+ +IPK LHCLSL L +E+SSNA AR QLP PEL+P
Sbjct  66    LSEQLNKHYAAIAIPKGLHCLSLRLTDEYSSNALARKQLPPPELIP  111



>ref|XP_003552555.1| PREDICTED: probable galacturonosyltransferase 14-like [Glycine 
max]
Length=539

 Score = 78.6 bits (192),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    Y +L E     EI    + P + + L+++ K ++ DAKTFA  L+ 
Sbjct  88    LGRADDSGRLVRDFYKILNE-VKAGEIPPDLKLPDSFDQLVSDMKNNQYDAKTFAFMLRG  146

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             M+   E+  R +K  E + +H A++SIPK +HCLSL L +E+SSNA+AR Q
Sbjct  147   MMEKHEREIRESKFAELMNKHFAASSIPKGIHCLSLRLTDEYSSNAHARKQ  197


 Score = 35.4 bits (80),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK------GVKEFIKfrivsrrvsfrvvfyslllftfllrfvfl  791
            MQLH SPS+R +T+  +       G  + +K ++ +R +S+R +F+++L+  FLL FVF+
Sbjct  1    MQLHFSPSMRSITISSSSNSNNNNGFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFI  60

Query  792  fTAVDTIDGESKCSGIGCFGRKIRPSIFRKA  884
             TA+ T++G + CS   C GR++ P +  +A
Sbjct  61   LTALVTLEGVNNCSSFDCLGRRLGPRLLGRA  91



>ref|XP_009121572.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Brassica 
rapa]
Length=516

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = +1

Query  874   LGRQLES-TLPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L    + +L E A+  +I  G + P +   L+++ K +  D KTFA  L+A
Sbjct  66    LGRVDDSERLARDFFKILNE-ASTQDIPDGLKLPDSFNHLVSDTKNNHYDPKTFALVLRA  124

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPSPELVP  1227
             M+   E+  R  K  E   +H A++SIPK +HCLSL L +E+SSNA+AR QLPSPE +P
Sbjct  125   MMEKFERDIRQTKFAELTNKHFAASSIPKGIHCLSLRLTDEYSSNAHARRQLPSPERLP  183



>gb|AFW89248.1| hypothetical protein ZEAMMB73_107521 [Zea mays]
Length=471

 Score = 84.3 bits (207),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQL-EST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ  +ST L + +Y   ++  N+ E     + P++  D + E K +  DA+TFA +L
Sbjct  103   FLGRQGGDSTRLVQDLYRFFDQ-VNKEEFPSDEKLPESFRDFLLEMKDNHYDARTFAVRL  161

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  + +++ E LY+H A+ +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  162   KATMETMDKEVKRSRLAEQLYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQ  214


 Score = 28.9 bits (63),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +3

Query  816  GESKCSGIGCFGRKIRPSIF  875
            G SKCS + C GR+I PS  
Sbjct  85   GGSKCSSVDCLGRRIGPSFL  104



>ref|XP_008658925.1| PREDICTED: uncharacterized protein LOC100384251 isoform X1 [Zea 
mays]
 gb|AFW89249.1| hypothetical protein ZEAMMB73_107521 [Zea mays]
Length=560

 Score = 84.3 bits (207),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ   +  L + +Y   ++  N+ E     + P++  D + E K +  DA+TFA +L
Sbjct  103   FLGRQGGDSTRLVQDLYRFFDQ-VNKEEFPSDEKLPESFRDFLLEMKDNHYDARTFAVRL  161

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  + +++ E LY+H A+ +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  162   KATMETMDKEVKRSRLAEQLYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQ  214


 Score = 28.9 bits (63),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +3

Query  816  GESKCSGIGCFGRKIRPSIF  875
            G SKCS + C GR+I PS  
Sbjct  85   GGSKCSSVDCLGRRIGPSFL  104



>ref|XP_003558510.1| PREDICTED: probable galacturonosyltransferase 14 [Brachypodium 
distachyon]
Length=563

 Score = 83.2 bits (204),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = +1

Query  874   LGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             LGR    +  L + +Y + ++  NE E     + P++  + + E K +  DA+TFA +LK
Sbjct  108   LGRHGGDSTRLVQDLYRIFDQVNNE-EPTSDKKLPESFREFLLEMKDNHYDARTFAVRLK  166

