BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12630

Length=838
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007021082.1|  Autophagy 18 F isoform 4                           164   1e-42   
ref|XP_007021080.1|  Autophagy 18 F isoform 2                           165   2e-42   
ref|XP_007021079.1|  Autophagy 18 F isoform 1                           165   3e-42   
gb|KDO52932.1|  hypothetical protein CISIN_1g002446mg                   162   2e-41   Citrus sinensis [apfelsine]
gb|KDO52929.1|  hypothetical protein CISIN_1g002446mg                   162   2e-41   Citrus sinensis [apfelsine]
gb|KDO52927.1|  hypothetical protein CISIN_1g002446mg                   162   2e-41   Citrus sinensis [apfelsine]
ref|XP_006475220.1|  PREDICTED: autophagy-related protein 18f-lik...    162   3e-41   
ref|XP_006475222.1|  PREDICTED: autophagy-related protein 18f-lik...    162   3e-41   Citrus sinensis [apfelsine]
ref|XP_011030884.1|  PREDICTED: autophagy-related protein 18f-lik...    160   1e-40   Populus euphratica
ref|XP_002317566.2|  hypothetical protein POPTR_0011s13610g             160   2e-40   
ref|XP_011048286.1|  PREDICTED: autophagy-related protein 18f-like      159   3e-40   Populus euphratica
ref|XP_009794960.1|  PREDICTED: autophagy-related protein 18f-like      159   3e-40   Nicotiana sylvestris
ref|XP_006452163.1|  hypothetical protein CICLE_v10007389mg             158   4e-40   
ref|XP_006452161.1|  hypothetical protein CICLE_v10007389mg             159   6e-40   Citrus clementina [clementine]
ref|XP_006452162.1|  hypothetical protein CICLE_v10007389mg             158   6e-40   
ref|XP_008365705.1|  PREDICTED: autophagy-related protein 18f-lik...    158   1e-39   
ref|XP_008365693.1|  PREDICTED: autophagy-related protein 18f-lik...    158   1e-39   
ref|XP_009611125.1|  PREDICTED: autophagy-related protein 18f-lik...    157   2e-39   Nicotiana tomentosiformis
ref|XP_009358092.1|  PREDICTED: autophagy-related protein 18f-like      156   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_009611131.1|  PREDICTED: autophagy-related protein 18f-lik...    155   4e-39   Nicotiana tomentosiformis
ref|XP_009355581.1|  PREDICTED: autophagy-related protein 18f-like      154   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_007213662.1|  hypothetical protein PRUPE_ppa001097mg             154   3e-38   Prunus persica
ref|XP_008244343.1|  PREDICTED: autophagy-related protein 18f iso...    151   3e-37   Prunus mume [ume]
ref|XP_010240957.1|  PREDICTED: autophagy-related protein 18f-like      150   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010105588.1|  Breast carcinoma-amplified sequence 3              149   1e-36   Morus notabilis
ref|XP_009343079.1|  PREDICTED: autophagy-related protein 18f-like      149   1e-36   Pyrus x bretschneideri [bai li]
gb|KDO52928.1|  hypothetical protein CISIN_1g002446mg                   149   1e-36   Citrus sinensis [apfelsine]
ref|XP_008244346.1|  PREDICTED: autophagy-related protein 18f iso...    147   6e-36   Prunus mume [ume]
ref|XP_006360096.1|  PREDICTED: autophagy-related protein 18f-like      146   9e-36   Solanum tuberosum [potatoes]
gb|KHG11309.1|  Breast carcinoma-amplified sequence 3                   146   9e-36   Gossypium arboreum [tree cotton]
gb|KJB45593.1|  hypothetical protein B456_007G314600                    146   1e-35   Gossypium raimondii
ref|XP_008386020.1|  PREDICTED: autophagy-related protein 18f           146   2e-35   
ref|XP_004244157.1|  PREDICTED: autophagy-related protein 18f           145   3e-35   Solanum lycopersicum
gb|KJB45595.1|  hypothetical protein B456_007G314600                    144   8e-35   Gossypium raimondii
emb|CAN75263.1|  hypothetical protein VITISV_005771                     141   6e-34   Vitis vinifera
ref|XP_002279886.1|  PREDICTED: autophagy-related protein 18f iso...    141   7e-34   Vitis vinifera
ref|XP_011460985.1|  PREDICTED: autophagy-related protein 18f           140   1e-33   Fragaria vesca subsp. vesca
ref|XP_012070728.1|  PREDICTED: autophagy-related protein 18f           140   1e-33   Jatropha curcas
ref|XP_011097925.1|  PREDICTED: autophagy-related protein 18f           140   2e-33   Sesamum indicum [beniseed]
ref|XP_008244345.1|  PREDICTED: autophagy-related protein 18f iso...    136   3e-32   Prunus mume [ume]
gb|KHN47845.1|  Breast carcinoma-amplified sequence 3 like              136   3e-32   Glycine soja [wild soybean]
emb|CBI20508.3|  unnamed protein product                                128   3e-32   Vitis vinifera
ref|XP_010644334.1|  PREDICTED: autophagy-related protein 18f iso...    136   4e-32   Vitis vinifera
emb|CDP05803.1|  unnamed protein product                                136   4e-32   Coffea canephora [robusta coffee]
gb|KHN36731.1|  Breast carcinoma-amplified sequence 3 like              134   2e-31   Glycine soja [wild soybean]
ref|XP_006582241.1|  PREDICTED: autophagy-related protein 18f-like      133   4e-31   Glycine max [soybeans]
ref|XP_011095316.1|  PREDICTED: autophagy-related protein 18f-lik...    132   1e-30   
ref|XP_002522834.1|  breast carcinoma amplified sequence, putative      129   2e-29   
ref|XP_006370615.1|  hypothetical protein POPTR_0001s44270g             126   9e-29   
ref|XP_004151961.1|  PREDICTED: autophagy-related protein 18f           125   2e-28   Cucumis sativus [cucumbers]
ref|XP_010267792.1|  PREDICTED: autophagy-related protein 18f-like      125   3e-28   
ref|XP_009624718.1|  PREDICTED: autophagy-related protein 18f-like      124   6e-28   
ref|XP_008775921.1|  PREDICTED: autophagy-related protein 18f-like      123   1e-27   Phoenix dactylifera
ref|XP_003596621.1|  Autophagy-related protein                          120   1e-26   
ref|XP_003596622.1|  Autophagy-related protein                          119   3e-26   Medicago truncatula
ref|XP_004487612.1|  PREDICTED: autophagy-related protein 18f-lik...    118   5e-26   Cicer arietinum [garbanzo]
ref|XP_007021083.1|  Autophagy 18 F isoform 5                           116   2e-25   
ref|XP_007021081.1|  Autophagy 18 F isoform 3                           115   3e-25   
ref|XP_006592506.1|  PREDICTED: autophagy-related protein 18f-lik...    115   3e-25   Glycine max [soybeans]
ref|XP_008454562.1|  PREDICTED: LOW QUALITY PROTEIN: autophagy-re...    115   4e-25   Cucumis melo [Oriental melon]
ref|XP_003541014.1|  PREDICTED: autophagy-related protein 18f-lik...    115   4e-25   Glycine max [soybeans]
gb|KHN36337.1|  Breast carcinoma-amplified sequence 3 like              115   4e-25   Glycine soja [wild soybean]
ref|XP_009794099.1|  PREDICTED: autophagy-related protein 18f-like      115   5e-25   Nicotiana sylvestris
ref|XP_011030885.1|  PREDICTED: autophagy-related protein 18f-lik...    114   9e-25   Populus euphratica
ref|XP_007132977.1|  hypothetical protein PHAVU_011G140900g             114   1e-24   Phaseolus vulgaris [French bean]
gb|KJB13576.1|  hypothetical protein B456_002G082200                    113   2e-24   Gossypium raimondii
gb|KJB13574.1|  hypothetical protein B456_002G082200                    113   2e-24   Gossypium raimondii
ref|XP_011095317.1|  PREDICTED: autophagy-related protein 18f-lik...    112   4e-24   Sesamum indicum [beniseed]
ref|XP_010931238.1|  PREDICTED: autophagy-related protein 18f-like      111   1e-23   Elaeis guineensis
ref|XP_008800488.1|  PREDICTED: autophagy-related protein 18h-lik...    110   2e-23   Phoenix dactylifera
ref|XP_008800486.1|  PREDICTED: autophagy-related protein 18f-lik...    110   3e-23   Phoenix dactylifera
ref|XP_010062964.1|  PREDICTED: autophagy-related protein 18f           108   9e-23   Eucalyptus grandis [rose gum]
gb|KHN27976.1|  Breast carcinoma-amplified sequence 3 like              107   3e-22   Glycine soja [wild soybean]
gb|KHG21819.1|  Breast carcinoma-amplified sequence 3                   105   8e-22   Gossypium arboreum [tree cotton]
gb|KJB13575.1|  hypothetical protein B456_002G082200                    103   5e-21   Gossypium raimondii
ref|XP_010908141.1|  PREDICTED: autophagy-related protein 18f-lik...    102   1e-20   Elaeis guineensis
ref|XP_010908142.1|  PREDICTED: autophagy-related protein 18f-lik...    102   1e-20   Elaeis guineensis
gb|KJB45596.1|  hypothetical protein B456_007G314600                    101   2e-20   Gossypium raimondii
ref|XP_004487613.1|  PREDICTED: autophagy-related protein 18f-lik...  99.8    8e-20   Cicer arietinum [garbanzo]
ref|XP_007149695.1|  hypothetical protein PHAVU_005G091300g           99.4    2e-19   Phaseolus vulgaris [French bean]
ref|XP_010694257.1|  PREDICTED: autophagy-related protein 18f iso...  98.2    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694259.1|  PREDICTED: autophagy-related protein 18f iso...  97.8    4e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010908143.1|  PREDICTED: autophagy-related protein 18f-lik...  94.7    4e-18   Elaeis guineensis
gb|EPS70907.1|  hypothetical protein M569_03850                       94.4    4e-18   Genlisea aurea
ref|XP_008800489.1|  PREDICTED: autophagy-related protein 18f-lik...  94.4    5e-18   Phoenix dactylifera
gb|EYU33601.1|  hypothetical protein MIMGU_mgv1a003709mg              93.6    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_006592885.1|  PREDICTED: autophagy-related protein 18f-like    92.4    2e-17   Glycine max [soybeans]
gb|ERN10464.1|  hypothetical protein AMTR_s01464p00006980             90.9    5e-17   Amborella trichopoda
ref|XP_011625098.1|  PREDICTED: LOW QUALITY PROTEIN: autophagy-re...  90.9    6e-17   
ref|XP_011621063.1|  PREDICTED: autophagy-related protein 18f         90.5    1e-16   
gb|ERM99845.1|  hypothetical protein AMTR_s00098p00100110             90.1    1e-16   Amborella trichopoda
ref|XP_009402870.1|  PREDICTED: autophagy-related protein 18f-like    90.1    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006475223.1|  PREDICTED: autophagy-related protein 18f-lik...  87.4    8e-16   
ref|XP_006363524.1|  PREDICTED: autophagy-related protein 18f-lik...  87.4    9e-16   Solanum tuberosum [potatoes]
ref|XP_006363523.1|  PREDICTED: autophagy-related protein 18f-lik...  87.0    1e-15   Solanum tuberosum [potatoes]
gb|KDO52934.1|  hypothetical protein CISIN_1g002446mg                 87.0    1e-15   Citrus sinensis [apfelsine]
ref|XP_010539276.1|  PREDICTED: autophagy-related protein 18f iso...  85.9    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_006644820.1|  PREDICTED: autophagy-related protein 18g-lik...  83.2    2e-14   
ref|XP_006644819.1|  PREDICTED: autophagy-related protein 18g-lik...  82.8    3e-14   
ref|XP_010694260.1|  PREDICTED: autophagy-related protein 18f iso...  82.8    3e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694258.1|  PREDICTED: autophagy-related protein 18f iso...  82.0    5e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010539275.1|  PREDICTED: autophagy-related protein 18f iso...  81.6    6e-14   Tarenaya hassleriana [spider flower]
ref|XP_010539277.1|  PREDICTED: autophagy-related protein 18f iso...  81.6    7e-14   Tarenaya hassleriana [spider flower]
ref|XP_010539278.1|  PREDICTED: autophagy-related protein 18f iso...  81.6    7e-14   Tarenaya hassleriana [spider flower]
emb|CDY47444.1|  BnaC09g31130D                                        80.1    2e-13   Brassica napus [oilseed rape]
ref|NP_001044475.2|  Os01g0786900                                     79.7    3e-13   
gb|EAY76096.1|  hypothetical protein OsI_04020                        79.7    3e-13   Oryza sativa Indica Group [Indian rice]
dbj|BAD53258.1|  breast carcinoma amplified sequence 3-like protein   79.7    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674950.1|  PREDICTED: autophagy-related protein 18f         75.5    6e-12   Zea mays [maize]
ref|XP_004970215.1|  PREDICTED: autophagy-related protein 18g-like    75.5    7e-12   Setaria italica
ref|XP_004251478.2|  PREDICTED: autophagy-related protein 18f-lik...  75.5    7e-12   
ref|XP_010313652.1|  PREDICTED: autophagy-related protein 18f-lik...  75.1    8e-12   Solanum lycopersicum
ref|XP_010232446.1|  PREDICTED: autophagy-related protein 18f         74.7    1e-11   Brachypodium distachyon [annual false brome]
ref|NP_200284.1|  autophagy 18F-like protein                          73.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401541.1|  hypothetical protein EUTSA_v10012811mg           72.0    7e-11   
emb|CDM84501.1|  unnamed protein product                              69.3    8e-10   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ88459.1|  predicted protein                                    67.8    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89507.1|  predicted protein                                    68.2    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS62994.1|  Breast carcinoma-amplified sequence 3-like protein    67.8    2e-09   Triticum urartu
ref|XP_010443049.1|  PREDICTED: autophagy-related protein 18f-like    66.6    5e-09   Camelina sativa [gold-of-pleasure]
gb|EMT21334.1|  hypothetical protein F775_31166                       66.6    5e-09   
dbj|BAJ99624.1|  predicted protein                                    66.6    5e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010475693.1|  PREDICTED: autophagy-related protein 18f-like    65.9    1e-08   
ref|XP_010482879.1|  PREDICTED: autophagy-related protein 18f-like    65.1    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009120004.1|  PREDICTED: autophagy-related protein 18f-like    64.3    3e-08   Brassica rapa
gb|EYU33600.1|  hypothetical protein MIMGU_mgv1a003709mg              63.9    4e-08   Erythranthe guttata [common monkey flower]
emb|CDY52567.1|  BnaC03g71750D                                        60.1    8e-08   Brassica napus [oilseed rape]
ref|XP_006280045.1|  hypothetical protein CARUB_v10025923mg           63.2    8e-08   Capsella rubella
emb|CDY43025.1|  BnaA03g11720D                                        63.2    9e-08   Brassica napus [oilseed rape]
ref|XP_009132428.1|  PREDICTED: autophagy-related protein 18f-like    62.4    1e-07   Brassica rapa
ref|XP_001753206.1|  predicted protein                                62.4    2e-07   
emb|CDY42477.1|  BnaA10g08530D                                        62.0    2e-07   Brassica napus [oilseed rape]
ref|XP_001780210.1|  predicted protein                                60.5    6e-07   
gb|ERN07493.1|  hypothetical protein AMTR_s00019p00257260             59.7    1e-06   Amborella trichopoda
ref|XP_001784306.1|  predicted protein                                59.7    1e-06   
ref|XP_006845818.2|  PREDICTED: autophagy-related protein 18h         59.7    1e-06   
emb|CDY52569.1|  BnaC03g71770D                                        59.3    1e-06   Brassica napus [oilseed rape]
gb|KDP23568.1|  hypothetical protein JCGZ_23401                       58.9    2e-06   Jatropha curcas
ref|XP_012089136.1|  PREDICTED: autophagy-related protein 18h         58.9    2e-06   
ref|XP_001753777.1|  predicted protein                                58.5    3e-06   
ref|XP_006382658.1|  hypothetical protein POPTR_0005s04210g           57.8    6e-06   
ref|XP_002866056.1|  hypothetical protein ARALYDRAFT_495551           57.4    7e-06   
ref|XP_010522678.1|  PREDICTED: autophagy-related protein 18g iso...  57.0    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_009629586.1|  PREDICTED: autophagy-related protein 18h-lik...  57.0    1e-05   Nicotiana tomentosiformis
ref|XP_010522679.1|  PREDICTED: autophagy-related protein 18g iso...  57.0    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_006433227.1|  hypothetical protein CICLE_v10000138mg           56.6    1e-05   Citrus clementina [clementine]
ref|XP_008246534.1|  PREDICTED: autophagy-related protein 18h iso...  56.2    2e-05   Prunus mume [ume]
ref|XP_004230156.1|  PREDICTED: autophagy-related protein 18h-like    56.2    2e-05   Solanum lycopersicum
ref|XP_007030763.1|  Autophagy 18 H                                   55.8    2e-05   
emb|CDP17988.1|  unnamed protein product                              55.8    2e-05   Coffea canephora [robusta coffee]
ref|XP_010660037.1|  PREDICTED: autophagy-related protein 18h         55.8    3e-05   Vitis vinifera
emb|CBI34324.3|  unnamed protein product                              55.5    3e-05   Vitis vinifera
emb|CAN80611.1|  hypothetical protein VITISV_035392                   55.5    3e-05   Vitis vinifera
ref|XP_010242571.1|  PREDICTED: autophagy-related protein 18h-like    55.5    3e-05   
ref|XP_006361891.1|  PREDICTED: autophagy-related protein 18h-like    55.1    4e-05   Solanum tuberosum [potatoes]
ref|XP_009629585.1|  PREDICTED: autophagy-related protein 18h-lik...  55.1    4e-05   Nicotiana tomentosiformis
gb|KHG13083.1|  Breast carcinoma-amplified sequence 3                 55.1    4e-05   Gossypium arboreum [tree cotton]
ref|XP_002512315.1|  breast carcinoma amplified sequence, putative    54.7    5e-05   
gb|KJB82598.1|  hypothetical protein B456_013G203700                  54.7    5e-05   Gossypium raimondii
ref|XP_010111879.1|  Breast carcinoma-amplified sequence 3            54.7    5e-05   
ref|XP_009113417.1|  PREDICTED: autophagy-related protein 18h-lik...  54.7    6e-05   Brassica rapa
ref|XP_009113416.1|  PREDICTED: autophagy-related protein 18h-lik...  54.7    6e-05   Brassica rapa
ref|XP_002973317.1|  hypothetical protein SELMODRAFT_442028           54.3    7e-05   
ref|XP_006847948.1|  PREDICTED: autophagy-related protein 18f         53.9    8e-05   
ref|XP_002976587.1|  hypothetical protein SELMODRAFT_443277           53.9    8e-05   
ref|XP_004302468.2|  PREDICTED: autophagy-related protein 18h-like    53.9    9e-05   Fragaria vesca subsp. vesca
ref|XP_009373952.1|  PREDICTED: autophagy-related protein 18h-like    53.9    1e-04   
ref|XP_011023512.1|  PREDICTED: autophagy-related protein 18h-like    53.9    1e-04   Populus euphratica
ref|XP_011013518.1|  PREDICTED: autophagy-related protein 18h-like    53.9    1e-04   Populus euphratica
ref|XP_007208399.1|  hypothetical protein PRUPE_ppa000848mg           53.5    1e-04   
ref|XP_010043141.1|  PREDICTED: autophagy-related protein 18h         53.5    1e-04   Eucalyptus grandis [rose gum]
ref|XP_002319034.2|  hypothetical protein POPTR_0013s02940g           53.5    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009403826.1|  PREDICTED: autophagy-related protein 18g-like    53.1    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010070318.1|  PREDICTED: autophagy-related protein 18g         53.1    2e-04   Eucalyptus grandis [rose gum]
ref|XP_008451647.1|  PREDICTED: autophagy-related protein 18g         52.8    2e-04   Cucumis melo [Oriental melon]
ref|XP_008388609.1|  PREDICTED: autophagy-related protein 18h-like    52.8    2e-04   
ref|XP_004148874.1|  PREDICTED: autophagy-related protein 18g iso...  52.4    3e-04   Cucumis sativus [cucumbers]
ref|XP_011659321.1|  PREDICTED: autophagy-related protein 18g iso...  52.4    3e-04   Cucumis sativus [cucumbers]
gb|KGN44850.1|  hypothetical protein Csa_7G391270                     52.4    3e-04   Cucumis sativus [cucumbers]
gb|KDO87469.1|  hypothetical protein CISIN_1g001814mg                 52.4    3e-04   Citrus sinensis [apfelsine]
ref|XP_006444176.1|  hypothetical protein CICLE_v10018690mg           52.0    3e-04   
gb|KDO87472.1|  hypothetical protein CISIN_1g001814mg                 52.0    3e-04   Citrus sinensis [apfelsine]
gb|KDO87470.1|  hypothetical protein CISIN_1g001814mg                 52.0    3e-04   Citrus sinensis [apfelsine]
gb|KDO87467.1|  hypothetical protein CISIN_1g001814mg                 52.0    4e-04   Citrus sinensis [apfelsine]
ref|XP_006444177.1|  hypothetical protein CICLE_v10018690mg           52.0    4e-04   Citrus clementina [clementine]
emb|CDY64215.1|  BnaC09g51640D                                        52.0    4e-04   Brassica napus [oilseed rape]
gb|KDO87471.1|  hypothetical protein CISIN_1g001814mg                 52.0    4e-04   Citrus sinensis [apfelsine]
gb|KDO87468.1|  hypothetical protein CISIN_1g001814mg                 52.0    4e-04   Citrus sinensis [apfelsine]
gb|KCW58975.1|  hypothetical protein EUGRSUZ_H01605                   51.6    5e-04   Eucalyptus grandis [rose gum]
ref|XP_002270856.1|  PREDICTED: autophagy-related protein 18g         51.6    5e-04   Vitis vinifera
emb|CBI32303.3|  unnamed protein product                              51.6    6e-04   Vitis vinifera
ref|XP_010550088.1|  PREDICTED: autophagy-related protein 18h-like    50.8    9e-04   Tarenaya hassleriana [spider flower]