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             AM+  + +  + +++ E LY+H AS +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  167   AMMKSMNKEIKRSRLAEQLYKHYASTAIPKGIHCLSLRLTDEYSSNAHARKQ  218


 Score = 30.0 bits (66),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +3

Query  816  GESKCSGIGCFGRKIRPSIF  875
            G SKCS I C GR+I PS+ 
Sbjct  89   GGSKCSSIDCLGRRIGPSLL  108



>dbj|BAJ86151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score = 84.7 bits (208),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ   +  L + +Y + ++  NE E     + P++  + ++E K +  D +TFA +L
Sbjct  112   FLGRQGGDSTRLVQDLYRIFDQVNNE-ESTSDKKLPESFREFLSEMKDNHYDGRTFAVRL  170

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  + +++ E LY+H AS +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  171   KATMKNMDKEVKRSRLAEQLYKHYASTAIPKGIHCLSLRLTDEYSSNAHARKQ  223


 Score = 28.1 bits (61),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +3

Query  816  GESKCSGIGCFGRKIRPSIF  875
            G +KCS I C GR+I PS  
Sbjct  94   GGTKCSSIDCLGRRIGPSFL  113



>ref|XP_002465655.1| hypothetical protein SORBIDRAFT_01g043170 [Sorghum bicolor]
 gb|EER92653.1| hypothetical protein SORBIDRAFT_01g043170 [Sorghum bicolor]
Length=297

 Score = 83.6 bits (205),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ   +  L + +Y + ++  NE E     + P++  D + E K +  DA+ FA +L
Sbjct  103   FLGRQGGDSTRLVQDLYRIFDQVNNE-EYPSDEKLPESFRDFLLEMKDNHYDARAFAVRL  161

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  + +++ E LY+H A+ +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  162   KATMESMDKEVKRSRLAEQLYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQ  214


 Score = 28.9 bits (63),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +3

Query  816  GESKCSGIGCFGRKIRPSIF  875
            G SKCS + C GR+I PS  
Sbjct  85   GGSKCSSVDCLGRRIGPSFL  104



>ref|XP_008646847.1| PREDICTED: uncharacterized protein LOC100501135 isoform X1 [Zea 
mays]
 tpg|DAA44039.1| TPA: hypothetical protein ZEAMMB73_034434 [Zea mays]
Length=560

 Score = 83.2 bits (204),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ   +  L + +Y   ++  NE E     + P++  D + E K +  DA+TFA +L
Sbjct  103   FLGRQGGDSTRLVQDLYRTFDQVNNE-ESPSDEKLPESFRDFLLEMKDNHYDARTFAVRL  161

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  + +++ E LY+H A+ +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  162   KATMENMDKEVKRSRLAEQLYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQ  214


 Score = 28.9 bits (63),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 0/20 (0%)
 Frame = +3

Query  816  GESKCSGIGCFGRKIRPSIF  875
            G SKCS + C GR+I PS  
Sbjct  85   GGSKCSSVDCLGRRIGPSFL  104



>gb|ABF94604.1| Glycosyl transferase family 8 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01509.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58569.1| hypothetical protein OsJ_09887 [Oryza sativa Japonica Group]
Length=577

 Score = 83.2 bits (204),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLESTLPEV--IYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ   ++  V  +Y + ++  NE E       P++  D + E K    DA+TFA +L
Sbjct  120   FLGRQGGDSMRLVQDLYRIFDQVNNE-ESPDDKRIPESFRDFLLEMKDSHYDARTFAVRL  178

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  +  ++ E LY+H A+ +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  179   KATMENMDKEVKKLRLAEQLYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQ  231


 Score = 28.5 bits (62),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (61%), Gaps = 1/28 (4%)
 Frame = +3

Query  795  TAVDTIDGE-SKCSGIGCFGRKIRPSIF  875
             AV  ++ + SKCS I C GR+I PS  
Sbjct  94   AAVPALEADGSKCSSIDCLGRRIGPSFL  121



>ref|XP_009629908.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Nicotiana 
tomentosiformis]
Length=535

 Score = 75.9 bits (185),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +    +L +  N  E+  G + P++   L++E K ++ +AK FA  LK 
Sbjct  85    LGRTDDSKRLVKDFVKILNQ-VNSEEVPAGLKLPESYSQLVSEMKNNKYNAKEFALMLKG  143