>ref|XP_007021082.1| Autophagy 18 F isoform 4 [Theobroma cacao]
 gb|EOY12607.1| Autophagy 18 F isoform 4 [Theobroma cacao]
Length=693

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 127/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ   PLWA+PEIYFQS++ + I M    A GGEIEIER+PTR +E
Sbjct  492  EKHNLYISEAELQMHQARMPLWAKPEIYFQSMVMDGIKMAEENAFGGEIEIERLPTRMIE  551

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ PK QQ R+      +N +LLH QRS +S  G+ +   S+      
Sbjct  552  ARSKDLVPVFDYLQTPKFQQARIPTVDSNSNGRLLH-QRSGLSENGQVSRRGSSGSLDSM  610

Query  494  TTNG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
              +G       NGIEE   NG  M P  TK  V N+DS K  T+L  VNN +   +  Q 
Sbjct  611  NEHGAAFTELLNGIEETSLNGPQM-PIETKGFVNNSDSSKIKTRLEIVNNRESLKMEAQL  669

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN++ +GLKM+NHFE E + FD
Sbjct  670  KFVNSNSEGLKMENHFEDEGDMFD  693



>ref|XP_007021080.1| Autophagy 18 F isoform 2 [Theobroma cacao]
 gb|EOY12605.1| Autophagy 18 F isoform 2 [Theobroma cacao]
Length=772

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 127/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ   PLWA+PEIYFQS++ + I M    A GGEIEIER+PTR +E
Sbjct  571  EKHNLYISEAELQMHQARMPLWAKPEIYFQSMVMDGIKMAEENAFGGEIEIERLPTRMIE  630

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ PK QQ R+      +N +LLH QRS +S  G+ +   S+      
Sbjct  631  ARSKDLVPVFDYLQTPKFQQARIPTVDSNSNGRLLH-QRSGLSENGQVSRRGSSGSLDSM  689

Query  494  TTNG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
              +G       NGIEE   NG  M P  TK  V N+DS K  T+L  VNN +   +  Q 
Sbjct  690  NEHGAAFTELLNGIEETSLNGPQM-PIETKGFVNNSDSSKIKTRLEIVNNRESLKMEAQL  748

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN++ +GLKM+NHFE E + FD
Sbjct  749  KFVNSNSEGLKMENHFEDEGDMFD  772



>ref|XP_007021079.1| Autophagy 18 F isoform 1 [Theobroma cacao]
 gb|EOY12604.1| Autophagy 18 F isoform 1 [Theobroma cacao]
Length=921

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 127/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ   PLWA+PEIYFQS++ + I M    A GGEIEIER+PTR +E
Sbjct  720  EKHNLYISEAELQMHQARMPLWAKPEIYFQSMVMDGIKMAEENAFGGEIEIERLPTRMIE  779

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ PK QQ R+      +N +LLH QRS +S  G+ +   S+      
Sbjct  780  ARSKDLVPVFDYLQTPKFQQARIPTVDSNSNGRLLH-QRSGLSENGQVSRRGSSGSLDSM  838

Query  494  TTNG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
              +G       NGIEE   NG  M P  TK  V N+DS K  T+L  VNN +   +  Q 
Sbjct  839  NEHGAAFTELLNGIEETSLNGPQM-PIETKGFVNNSDSSKIKTRLEIVNNRESLKMEAQL  897

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN++ +GLKM+NHFE E + FD
Sbjct  898  KFVNSNSEGLKMENHFEDEGDMFD  921



>gb|KDO52932.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
 gb|KDO52933.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
Length=779

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 126/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PTR +E
Sbjct  578  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTRMIE  637

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  638  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  696

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  697  TVNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  755

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  756  KFVNSKIEGLRMENHFEDEGDEFD  779



>gb|KDO52929.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
 gb|KDO52930.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
 gb|KDO52931.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
Length=832

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 126/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PTR +E
Sbjct  631  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTRMIE  690

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  691  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  749

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  750  TVNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  808

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  809  KFVNSKIEGLRMENHFEDEGDEFD  832



>gb|KDO52927.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
Length=921

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 126/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PTR +E
Sbjct  720  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTRMIE  779

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  780  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  838

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  839  TVNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  897

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  898  KFVNSKIEGLRMENHFEDEGDEFD  921



>ref|XP_006475220.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Citrus 
sinensis]
 ref|XP_006475221.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Citrus 
sinensis]
Length=921

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 126/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PTR VE
Sbjct  720  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTRMVE  779

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  780  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  838

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  839  TDNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  897

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  898  KFVNSKIEGLRMENHFEDEGDEFD  921



>ref|XP_006475222.1| PREDICTED: autophagy-related protein 18f-like isoform X3 [Citrus 
sinensis]
Length=832

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 126/204 (62%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PTR VE
Sbjct  631  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTRMVE  690

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  691  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  749

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  750  TDNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  808

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  809  KFVNSKIEGLRMENHFEDEGDEFD  832



>ref|XP_011030884.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Populus 
euphratica]
Length=890

 Score =   160 bits (406),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 125/203 (62%), Gaps = 10/203 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AELHMHQP  PLWA+PEIYFQS++   I +D   A  GEIEIERIPTR +E
Sbjct  689  EKHYLYISEAELHMHQPRFPLWAKPEIYFQSMMTEGIKVDDADALQGEIEIERIPTRMIE  748

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFG----NNDQLLHIQRS-EVSGKDNPINSNLGYPHCT  492
            ARSKDLVP+++YLQ PK    R+      +N +L H       +G+ +  +S+      T
Sbjct  749  ARSKDLVPLFDYLQTPKFLHTRVSSLDSNSNGRLQHQSYGPSENGRLSCRSSSGSLDSMT  808

Query  491  TNGCIEPP-YNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNN---SQISTQAK  324
             NG +    +NG EE G NG  M P  T+ IV +N SP+ N++L  VNN   S+   Q K
Sbjct  809  ENGAVVAELHNGAEETGWNGSRM-PVETRGIVNSNGSPETNSRLEVVNNRESSRTEAQLK  867

Query  323  FVNNDIDGLKMKNHFEGEVEEFD  255
            FVNN+ +  KM+N FE E +EFD
Sbjct  868  FVNNNNEAQKMENQFENEGDEFD  890



>ref|XP_002317566.2| hypothetical protein POPTR_0011s13610g [Populus trichocarpa]
 gb|EEE98178.2| hypothetical protein POPTR_0011s13610g [Populus trichocarpa]
Length=891

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 130/233 (56%), Gaps = 40/233 (17%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AELHMHQP  PLWA+PEIYFQS++   I +D   A  GEIEIERIPTR +E
Sbjct  660  EKHYLYISEAELHMHQPRFPLWAKPEIYFQSMMTEGIKVDDADALQGEIEIERIPTRMIE  719

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQ-----------RSEVSGKDNPI  522
            ARSKDLVP++++LQAPK    R+      +N +L H             RS     D+  
Sbjct  720  ARSKDLVPLFDHLQAPKFLHTRVPSLDSNSNGRLQHQSYGPSENGRLSCRSSSGSLDSMT  779

Query  521  NSNL----------GYPHC----------TTNGCIEPP-YNGIEENGSNGCWMAPETTKD  405
             + L          G   C          T NG +    +NG+EE G NG  M P  T+ 
Sbjct  780  ENGLQHQSYGPSENGRLSCRSSSGSLDSMTENGAVVAELHNGVEETGWNGSRM-PVETRG  838

Query  404  IVYNNDSPKANTQLGFVNN---SQISTQAKFVNNDIDGLKMKNHFEGEVEEFD  255
            +V +N SPK N++L  VNN   S+   Q KFVNN+ +GLKM+N FE E +EFD
Sbjct  839  VVNSNGSPKTNSRLEVVNNRESSRTEAQLKFVNNNNEGLKMENQFENEGDEFD  891



>ref|XP_011048286.1| PREDICTED: autophagy-related protein 18f-like [Populus euphratica]
Length=898

 Score =   159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 125/203 (62%), Gaps = 10/203 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLWA+PEIYFQS++   I ++   A  GE+EIERIP R +E
Sbjct  697  EKHHLYISEAELQMHQACLPLWAKPEIYFQSMMTEGIDVNDADAMQGEMEIERIPARMIE  756

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS--GKDNPINSNLGYPHCT  492
            ARSKDLVP+++YLQ PK    R+     N++  L  Q S +S  G+ +  +S+       
Sbjct  757  ARSKDLVPLFDYLQTPKFPHSRVLSLDSNSNGSLQHQSSGLSENGRLSCRSSSGSLDSMA  816

Query  491  TNG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVN---NSQISTQAK  324
             NG  +    NGIEE G NG  M P  T+  V +N SPK NT+L  VN   +S++  Q K
Sbjct  817  ENGVAVAELRNGIEETGWNGSRM-PVETRGFVDSNGSPKTNTRLEVVNSRESSRMEAQLK  875

Query  323  FVNNDIDGLKMKNHFEGEVEEFD  255
            FVN++  GLK++NHFE E +EFD
Sbjct  876  FVNSNNKGLKIENHFEDEGDEFD  898



>ref|XP_009794960.1| PREDICTED: autophagy-related protein 18f-like, partial [Nicotiana 
sylvestris]
Length=838

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 124/199 (62%), Gaps = 6/199 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  HMY S  EL MH+P  PLWA+PEIYFQS + + I++    A GGE EIE IPT  VE
Sbjct  641  ERHHMYISEVELEMHKPQIPLWAKPEIYFQSFVTDGINVGDVCAFGGESEIEAIPTHLVE  700

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLH-IQRSEVSGKDNPI-NSNLGYPHCTTNG  483
            ARSKDL+PV++Y+QA K QQ R   N D     + R EVSG  N + N   G  H + NG
Sbjct  701  ARSKDLIPVFDYIQASKTQQGRACVNGDHSQQSLPRLEVSGNCNLMANGGYGSRH-SMNG  759

Query  482  CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIST---QAKFVNN  312
                 + G E  G +G  M  +T    V +++SPKA+++L FVN+ + S    Q+KFVNN
Sbjct  760  PRSEVHCGQEVTGLDGIPMTGQTANGFVNSSESPKADSRLAFVNSMESSVKEAQSKFVNN  819

Query  311  DIDGLKMKNHFEGEVEEFD  255
            ++ G +M+NHFE EV++ D
Sbjct  820  NLGGAEMENHFEDEVDDVD  838



>ref|XP_006452163.1| hypothetical protein CICLE_v10007389mg [Citrus clementina]
 gb|ESR65403.1| hypothetical protein CICLE_v10007389mg [Citrus clementina]
Length=779

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 125/204 (61%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PT  VE
Sbjct  578  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTCMVE  637

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  638  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  696

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  697  TDNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  755

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  756  KFVNSKIEGLRMENHFEDEGDEFD  779



>ref|XP_006452161.1| hypothetical protein CICLE_v10007389mg [Citrus clementina]
 gb|ESR65401.1| hypothetical protein CICLE_v10007389mg [Citrus clementina]
Length=921

 Score =   159 bits (401),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 125/204 (61%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PT  VE
Sbjct  720  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTCMVE  779

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  780  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  838

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  839  TDNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  897

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  898  KFVNSKIEGLRMENHFEDEGDEFD  921



>ref|XP_006452162.1| hypothetical protein CICLE_v10007389mg [Citrus clementina]
 gb|ESR65402.1| hypothetical protein CICLE_v10007389mg [Citrus clementina]
Length=843

 Score =   158 bits (400),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 125/204 (61%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PT  VE
Sbjct  642  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTCMVE  701

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  702  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  760

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  761  TDNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  819

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  820  KFVNSKIEGLRMENHFEDEGDEFD  843



>ref|XP_008365705.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Malus 
domestica]
Length=889

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 118/204 (58%), Gaps = 11/204 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+YFQS++   + MD     GGEIEIERIPTR +E
Sbjct  687  EEHQLYISEAELQMHEARSPVWAKPELYFQSMIMEGVKMDDETTSGGEIEIERIPTRMIE  746

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS--GKDNPINSNLGYPHCT  492
            ARSKDLVPV+ YLQ P  QQ R+     N  + L  QRS +S  G  +  NS+      T
Sbjct  747  ARSKDLVPVFEYLQTPIFQQTRVASVDSNFSRQLSRQRSGISENGGRSCRNSSSSLDTMT  806

Query  491  TNGC-IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS----TQA  327
             +G  +    NGI   G  G  M P  +   V NNDSPK  TQL  VNN + S     Q 
Sbjct  807  ESGAGVAELTNGIGVTGRGGSQM-PTESMGFVNNNDSPKTETQLETVNNRESSLKLEAQL  865

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            K VNNDIDGL + N F  E +EFD
Sbjct  866  KSVNNDIDGLGVGNLFGIEGDEFD  889



>ref|XP_008365693.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Malus 
domestica]
 ref|XP_008365699.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Malus 
domestica]
Length=918

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 118/204 (58%), Gaps = 11/204 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+YFQS++   + MD     GGEIEIERIPTR +E
Sbjct  716  EEHQLYISEAELQMHEARSPVWAKPELYFQSMIMEGVKMDDETTSGGEIEIERIPTRMIE  775

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS--GKDNPINSNLGYPHCT  492
            ARSKDLVPV+ YLQ P  QQ R+     N  + L  QRS +S  G  +  NS+      T
Sbjct  776  ARSKDLVPVFEYLQTPIFQQTRVASVDSNFSRQLSRQRSGISENGGRSCRNSSSSLDTMT  835

Query  491  TNGC-IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS----TQA  327
             +G  +    NGI   G  G  M P  +   V NNDSPK  TQL  VNN + S     Q 
Sbjct  836  ESGAGVAELTNGIGVTGRGGSQM-PTESMGFVNNNDSPKTETQLETVNNRESSLKLEAQL  894

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            K VNNDIDGL + N F  E +EFD
Sbjct  895  KSVNNDIDGLGVGNLFGIEGDEFD  918



>ref|XP_009611125.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Nicotiana 
tomentosiformis]
Length=887

 Score =   157 bits (398),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 6/199 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  HMY S  EL MH+P  PLWA+ EIYFQS + + I++    A  GE EIE I T  VE
Sbjct  690  ERHHMYISEVELEMHKPQIPLWAKSEIYFQSFVTDGINVGDVCAFRGESEIEAISTHLVE  749

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLH-IQRSEVSGKDNPINSNLGY-PHCTTNG  483
            ARSKDL+PV++Y+QA K QQ R   N+D     + R E SG  N + +N GY  H + NG
Sbjct  750  ARSKDLIPVFDYIQASKTQQGRACFNSDHSQQSLPRLEFSGNCN-LMANGGYGSHHSMNG  808

Query  482  CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS---TQAKFVNN  312
                 + G E  G +G  M  +T    V +++SPKA+++L FVN+ + S   TQ+KFVNN
Sbjct  809  PRSEVHCGREVTGLDGRPMTSQTANGFVNSSESPKADSRLAFVNSMESSVKETQSKFVNN  868

Query  311  DIDGLKMKNHFEGEVEEFD  255
            ++DG +M+NHFE EV++ D
Sbjct  869  NLDGTEMENHFEDEVDDVD  887



>ref|XP_009358092.1| PREDICTED: autophagy-related protein 18f-like [Pyrus x bretschneideri]
 ref|XP_009358093.1| PREDICTED: autophagy-related protein 18f-like [Pyrus x bretschneideri]
Length=918

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 120/204 (59%), Gaps = 11/204 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+P++YFQS++   + MD   A GGEIEIERIPT  +E
Sbjct  716  ENHQLYISEAELQMHEARSPVWAKPKLYFQSMIMEGVKMDDETASGGEIEIERIPTCMIE  775

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS--GKDNPINSNLGYPHCT  492
            ARSKDLVPV+ YLQAP  QQ R+     N  + L  QRS +S  G  +  NS+      T
Sbjct  776  ARSKDLVPVFEYLQAPIFQQTRVASVESNFSRQLSRQRSGISENGGRSCRNSSSSLDTMT  835

Query  491  TNGC-IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS----TQA  327
             +G  +    NGIE  G  G  M P  +   V NN+SPK  TQL  VNN + S     Q 
Sbjct  836  ESGAGVAELTNGIEVTGRGGSQM-PTESMGFVNNNNSPKTETQLETVNNRESSLKSEAQL  894

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            K VNNDIDGL + N F  E +EFD
Sbjct  895  KSVNNDIDGLGVGNLFGIEGDEFD  918



>ref|XP_009611131.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Nicotiana 
tomentosiformis]
Length=809

 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 125/199 (63%), Gaps = 6/199 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  HMY S  EL MH+P  PLWA+ EIYFQS + + I++    A  GE EIE I T  VE
Sbjct  612  ERHHMYISEVELEMHKPQIPLWAKSEIYFQSFVTDGINVGDVCAFRGESEIEAISTHLVE  671

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLH-IQRSEVSGKDNPINSNLGY-PHCTTNG  483
            ARSKDL+PV++Y+QA K QQ R   N+D     + R E SG  N + +N GY  H + NG
Sbjct  672  ARSKDLIPVFDYIQASKTQQGRACFNSDHSQQSLPRLEFSGNCN-LMANGGYGSHHSMNG  730

Query  482  CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS---TQAKFVNN  312
                 + G E  G +G  M  +T    V +++SPKA+++L FVN+ + S   TQ+KFVNN
Sbjct  731  PRSEVHCGREVTGLDGRPMTSQTANGFVNSSESPKADSRLAFVNSMESSVKETQSKFVNN  790

Query  311  DIDGLKMKNHFEGEVEEFD  255
            ++DG +M+NHFE EV++ D
Sbjct  791  NLDGTEMENHFEDEVDDVD  809



>ref|XP_009355581.1| PREDICTED: autophagy-related protein 18f-like [Pyrus x bretschneideri]
Length=917

 Score =   154 bits (390),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 117/205 (57%), Gaps = 13/205 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+YFQSI+   + MD   A  GEIEIERIPT  +E
Sbjct  715  EKHQLYISEAELQMHEAQSPVWAKPELYFQSIIVEGVKMDDETASVGEIEIERIPTHMIE  774

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNND----QLLHIQRSEVSGKDNPI--NSNLGYPHC  495
            ARSKDLVPV+ YLQ P  QQ R+   +     QL H QRS VS        NS+      
Sbjct  775  ARSKDLVPVFEYLQTPIFQQTRVASVDSNFSGQLSH-QRSGVSENSGLSCRNSSSSLDTM  833

Query  494  TTNGC-IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS----TQ  330
            T +G  +    NGIEE G  G    P   K  V NNDSPK  TQL  VNN + S     Q
Sbjct  834  TESGAGVAQLANGIEETGRGGS-QTPIERKGFVNNNDSPKTETQLETVNNRESSLNLEAQ  892

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
             KFVNND +GL + N F  + +EFD
Sbjct  893  LKFVNNDKEGLGLGNLFGDKGDEFD  917



>ref|XP_007213662.1| hypothetical protein PRUPE_ppa001097mg [Prunus persica]
 gb|EMJ14861.1| hypothetical protein PRUPE_ppa001097mg [Prunus persica]
Length=909

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 114/205 (56%), Gaps = 21/205 (10%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+YFQS++   + MD   A GGEIEIERIPTRT+E
Sbjct  715  EKHQLYISEAELQMHETQSPVWAKPELYFQSMIMEGVKMDDETASGGEIEIERIPTRTIE  774

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQ-------RSEVSGKDNPINSNLGYPH  498
            ARSKDLVPV++YLQ P+ QQ R+   +  +  I        RS     D   +S  G   
Sbjct  775  ARSKDLVPVFDYLQTPRFQQTRVAAIDSNVSGISENGRLSCRSSSGSLDTMTDSGAGVAE  834

Query  497  CTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
             +         NG EE    G    P  +K  V NNDS K  TQL  VNN +       Q
Sbjct  835  LS---------NGTEETEWGGS-QTPVESKRFVNNNDSQKTKTQLEIVNNRERTLKTEAQ  884