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
             M++  E+  R +K  E + +H A++++PK +HCLSL L +E+SSNA+AR QLPS
Sbjct  144   MMDRSEREIRESKFAELMNKHFAASAVPKGIHCLSLRLTDEYSSNAHARRQLPS  197


 Score = 35.0 bits (79),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK---GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            MQLH SPS+R +T+  +    G  E +K ++ +R  S+R +F+++L+  FLL FVF+ TA
Sbjct  1    MQLHFSPSMRSITISSSNSNGGFGELMKIKVAARHFSYRTLFHTILILAFLLPFVFILTA  60

Query  801  VDTIDGESKCSGIGCFGRKIRPSIF  875
            V T++G +KCS   C GR++ P + 
Sbjct  61   VVTLEGVNKCSSFDCLGRRLGPKLL  85



>ref|XP_009629907.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=536

 Score = 75.9 bits (185),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +1

Query  934   ANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRH  1113
              N  E+  G + P++   L++E K ++ +AK FA  LK M++  E+  R +K  E + +H
Sbjct  106   VNSEEVPAGLKLPESYSQLVSEMKNNKYNAKEFALMLKGMMDRSEREIRESKFAELMNKH  165

Query  1114  VASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
              A++++PK +HCLSL L +E+SSNA+AR QLPS
Sbjct  166   FAASAVPKGIHCLSLRLTDEYSSNAHARRQLPS  198


 Score = 35.0 bits (79),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK---GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            MQLH SPS+R +T+  +    G  E +K ++ +R  S+R +F+++L+  FLL FVF+ TA
Sbjct  1    MQLHFSPSMRSITISSSNSNGGFGELMKIKVAARHFSYRTLFHTILILAFLLPFVFILTA  60

Query  801  VDTIDGESKCSGIGCFGRKIRPSIF  875
            V T++G +KCS   C GR++ P + 
Sbjct  61   VVTLEGVNKCSSFDCLGRRLGPKLL  85



>ref|XP_011098715.1| PREDICTED: probable galacturonosyltransferase 14 [Sesamum indicum]
Length=537

 Score = 75.5 bits (184),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L + +  +L +  N  ++Q G + P +   L++E K ++  +K FA  LK 
Sbjct  88    LGRTDDSGRLVKDLVKILNQ-VNSEKVQAGLKLPDSFSQLVSEMKNNKFSSKEFALILKG  146

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
             M+   E+  R +K  E + +H A+++IPK +HCLSL L +E+SSNA+AR QLPS
Sbjct  147   MMEKYEREIRESKFAELMNKHFAASAIPKGIHCLSLRLTDEYSSNAHARKQLPS  200


 Score = 35.4 bits (80),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 57/88 (65%), Gaps = 6/88 (7%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVK------EFIKfrivsrrvsfrvvfyslllftfllrfvfl  791
            MQLH SPS+R +T+  +          + +K ++ +R +S+R +F+++L+  FLL FVF+
Sbjct  1    MQLHFSPSMRSITISSSSSGGNGNGSGDLMKIKLAARHISYRTLFHTILILAFLLPFVFI  60

Query  792  fTAVDTIDGESKCSGIGCFGRKIRPSIF  875
             TA+ T++G +KCS I C GR++ P + 
Sbjct  61   LTALVTLEGVNKCSSIDCLGRRLGPKLL  88



>ref|XP_006651162.1| PREDICTED: probable galacturonosyltransferase 14-like [Oryza 
brachyantha]
Length=519

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = +1

Query  871   YLGRQLEST--LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKL  1044
             +LGRQ   +  L + +Y + ++  NE E       P++  D + E K +R DA+TFA +L
Sbjct  62    FLGRQGGDSTRLVQDLYRIFDQVNNE-ESPSDKRIPESFRDFLLEMKDNRYDARTFAVRL  120

Query  1045  KAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
             KA +  +++  + +++ E LY+H A+ +IPK +HCLSL L +E+SSNA+AR Q
Sbjct  121   KATMENMDKEVKKSRLAEQLYKHFAATAIPKGIHCLSLRLTDEYSSNAHARKQ  173



>ref|XP_009587642.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Nicotiana 
tomentosiformis]
Length=536