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
             KFVN++I+G+ M+N F  E +E D
Sbjct  885  LKFVNSNIEGMGMENLFREEGDELD  909



>ref|XP_008244343.1| PREDICTED: autophagy-related protein 18f isoform X1 [Prunus mume]
Length=909

 Score =   151 bits (381),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 113/205 (55%), Gaps = 21/205 (10%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+YFQS++   + MD   A GGEIEIERIPTR +E
Sbjct  715  EKHQLYISEAELQMHEAQSPVWAKPELYFQSMIVEGVQMDDETASGGEIEIERIPTRMIE  774

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQ-------RSEVSGKDNPINSNLGYPH  498
            ARSKDLVPV++YLQ P+ QQ R+   +  +  I        RS     D   +S  G   
Sbjct  775  ARSKDLVPVFDYLQTPRFQQTRVAAIDRNVSGISENGRLSCRSSSGSLDTMTDSGAGVAE  834

Query  497  CTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
             +         NG EE    G   A E  K  V NNDS K  TQL  VNN +       Q
Sbjct  835  LS---------NGTEETEWGGSQTAVE-NKGFVNNNDSQKTKTQLEIVNNRERTLKTEAQ  884

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
             KFVN++I+G+ M+N F  E +E D
Sbjct  885  LKFVNSNIEGMGMENLFREEGDELD  909



>ref|XP_010240957.1| PREDICTED: autophagy-related protein 18f-like [Nelumbo nucifera]
Length=894

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 122/196 (62%), Gaps = 11/196 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL  HQ   PLWA+ +IYFQ ++ +   ++ +   GGEIEIERIPTR +E
Sbjct  694  ERNHLYISEAELQTHQSGIPLWAKSKIYFQVMMMDSEKVEES-VSGGEIEIERIPTRMIE  752

Query  656  ARSKDLVPVYNYLQAPKIQQQR---MFGNNDQLLHIQRSEVS--GKDNPINSNLGYPHCT  492
            ARSKDLVPV+NYL+ PK QQ R   +  N+  LL  QRS +S  GK +  NS++    C 
Sbjct  753  ARSKDLVPVFNYLRTPKFQQLRVPALDSNHIGLLQNQRSGLSDDGKSSCRNSSISL-DCI  811

Query  491  TNG--CIEPPYNGIEENGSN-GCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ-ISTQAK  324
            + G        +GIEENG + G   + E+    V NNDSPK +T L FVN+ + + +  K
Sbjct  812  SEGSNAAAELRSGIEENGWDCGLLFSSESDVGFVNNNDSPKISTGLEFVNSKEKMGSHLK  871

Query  323  FVNNDIDGLKMKNHFE  276
            FVNN+   LKM+NHFE
Sbjct  872  FVNNNKQNLKMENHFE  887



>ref|XP_010105588.1| Breast carcinoma-amplified sequence 3 [Morus notabilis]
 gb|EXC05117.1| Breast carcinoma-amplified sequence 3 [Morus notabilis]
Length=890

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 122/201 (61%), Gaps = 12/201 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y + AELHMH+P  P+WARP I FQS++   ++MD + A GGE+EIERIPTRT+E
Sbjct  690  ENHHLYIAEAELHMHEPRNPVWARPGICFQSMVMEGVNMDRDIASGGEVEIERIPTRTIE  749

Query  656  ARSKDLVPVYNYLQAPKIQQQR--MFGN--NDQLLHIQRSEV--SGKDNPINSNLGYPHC  495
            ARSKDLVPV++Y+Q  K Q+ R     N  N + LH QRS V  +G+ +  +S+      
Sbjct  750  ARSKDLVPVFDYVQTTKYQKTRNHALDNSINGRFLH-QRSGVFENGRISCKSSSGSLDSL  808

Query  494  TTNGCIEPP-YNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQI---STQA  327
            T  G      YNG+++    G    P  T   V   DS K  TQL  VN+ +      Q 
Sbjct  809  TDCGAASTDLYNGVDKMRRYGL-ETPADTMHFVNTYDSSKTTTQLETVNDRESLRKEPQL  867

Query  326  KFVNNDIDGLKMKNHFEGEVE  264
            KFVNN+I+GLKM+NHFE E E
Sbjct  868  KFVNNNIEGLKMENHFEDEDE  888



>ref|XP_009343079.1| PREDICTED: autophagy-related protein 18f-like [Pyrus x bretschneideri]
Length=918

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 118/205 (58%), Gaps = 13/205 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+ FQS++   + MD   A GGEIEIERIPT  +E
Sbjct  716  EKHQLYISEAELQMHEARSPVWAKPELNFQSMIMEGVKMDDETASGGEIEIERIPTCMIE  775

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNND----QLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV+ YLQAP  QQ R+   +     QLL  QRS +S  G  +  NS+      
Sbjct  776  ARSKDLVPVFEYLQAPIFQQTRVASVDSNFSGQLLR-QRSGISENGGRSCRNSSSSLDTM  834

Query  494  TTNGC-IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS----TQ  330
            T +G  +    NGIE  G  G  M P  +   V NN+SPK  TQL  VNN + S     Q
Sbjct  835  TESGAGVAELTNGIEVTGQGGSQM-PTESMGFVNNNNSPKTETQLETVNNRESSLKLEAQ  893

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
             K VNNDID L + N F  E + FD
Sbjct  894  LKSVNNDIDSLGVGNLFGIEGDAFD  918



>gb|KDO52928.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
Length=828

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 122/204 (60%), Gaps = 16/204 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P    QS++  D  M       GEIEIER PTR +E
Sbjct  631  DKHHLYISEAELQMHPPRIPLWAKP----QSMMIKDFKMGEENFLKGEIEIERFPTRMIE  686

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVS--GKDNPINSNLGYPHC  495
            ARSKDLVPV++YLQ+PK  Q R+      +N++LLH QRS +S  G  +  +S+      
Sbjct  687  ARSKDLVPVFDYLQSPKFSQARVPTVGRNSNERLLH-QRSGLSENGLLSRRSSSGSLDSV  745

Query  494  TTNGCIEP-PYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG +   P  GIEE  S  C   P  TK  V N+ SPK  T+   VNNS+   +  Q 
Sbjct  746  TVNGALAAEPNIGIEET-SLDCPQMPVDTKGFVNNSVSPKTKTRHEIVNNSESLRVEAQL  804

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVN+ I+GL+M+NHFE E +EFD
Sbjct  805  KFVNSKIEGLRMENHFEDEGDEFD  828



>ref|XP_008244346.1| PREDICTED: autophagy-related protein 18f isoform X3 [Prunus mume]
Length=889

 Score =   147 bits (371),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 108/198 (55%), Gaps = 27/198 (14%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+YFQS++   + MD   A GGEIEIERIPTR +E
Sbjct  715  EKHQLYISEAELQMHEAQSPVWAKPELYFQSMIVEGVQMDDETASGGEIEIERIPTRMIE  774

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCI  477
            ARSKDLVPV++YLQ P+ QQ              RS     D   +S  G    +     
Sbjct  775  ARSKDLVPVFDYLQTPRFQQ-------------TRSSSGSLDTMTDSGAGVAELS-----  816

Query  476  EPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQAKFVNND  309
                NG EE    G   A E  K  V NNDS K  TQL  VNN +       Q KFVN++
Sbjct  817  ----NGTEETEWGGSQTAVE-NKGFVNNNDSQKTKTQLEIVNNRERTLKTEAQLKFVNSN  871

Query  308  IDGLKMKNHFEGEVEEFD  255
            I+G+ M+N F  E +E D
Sbjct  872  IEGMGMENLFREEGDELD  889



>ref|XP_006360096.1| PREDICTED: autophagy-related protein 18f-like [Solanum tuberosum]
Length=892

 Score =   146 bits (369),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 117/195 (60%), Gaps = 7/195 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  HMY S  EL MH+    LW +PEIYFQS + +++ +    A GGEIEIE  P   VE
Sbjct  704  ERHHMYISEVELEMHKRQISLWEKPEIYFQSFVADEVKIGDVYAFGGEIEIEEFPMHLVE  763

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLH-IQRSEVSGKDNPINSNLGYPHCTTNGC  480
            ARSKDLVPV++++QA K QQ R+  N+D     + R EVS   N + + +   H + NG 
Sbjct  764  ARSKDLVPVFDFIQASKTQQGRVSVNSDNSQQSLPRLEVSESCNLMANGVNELHHSMNGP  823

Query  479  IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQISTQAKFVNNDIDG  300
                + G E NG +G  M  +T    V +++SPKA+ +L FVNN       KFVNN++DG
Sbjct  824  RSEVHCGREVNGLDGLPMTSQTANGFVNSSESPKADAELDFVNN------MKFVNNNLDG  877

Query  299  LKMKNHFEGEVEEFD  255
             +M++HF+ EV+  D
Sbjct  878  TEMEDHFDDEVDCVD  892



>gb|KHG11309.1| Breast carcinoma-amplified sequence 3 [Gossypium arboreum]
Length=889

 Score =   146 bits (369),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 122/204 (60%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ  TPLWA+PEIYFQS++ +DI+M    A  GE+EIE + TR + 
Sbjct  688  EKHNLYISEAELQMHQAQTPLWAKPEIYFQSMVMDDINMADENAFVGEVEIEMLLTRMIG  747

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVSGKDN-PINSNLGYPHCT  492
             R K LVPV++YLQ+ K QQ R+      NN  LLH QRS +S        S  G  +C 
Sbjct  748  TRKKSLVPVFDYLQSFKFQQARVPTVDSNNNGWLLH-QRSGLSENGRLSCRSISGSLNCM  806

Query  491  T-NG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG  ++   NGIEE   NG  M P  TK  V  +DSPK NT+L  VNNS+   +  Q 
Sbjct  807  TENGDAVDELQNGIEETRLNGRQM-PLGTKGFVNRSDSPKTNTRLEIVNNSENSRMEAQL  865

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVNN+ + L M N F  E +E+D
Sbjct  866  KFVNNNSEDLNMGNLFGDEGDEYD  889



>gb|KJB45593.1| hypothetical protein B456_007G314600 [Gossypium raimondii]
 gb|KJB45594.1| hypothetical protein B456_007G314600 [Gossypium raimondii]
Length=889

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 121/204 (59%), Gaps = 12/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ  TPLWA+PEIYFQS+L +DI+M    A  GEIEIE + TR   
Sbjct  688  EKHNLYISEAELQMHQAQTPLWAKPEIYFQSMLMDDINMADENAFVGEIEIEMLLTRMTG  747

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF----GNNDQLLHIQRSEVSGKDN-PINSNLGYPHCT  492
             R K LVPV++YLQ+ K QQ R+      NN  L+H QRS +S        S  G  +C 
Sbjct  748  TRKKSLVPVFDYLQSFKFQQARVSTVDNNNNGCLMH-QRSGLSENGRLSCRSISGSLNCM  806

Query  491  T-NG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG  ++   NGIEE   NG  M P  TK  V  +DSPK NT+L  VNNS+   +  Q 
Sbjct  807  TKNGDAVDELQNGIEETRLNGHQM-PLGTKGFVNRSDSPKTNTRLEIVNNSENSRMEAQL  865

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVNN+ + L M N F  E +E+D
Sbjct  866  KFVNNNSEDLNMGNLFGDEGDEYD  889



>ref|XP_008386020.1| PREDICTED: autophagy-related protein 18f [Malus domestica]
Length=918

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 118/204 (58%), Gaps = 13/204 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE+YFQSI+   + MD   A  GEIEIERIPTR +E
Sbjct  716  EKHQLYISEAELQMHEAQSPVWAKPELYFQSIVVEGVKMDDETASVGEIEIERIPTRMIE  775

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNND----QLLHIQRSEVSGKD--NPINSNLGYPHC  495
            ARSKDLVPV+ YLQ P  QQ R+   +     QL H QRS VS     +  NS+      
Sbjct  776  ARSKDLVPVFEYLQTPIFQQTRVASVDSNFSGQLSH-QRSRVSENSGLSCRNSSSSLDXM  834

Query  494  TTNGC-IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS----TQ  330
            T +G  +    NGIEE G  G    P   K  V NN SPK  TQL  VNN + S     Q
Sbjct  835  TESGAGVAQLANGIEETGRGGS-QTPIERKGFVNNNYSPKTETQLETVNNRESSLNSEAQ  893

Query  329  AKFVNNDIDGLKMKNHFEGEVEEF  258
             KFVNNDI+GL + N F  E +EF
Sbjct  894  LKFVNNDIEGLGLGNLFGXEGDEF  917



>ref|XP_004244157.1| PREDICTED: autophagy-related protein 18f [Solanum lycopersicum]
Length=892

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 116/195 (59%), Gaps = 7/195 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  HMY S  EL MH+    LWA+PEIYFQS + +++ +    A GGE EIE +PT  VE
Sbjct  704  ERHHMYISEVELEMHKRQISLWAKPEIYFQSFVADEVKIGDIYAFGGETEIEEVPTHLVE  763

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLH-IQRSEVSGKDNPINSNLGYPHCTTNGC  480
            ARSKDLVPV++++QA K Q  R+  N+D     + R EVS   N + + +   H +  G 
Sbjct  764  ARSKDLVPVFDFIQASKTQPGRVSVNSDNSQQSLPRLEVSNYCNLMANGVDELHHSMTGP  823

Query  479  IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQISTQAKFVNNDIDG  300
                + G E NG +G  M  +T    V +++SPKA+ +L FVNN       KFVNN++DG
Sbjct  824  RSKVHCGREVNGLDGLPMTSQTANGFVNSSESPKADAELDFVNN------MKFVNNNLDG  877

Query  299  LKMKNHFEGEVEEFD  255
              +++HFE EV+  D
Sbjct  878  AALEDHFEDEVDGVD  892



>gb|KJB45595.1| hypothetical protein B456_007G314600 [Gossypium raimondii]
Length=901

 Score =   144 bits (363),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 119/203 (59%), Gaps = 12/203 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ  TPLWA+PEIYFQS+L +DI+M    A  GEIEIE + TR   
Sbjct  688  EKHNLYISEAELQMHQAQTPLWAKPEIYFQSMLMDDINMADENAFVGEIEIEMLLTRMTG  747

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF----GNNDQLLHIQRSEVSGKDN-PINSNLGYPHCT  492
             R K LVPV++YLQ+ K QQ R+      NN  L+H QRS +S        S  G  +C 
Sbjct  748  TRKKSLVPVFDYLQSFKFQQARVSTVDNNNNGCLMH-QRSGLSENGRLSCRSISGSLNCM  806

Query  491  T-NG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            T NG  ++   NGIEE   NG  M P  TK  V  +DSPK NT+L  VNNS+   +  Q 
Sbjct  807  TKNGDAVDELQNGIEETRLNGHQM-PLGTKGFVNRSDSPKTNTRLEIVNNSENSRMEAQL  865

Query  326  KFVNNDIDGLKMKNHFEGEVEEF  258
            KFVNN+ + L M N F  E  EF
Sbjct  866  KFVNNNSEDLNMGNLFGDEGVEF  888



>emb|CAN75263.1| hypothetical protein VITISV_005771 [Vitis vinifera]
Length=893

 Score =   141 bits (356),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 116/204 (57%), Gaps = 16/204 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLWA+PEIYFQ+++ + +  +     GGEIE+ER PTR +E
Sbjct  696  ERHHLYISEAELQMHQAQNPLWAKPEIYFQTMMVDGLEENV---LGGEIEVERFPTRMIE  752

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTT  489
            ARSKDLVPV++YLQ PK Q+ R+       N   LH +            S+ G      
Sbjct  753  ARSKDLVPVFDYLQTPKFQKARVPVLDSNINGHPLHHKSGPSENGRLSRRSSSGSLDLVA  812

Query  488  NGCI---EPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            +G +   E P  GIEE G NG  M PET K  V +ND PK  T L  VNN +   +  Q 
Sbjct  813  DGGVAVAEHP-TGIEETGWNGLRM-PETDKGFVNSNDRPKTKT-LKTVNNRESFKMEAQH  869

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVNN+ DGL ++N  E   +EFD
Sbjct  870  KFVNNNKDGLNVENQLEDADDEFD  893



>ref|XP_002279886.1| PREDICTED: autophagy-related protein 18f isoform X1 [Vitis vinifera]
Length=922

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 116/204 (57%), Gaps = 16/204 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLWA+PEIYFQ+++ + +  +     GGEIE+ER PTR +E
Sbjct  725  ERHHLYISEAELQMHQAQNPLWAKPEIYFQTMMVDGLEENV---LGGEIEVERFPTRMIE  781

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTT  489
            ARSKDLVPV++YLQ PK Q+ R+       N   LH +            S+ G      
Sbjct  782  ARSKDLVPVFDYLQTPKFQKARVPVLDSNINGHPLHHKSGPSENGRLSRRSSSGSLDLVA  841

Query  488  NGCI---EPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQA  327
            +G +   E P  GIEE G NG  M PET K  V +ND PK  T L  VNN +   +  Q 
Sbjct  842  DGGVAVAEHP-TGIEETGWNGLRM-PETDKGFVNSNDRPKTKT-LKTVNNRESFKMEAQH  898

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
            KFVNN+ DGL ++N  E   +EFD
Sbjct  899  KFVNNNKDGLNVENQLEDADDEFD  922



>ref|XP_011460985.1| PREDICTED: autophagy-related protein 18f [Fragaria vesca subsp. 
vesca]
Length=895

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 118/219 (54%), Gaps = 39/219 (18%)
 Frame = -3

Query  836  EXQHMYXSXAEL-HMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            E  H+Y S AEL  MH+  +PLWARPE+YFQS++   + MD   A GGEIEIERIPTR +
Sbjct  691  EKHHLYISEAELLQMHETRSPLWARPELYFQSMIVEGVKMDGETAAGGEIEIERIPTRMI  750

Query  659  EARSKDLVPVYNYLQAPKIQQQRMFGNNDQL---LHIQRSEV------------SGKDNP  525
            EARSKDLVPV++YLQ P  Q  R+   N  +   L  QRS +            +  D  
Sbjct  751  EARSKDLVPVFDYLQTPVFQPTRVAAVNSNISGKLIQQRSGIPENDRLSCRSSSNSLDTM  810

Query  524  INSNLGYP-HCTTNGCIEPPYNGIEENGSNGCWMAPETT---KDIVYNNDSPKANTQLGF  357
             +S  G   HCT          G EE G    W  P+ T   K  V N DSP+  TQL  
Sbjct  811  THSGAGLTEHCT----------GSEETG----WGVPQMTIGSKGSVNNYDSPETKTQLET  856

Query  356  VNNSQ----ISTQAKFVNNDI-DGLKMKNHFEGEVEEFD  255
            VN+ +    +  Q KFVNNDI + + M N FE   +E+D
Sbjct  857  VNSREHSFKMEAQLKFVNNDIEEDMGMGNLFEQGGDEYD  895



>ref|XP_012070728.1| PREDICTED: autophagy-related protein 18f [Jatropha curcas]
 gb|KDP39046.1| hypothetical protein JCGZ_00803 [Jatropha curcas]
Length=921

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 116/200 (58%), Gaps = 9/200 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLWA+PEIYFQ ++   I MD      GEIE+ERIP RT+E
Sbjct  725  EKHHLYISEAELQMHQAHIPLWAKPEIYFQLMVTEGIKMDEENTVLGEIEVERIPARTIE  784

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVS--GKDNPINSNLGYPHCTTNG  483
            ARSKDLVPV++YL+  ++    + GN +  L  QRS ++  GK +  +S+      T +G
Sbjct  785  ARSKDLVPVFDYLRHARVPA--LDGNINGHLQHQRSVLTENGKHSRRSSSGSLDSMTDSG  842

Query  482  CIEPPY-NGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQAKFVN  315
             +     N +EE G  G    P      V + DSPK NT L  VNN++      Q KFVN
Sbjct  843  AVTAELQNVVEETGWYGH-RKPVEAMGFVNSRDSPKTNTWLENVNNTESLRTGAQLKFVN  901

Query  314  NDIDGLKMKNHFEGEVEEFD  255
            ++  G K +NHFE E +EFD
Sbjct  902  SNNGGPKAENHFEDEGDEFD  921



>ref|XP_011097925.1| PREDICTED: autophagy-related protein 18f [Sesamum indicum]
Length=893

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 120/200 (60%), Gaps = 10/200 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  HM+ S AEL MHQ   PLWAR EIYFQS+L +  ++   GACGGEIEIER+PTR +E
Sbjct  698  EKHHMHISEAELQMHQNQNPLWARSEIYFQSMLTDGFNIKEEGACGGEIEIERVPTRMLE  757

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF-GNNDQLLHIQRSEVS--GKDNPINSNLGYPHCTTN  486
            ARS+ LVPV++YLQ PK QQ R+  GNN+  +  Q S+VS  GK    +S+         
Sbjct  758  ARSRGLVPVFDYLQTPKSQQGRITDGNNNGQIDPQGSDVSEYGKLAGRSSSGSLDSIANA  817