 Score = 72.8 bits (177),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  934   ANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRH  1113
              N  E+  G + P++   L++E K ++  AK FA  LK M+   E+  R +K  E + +H
Sbjct  106   VNSEEVPAGLKLPESYSQLVSEIKNNKYSAKEFALMLKGMMERSEREIRESKFAELMNKH  165

Query  1114  VASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
              A++++PK +HCLSL L +E+S+NA+AR QLPS
Sbjct  166   FAASAVPKGIHCLSLRLTDEYSTNAHARKQLPS  198


 Score = 38.1 bits (87),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGV----KEFIKfrivsrrvsfrvvfyslllftfllrfvflfT  797
            MQLH SPS+R +T+  + G      + +K ++ +R+ S+R +F ++L+  FLL FVF+ T
Sbjct  1    MQLHFSPSMRSITISNSNGGCVGGGDLMKIKLAARQFSYRTLFRTILILAFLLPFVFILT  60

Query  798  AVDTIDGESKCSGIGCFGRKIRPSIFRKA  884
            A+ T++G +KCS I C GR++ P +  ++
Sbjct  61   ALVTLEGVNKCSSIDCLGRRLGPKLLGRS  89



>ref|XP_009587641.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=537

 Score = 72.8 bits (177),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +1

Query  934   ANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRH  1113
              N  E+  G + P++   L++E K ++  AK FA  LK M+   E+  R +K  E + +H
Sbjct  107   VNSEEVPAGLKLPESYSQLVSEIKNNKYSAKEFALMLKGMMERSEREIRESKFAELMNKH  166

Query  1114  VASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
              A++++PK +HCLSL L +E+S+NA+AR QLPS
Sbjct  167   FAASAVPKGIHCLSLRLTDEYSTNAHARKQLPS  199


 Score = 38.1 bits (87),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGV----KEFIKfrivsrrvsfrvvfyslllftfllrfvflfT  797
            MQLH SPS+R +T+  + G      + +K ++ +R+ S+R +F ++L+  FLL FVF+ T
Sbjct  1    MQLHFSPSMRSITISNSNGGCVGGGDLMKIKLAARQFSYRTLFRTILILAFLLPFVFILT  60

Query  798  AVDTIDGESKCSGIGCFGRKIRPSIFRKA  884
            A+ T++G +KCS I C GR++ P +  ++
Sbjct  61   ALVTLEGVNKCSSIDCLGRRLGPKLLGRS  89



>ref|XP_009789619.1| PREDICTED: probable galacturonosyltransferase 14 isoform X2 [Nicotiana 
sylvestris]
Length=535

 Score = 75.5 bits (184),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +1

Query  874   LGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKA  1050
             LGR  +S  L +    +L +  N  E+  G + P++   L++E K ++  AK FA  LK 
Sbjct  85    LGRTDDSKRLVKDFVKILNQ-VNSEEVPAGLKLPESYSQLVSEMKNNKYSAKEFALMLKG  143

Query  1051  MINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
             M++  E+  R +K  E + +H A++++PK +HCLSL L +E+SSNA+AR QLPS
Sbjct  144   MMDRSEREIRESKFAELMNKHFAASAVPKGIHCLSLRLTDEYSSNAHARRQLPS  197


 Score = 35.0 bits (79),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK---GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            MQLH SPS+R +T+  +    G  E +K ++ +R  S+R +F+++L+  FLL FVF+ TA
Sbjct  1    MQLHFSPSMRSITISSSNSNGGFGELMKIKVAARHFSYRTLFHTILILAFLLPFVFILTA  60

Query  801  VDTIDGESKCSGIGCFGRKIRPSIF  875
            V T++G +KCS   C GR++ P + 
Sbjct  61   VVTLEGVNKCSSFDCLGRRLGPKLL  85



>ref|XP_009789618.1| PREDICTED: probable galacturonosyltransferase 13 isoform X1 [Nicotiana 
sylvestris]
Length=536

 Score = 75.1 bits (183),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  934   ANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRH  1113
              N  E+  G + P++   L++E K ++  AK FA  LK M++  E+  R +K  E + +H
Sbjct  106   VNSEEVPAGLKLPESYSQLVSEMKNNKYSAKEFALMLKGMMDRSEREIRESKFAELMNKH  165