Query  485  GCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVN---NSQISTQAKFVN  315
            G I+  Y+ + + G +G     ET+   V  ND+P  N  +  VN   NS   +Q + V+
Sbjct  818  GIIDDEYS-LHDKGQDGLQFT-ETSGGFVNTNDTPIVNAWVDNVNTRDNSVTESQHRSVH  875

Query  314  NDIDGLKMKNHFEGEVEEFD  255
              IDGLK++N    E +EFD
Sbjct  876  T-IDGLKVENQ-SAEGDEFD  893



>ref|XP_008244345.1| PREDICTED: autophagy-related protein 18f isoform X2 [Prunus mume]
Length=905

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 109/205 (53%), Gaps = 25/205 (12%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+  +P+WA+PE    S++   + MD   A GGEIEIERIPTR +E
Sbjct  715  EKHQLYISEAELQMHEAQSPVWAKPE----SMIVEGVQMDDETASGGEIEIERIPTRMIE  770

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQ-------RSEVSGKDNPINSNLGYPH  498
            ARSKDLVPV++YLQ P+ QQ R+   +  +  I        RS     D   +S  G   
Sbjct  771  ARSKDLVPVFDYLQTPRFQQTRVAAIDRNVSGISENGRLSCRSSSGSLDTMTDSGAGVAE  830

Query  497  CTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
             +         NG EE    G   A E  K  V NNDS K  TQL  VNN +       Q
Sbjct  831  LS---------NGTEETEWGGSQTAVE-NKGFVNNNDSQKTKTQLEIVNNRERTLKTEAQ  880

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
             KFVN++I+G+ M+N F  E +E D
Sbjct  881  LKFVNSNIEGMGMENLFREEGDELD  905



>gb|KHN47845.1| Breast carcinoma-amplified sequence 3 like [Glycine soja]
Length=905

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 117/205 (57%), Gaps = 14/205 (7%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPVTPLWARPEIYFQSILFN-DISMDANGACGGEIEIERIPTRT  663
            E +H  Y S AEL MHQ  TPLW +  IYF S+     + MD   A GGE EIE+IPTR 
Sbjct  704  EKEHQFYISEAELQMHQAKTPLWGKTGIYFHSVGKEATLMMDEEAALGGEFEIEKIPTRV  763

Query  662  VEARSKDLVPVYNYLQAPKIQQQRMFGN---NDQLLHIQRSEVSGKDNPINSNLGYPHCT  492
            ++ARSKDLVP+++Y+Q  K QQ R   N   N+QLLH Q S   G+ +P    LG+P C 
Sbjct  764  IQARSKDLVPIFDYIQTSKFQQIRTLVNNKLNEQLLH-QSSFEKGRISP-RGILGFPDCI  821

Query  491  TNG--CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
             N    I    +GIE N   G  + P  TK  V NN++ K NT    VNN +    +   
Sbjct  822  NNSGETIAEFKSGIEGN-ERGDSLIPAETKAFVNNNNTLKPNTWPEIVNNRRENLNMDVH  880

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
              FVN+D  GLK++NH + + +EF+
Sbjct  881  QMFVNSDRKGLKLENHCKEKGDEFE  905



>emb|CBI20508.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 107/191 (56%), Gaps = 16/191 (8%)
 Frame = -3

Query  797  MHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVEARSKDLVPVYNYL  618
            MHQ   PLWA+PEIYFQ+++ + +        GGEIE+ER PTR +EARSKDLVPV++YL
Sbjct  1    MHQAQNPLWAKPEIYFQTMMVDGLE---ENVLGGEIEVERFPTRMIEARSKDLVPVFDYL  57

Query  617  QAPKIQQQRM----FGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCI---EPPYNG  459
            Q PK Q+ R+       N   LH +            S+ G      +G +   E P  G
Sbjct  58   QTPKFQKARVPVLDSNINGHPLHHKSGPSENGRLSRRSSSGSLDLVADGGVAVAEHP-TG  116

Query  458  IEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQAKFVNNDIDGLKMK  288
            IEE G NG  M PET K  V +ND PK  T L  VNN +   +  Q KFVNN+ DGL ++
Sbjct  117  IEETGWNGLRM-PETDKGFVNSNDRPKTKT-LKTVNNRESFKMEAQHKFVNNNKDGLNVE  174

Query  287  NHFEGEVEEFD  255
            N  E   +EFD
Sbjct  175  NQLEDADDEFD  185



>ref|XP_010644334.1| PREDICTED: autophagy-related protein 18f isoform X2 [Vitis vinifera]
Length=898

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 111/199 (56%), Gaps = 30/199 (15%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLWA+PEIYFQ+++ + +  +     GGEIE+ER PTR +E
Sbjct  725  ERHHLYISEAELQMHQAQNPLWAKPEIYFQTMMVDGLEENV---LGGEIEVERFPTRMIE  781

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLH--IQRSEVSGKDNPINSNLGYPHCTTNG  483
            ARSKDLVPV++YLQ PK Q+ R+   +       +    V+  ++P              
Sbjct  782  ARSKDLVPVFDYLQTPKFQKARLSRRSSSGSLDLVADGGVAVAEHP--------------  827

Query  482  CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQAKFVNN  312
                   GIEE G NG  M PET K  V +ND PK  T L  VNN +   +  Q KFVNN
Sbjct  828  ------TGIEETGWNGLRM-PETDKGFVNSNDRPKTKT-LKTVNNRESFKMEAQHKFVNN  879

Query  311  DIDGLKMKNHFEGEVEEFD  255
            + DGL ++N  E   +EFD
Sbjct  880  NKDGLNVENQLEDADDEFD  898



>emb|CDP05803.1| unnamed protein product [Coffea canephora]
Length=891

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 109/199 (55%), Gaps = 7/199 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLW + EIYFQ++  + I+     A  GEIEIERIPTR +E
Sbjct  691  EKYHLYLSEAELQMHQHRVPLWMKAEIYFQTMATDGINTSEESAFEGEIEIERIPTRMIE  750

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGN--NDQLLHIQRSEVS--GKDNPINSNLGYPHCTT  489
              SK+LVPV+ YLQAPK+Q  R   N   D+ L  QRS +S   K   + S+      + 
Sbjct  751  VSSKELVPVFEYLQAPKLQPGRQVLNRSKDRQLLYQRSGMSENRKLAYMGSSGSLDSMSG  810

Query  488  NGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQIS---TQAKFV  318
               +   +NG EE G  G  +   TTK  V   D  KAN +L  VNN + S   TQ  FV
Sbjct  811  GLAVTELHNGAEETGWVGLQVPTNTTKGFVNTADYSKANGRLEIVNNRESSVTETQFSFV  870

Query  317  NNDIDGLKMKNHFEGEVEE  261
            NN I  L  +N FEG  +E
Sbjct  871  NNSIGVLTSENQFEGSGDE  889



>gb|KHN36731.1| Breast carcinoma-amplified sequence 3 like [Glycine soja]
Length=969

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 114/191 (60%), Gaps = 19/191 (10%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGAC-GGEIEIERIPTRTV  660
            E  H+Y S AEL MHQ  TPLWA+PEIYF S+L     MD   A  GGE EIERIPT  +
Sbjct  761  EEHHLYISEAELQMHQAQTPLWAKPEIYFHSMLQESTIMDEEAAASGGEFEIERIPTCMI  820

Query  659  EARSKDLVPVYNYLQAPKIQQQR---MFG-NNDQLLHIQRSEVS--GKDNPINSNLGYPH  498
            EARSKDLVP+++Y+Q PK+QQ+R   M G  N+QLLH   S+V+  G+ +P  + L  P 
Sbjct  821  EARSKDLVPIFDYIQTPKVQQKRIPAMDGKTNEQLLHYSSSQVAGNGRISP-RTILESPE  879

Query  497  CTTNG--CIEPPYNGIEENGSNGCW---MAPETTKDIVYNNDSPKANTQLGFVNN--SQI  339
            C TN    +    +GIE  G+   W   + P  T + V NND+ + NTQ   VNN    +
Sbjct  880  CVTNAGDAVSEFRSGIE--GTE--WDNHVVPSETVNFVNNNDTFRQNTQHEIVNNRMEHL  935

Query  338  STQAKFVNNDI  306
            +T A  +  +I
Sbjct  936  NTGAHLMRGNI  946



>ref|XP_006582241.1| PREDICTED: autophagy-related protein 18f-like [Glycine max]
Length=905

 Score =   133 bits (335),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 116/205 (57%), Gaps = 14/205 (7%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPVTPLWARPEIYFQSILFN-DISMDANGACGGEIEIERIPTRT  663
            E +H  Y S AEL MHQ  TPLW +  IYF S+     + MD   A  GE EIE+IPTR 
Sbjct  704  EKEHQFYISEAELQMHQAKTPLWGKTGIYFHSVGKEATLMMDEEAALEGEFEIEKIPTRV  763

Query  662  VEARSKDLVPVYNYLQAPKIQQQRMFGN---NDQLLHIQRSEVSGKDNPINSNLGYPHCT  492
            ++ARSKDLVP+++Y+Q  K QQ R   N   N+QLLH Q S   G+ +P    LG+P C 
Sbjct  764  IQARSKDLVPIFDYIQTSKFQQIRTLVNNKLNEQLLH-QSSFEKGRISP-RGILGFPDCI  821

Query  491  TNG--CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
             N    I    +GIE N   G  + P  TK  V NN++ K NT    VNN +    +   
Sbjct  822  NNSGETIAEFKSGIEGN-ERGDSLIPAETKAFVNNNNTLKPNTWPEIVNNRRENLNMDVH  880

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
              FVN+D  GLK++NH + + +EF+
Sbjct  881  QMFVNSDRKGLKLENHCKEKGDEFE  905



>ref|XP_011095316.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Sesamum 
indicum]
Length=869

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 94/167 (56%), Gaps = 13/167 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   MY S AELHMHQ   PLWAR EIYFQS+L +  +MD  GAC GE EIER+P R +E
Sbjct  700  EKNQMYISEAELHMHQNQNPLWARSEIYFQSMLTDGSNMDEEGACNGETEIERVPIRMLE  759

Query  656  ARSKDLVPVYNYLQAPKIQQQR---MFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTN  486
            ARSKDLVPV++Y+ APK Q  R   M  NN++    Q S+ SG         G     +N
Sbjct  760  ARSKDLVPVFDYIHAPKYQWGRTSAMKDNNNEQFEYQGSDASGN--------GRLASISN  811

Query  485  GC--IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVN  351
            G   +    N   E G +G  ++ ET+   V   DSP  N QL  VN
Sbjct  812  GVTIVNESNNSSNEPGQDGVLLSTETSGGFVNTKDSPVENAQLEAVN  858