Query  1114  VASNSIPKQLHCLSLMLANEHSSNANARLQLPS  1212
              A++++PK +HCLSL L +E+SSNA+AR QLPS
Sbjct  166   FAASAVPKGIHCLSLRLTDEYSSNAHARRQLPS  198


 Score = 35.0 bits (79),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTK---GVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTA  800
            MQLH SPS+R +T+  +    G  E +K ++ +R  S+R +F+++L+  FLL FVF+ TA
Sbjct  1    MQLHFSPSMRSITISSSNSNGGFGELMKIKVAARHFSYRTLFHTILILAFLLPFVFILTA  60

Query  801  VDTIDGESKCSGIGCFGRKIRPSIF  875
            V T++G +KCS   C GR++ P + 
Sbjct  61   VVTLEGVNKCSSFDCLGRRLGPKLL  85



>emb|CDP02301.1| unnamed protein product [Coffea canephora]
Length=543

 Score = 71.6 bits (174),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +1

Query  970   PQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHC  1149
             P +   L++E K ++  AK FA  LK M+  LE+  + AK  E   +H A++S+PK LHC
Sbjct  125   PDSFRQLVSETKNNKYTAKEFALILKGMMERLEREIKAAKFAELTNKHFAASSVPKGLHC  184

Query  1150  LSLMLANEHSSNANARLQ  1203
             LSL L +E+SSNA+AR Q
Sbjct  185   LSLRLTDEYSSNAHARKQ  202


 Score = 38.1 bits (87),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 60/95 (63%), Gaps = 10/95 (11%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKG----------VKEFIKfrivsrrvsfrvvfyslllftfllr  779
            MQLH SPS+R +T+  +              + +K ++ +R +S+R +F+++L+  FLL 
Sbjct  1    MQLHFSPSMRSITISSSSNGTANGGFGSGGGDLMKIKLAARHISYRTLFHTILILAFLLP  60

Query  780  fvflfTAVDTIDGESKCSGIGCFGRKIRPSIFRKA  884
            FVF+ TA+ T++G +KCS I C GR++ P +F +A
Sbjct  61   FVFILTALITLEGVNKCSTIDCLGRRLGPKVFGRA  95



>emb|CDP18723.1| unnamed protein product [Coffea canephora]
Length=546

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +1

Query  970   PQTLEDLIAEFKGDRPDAKTFAAKLKAMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHC  1149
             P + +DL+ +   ++ D KTFA K KAM+  +EQ  ++A+  EY+  H+AS+ IPK L C
Sbjct  130   PASFKDLVKDVTSNKQDIKTFAFKTKAMMAKMEQMVQSARRHEYINWHLASHGIPKSLQC  189

Query  1150  LSLMLANEHSSNANARLQLPSPELV  1224
             LSL+LA E++ NA AR +LPSPE V
Sbjct  190   LSLILAEEYAVNAMARSRLPSPEFV  214



>ref|XP_003618627.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
Length=561

 Score = 78.2 bits (191),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +1

Query  871   YLGRQLEST-LPEVIYSVLEEPANETEIQVGPETPQTLEDLIAEFKGDRPDAKTFAAKLK  1047
             +LGR  +S  L    Y++L E     E+    + P + + ++++ K ++ DAKTFA  LK
Sbjct  109   FLGRADDSARLVRDFYNILNE-VKTGEVPSSLKLPDSFDQMVSDMKNNQYDAKTFAFMLK  167

Query  1048  AMINFLEQTTRTAKIQEYLYRHVASNSIPKQLHCLSLMLANEHSSNANARLQ  1203
              M+   E   R +K  E + +H A++SIPK ++CLSL L +E+SSNA+AR Q
Sbjct  168   RMMEKFENEIRESKFAELMNKHFAASSIPKGINCLSLRLTDEYSSNAHARKQ  219


 Score = 31.2 bits (69),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  630  MQLHISPSLRHVTVLPTKGVKEFIKfrivsrrvsfrvvfyslllftfllrfvflfTAVDT  809
            MQL  SPS+R +T+    G  + +K ++ +  +S+R +F+++L+  FLL FVF+ TAV T
Sbjct  1    MQLQFSPSMRSITISSNNGFIDLMKIKVAACHISYRTLFHTILILAFLLPFVFILTAVVT  60

Query  810  IDGESKCSGIG  842
            ++G +KCS  G
Sbjct  61   LEGVNKCSSFG  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3475346881242