>ref|XP_002522834.1| breast carcinoma amplified sequence, putative [Ricinus communis]
 gb|EEF39532.1| breast carcinoma amplified sequence, putative [Ricinus communis]
Length=891

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 115/200 (58%), Gaps = 9/200 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQP T LWA+PEIYFQ ++   I MD   A  GEIE+ER+PTRT+E
Sbjct  695  EKHHLYISEAELQMHQPHTALWAKPEIYFQPMMTEGIKMDGENAMLGEIEVERLPTRTIE  754

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVS--GKDNPINSNLGYPHCTTNG  483
            ARSKDLVPV++Y +  ++    +  N +     QRS +S  G+ +  +S+      T  G
Sbjct  755  ARSKDLVPVFDYHRYARVPA--LDNNINVQPQHQRSVLSENGRISCRSSSCSLDCMTDCG  812

Query  482  CIEPP-YNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNS---QISTQAKFVN  315
             +     NG+EE G N   M P      V ++D  K +T L  VN+    +   Q K VN
Sbjct  813  AVAAERRNGVEETGWNDSRM-PSEVMGYVNSSDGSKIDTPLDNVNSRDSLRTEAQLKLVN  871

Query  314  NDIDGLKMKNHFEGEVEEFD  255
            ++  G +M+NHFE E +EFD
Sbjct  872  SNNGGPRMENHFEDEGDEFD  891



>ref|XP_006370615.1| hypothetical protein POPTR_0001s44270g, partial [Populus trichocarpa]
 gb|ERP67184.1| hypothetical protein POPTR_0001s44270g, partial [Populus trichocarpa]
Length=794

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 97/163 (60%), Gaps = 7/163 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLWA+PEIYFQS++   I ++   A  GEIEIERIP R +E
Sbjct  621  EKHHLYISEAELQMHQACFPLWAKPEIYFQSMMTEGIDVNDADAMQGEIEIERIPARMIE  680

Query  656  ARSKDLVPVYNYLQAPKIQQQR---MFGNNDQLLHIQRSEVS--GKDNPINSNLGYPHCT  492
            ARSKDLVP+++YLQ PK    R   +  N++  L  Q S +S  G+ +  +S+       
Sbjct  681  ARSKDLVPLFDYLQTPKFPHSRVPSLDSNSNGSLQHQSSGLSENGRLSCRSSSGSLDSMA  740

Query  491  TNG-CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQ  366
             NG  +    NGIEE G NG  M P  T+  V +N SPK NT+
Sbjct  741  ENGAAVAELRNGIEETGWNGSRM-PVETRGFVDSNGSPKTNTE  782



>ref|XP_004151961.1| PREDICTED: autophagy-related protein 18f [Cucumis sativus]
 gb|KGN57966.1| hypothetical protein Csa_3G415110 [Cucumis sativus]
Length=907

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 112/200 (56%), Gaps = 14/200 (7%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH   TPLW +PEIYFQ +  + + +D     G E++IERIPTR +E
Sbjct  716  EQYHLYISEAELQMHAARTPLWTKPEIYFQVMARDGVKIDEIDHPG-ELDIERIPTRMIE  774

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF-GNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGC  480
            ARSKDLVPV++YLQ+ KI Q R    N+DQLL  Q+S           +   PH +  G 
Sbjct  775  ARSKDLVPVFDYLQSSKISQPRYLNSNSDQLLLQQKSGQFENGRQSWRSAANPHDSVVG-  833

Query  479  IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNS----QISTQAKFVNN  312
                 NG E  G +G     E TK IV   + P++ TQ   VN+      + +Q K VNN
Sbjct  834  -----NGREVTGRHGYKRVTE-TKGIVNEPECPRSQTQFSNVNSCTESISMESQPKSVNN  887

Query  311  -DIDGLKMKNHFEGEVEEFD  255
                GL+++NHFE   +EF+
Sbjct  888  HHKSGLRVENHFEDLGDEFE  907



>ref|XP_010267792.1| PREDICTED: autophagy-related protein 18f-like [Nelumbo nucifera]
 ref|XP_010267793.1| PREDICTED: autophagy-related protein 18f-like [Nelumbo nucifera]
Length=901

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 116/209 (56%), Gaps = 18/209 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   P+WA+PEIYFQ ++  D         GGEIEIE+ PTR +E
Sbjct  696  ERHHLYISEAELQMHQARIPMWAKPEIYFQ-VMMMDYKNIKESVLGGEIEIEQFPTRMIE  754

Query  656  ARSKDLVPVYNYLQAPKIQQQR---MFGNNDQLLHIQRSEVSGKDNPIN-----SNLGYP  501
            ARSKDLVPV+ +LQ PK Q+ R   +  N + LL  QRS +S +D  ++     S+L Y 
Sbjct  755  ARSKDLVPVFEHLQTPKFQETRVPALDSNCNVLLQNQRSRLS-EDGRVSCGSRHSSLDYV  813

Query  500  HCTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ-ISTQAK  324
               +    E P N  EEN   G  M+ E+T   V NN+  +    L FV+N + I T  +
Sbjct  814  SEGSIAATELP-NTNEENCWGGLQMSLESTAGFVNNNNMTEIKNGLEFVDNREKIETYLE  872

Query  323  FV------NNDIDGLKMKNHFEGEVEEFD  255
            FV       N+ + LKM+NH + +  E D
Sbjct  873  FVNNNKKKKNNKESLKMENHLKDDDGELD  901



>ref|XP_009624718.1| PREDICTED: autophagy-related protein 18f-like [Nicotiana tomentosiformis]
 ref|XP_009624726.1| PREDICTED: autophagy-related protein 18f-like [Nicotiana tomentosiformis]
Length=861

 Score =   124 bits (311),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 102/166 (61%), Gaps = 7/166 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH+P  PLWA+PE+YFQS+  + I +  +G CGGE E+E IPT  VE
Sbjct  692  EKHHIYISEAELQMHKPRNPLWAKPEVYFQSLDMDRIYV-VDG-CGGEAEVEVIPTHMVE  749

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQ-RSEVSGKDNPINSNLGYPHCTTNGC  480
            ARSK LVPV+N+LQA K QQ R+  ++D    +  R E+S +++ +  N G   C ++  
Sbjct  750  ARSKHLVPVFNHLQASKTQQGRLHVHSDNGQKLSPRPEIS-ENSKLTLNSG---CASSDG  805

Query  479  IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ  342
                 +   E   N   M    ++D + ++DSP+A T+L FVNN++
Sbjct  806  SSIELHHCRETACNSLRMTSHISRDFINSSDSPEAATRLDFVNNTR  851



>ref|XP_008775921.1| PREDICTED: autophagy-related protein 18f-like [Phoenix dactylifera]
Length=889

 Score =   123 bits (308),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 80/193 (41%), Positives = 108/193 (56%), Gaps = 17/193 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S  EL MH    PLWA+ EI FQ ++  +I  D +    GEIEIERIPTRT+E
Sbjct  699  ENHHLYISEVELQMHADRVPLWAKSEICFQVMMDENIKADDSYTSSGEIEIERIPTRTIE  758

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTT-NGC  480
            ARSKDL+PV++Y++ P+ QQ R    ND L+  Q+S +S       S+     C + N  
Sbjct  759  ARSKDLIPVFDYIRTPRFQQSR----NDLLVR-QKSGLSEGRLSCRSSCSSLDCMSENAA  813

Query  479  IEPPYNGIEENGSNGCW-MAPETTKDIVYNN--DSPKANTQLGFVNNSQ---ISTQAKFV  318
            +    NGI+ENG    W  +P    +   NN  DSP   + L FVN+S+   +  Q + V
Sbjct  814  VAELPNGIDENG----WSRSPAEPNEGFVNNHMDSPVMKSHLEFVNDSEGLKMEAQLESV  869

Query  317  NNDIDGLKMKNHF  279
            NN  D LK + HF
Sbjct  870  NNK-DNLKTETHF  881



>ref|XP_003596621.1| Autophagy-related protein [Medicago truncatula]
Length=914

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 104/189 (55%), Gaps = 16/189 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLW +PEIYF  +L     MD   A GGE EIERIPT  +E
Sbjct  699  EEHHLYISEAELQMHQTQIPLWVKPEIYFNPMLKESTIMDEEDASGGEFEIERIPTCMIE  758

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGN----NDQLLHIQRSEV--SGKDNP--INSNLGYP  501
            AR KDLVP++NY+QAPK+QQ R        N+Q+LH  RSE   +G+ +P  ++    Y 
Sbjct  759  ARPKDLVPIFNYMQAPKLQQTRAPAMDRKINEQVLH-HRSESYGNGRISPRSVSETPEYM  817

Query  500  HCTTNGCIEPPYNGIEENGSN-GCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----IS  336
            +      I    N IE  G+  G  + P  T   V NND+ K NTQ   VNN +    + 
Sbjct  818  NNYGGEVITEHENHIE--GTEWGNHVMPSETTGFVNNNDNLKPNTQHEIVNNRKEHLNMG  875

Query  335  TQAKFVNND  309
             Q   VN+D
Sbjct  876  AQLMLVNSD  884



>ref|XP_003596622.1| Autophagy-related protein [Medicago truncatula]
 gb|AES66873.1| breast carcinoma amplified sequence 3 protein [Medicago truncatula]
Length=901

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 104/189 (55%), Gaps = 16/189 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ   PLW +PEIYF  +L     MD   A GGE EIERIPT  +E
Sbjct  699  EEHHLYISEAELQMHQTQIPLWVKPEIYFNPMLKESTIMDEEDASGGEFEIERIPTCMIE  758

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGN----NDQLLHIQRSEV--SGKDNP--INSNLGYP  501
            AR KDLVP++NY+QAPK+QQ R        N+Q+LH  RSE   +G+ +P  ++    Y 
Sbjct  759  ARPKDLVPIFNYMQAPKLQQTRAPAMDRKINEQVLH-HRSESYGNGRISPRSVSETPEYM  817

Query  500  HCTTNGCIEPPYNGIEENGSN-GCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----IS  336
            +      I    N IE  G+  G  + P  T   V NND+ K NTQ   VNN +    + 
Sbjct  818  NNYGGEVITEHENHIE--GTEWGNHVMPSETTGFVNNNDNLKPNTQHEIVNNRKEHLNMG  875

Query  335  TQAKFVNND  309
             Q   VN+D
Sbjct  876  AQLMLVNSD  884



>ref|XP_004487612.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Cicer 
arietinum]
Length=899

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 107/205 (52%), Gaps = 14/205 (7%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MHQ   P WA+P+IYF S++     MD   A GGE EIERIPT   E
Sbjct  698  DGHHLYISEAELQMHQAQVPPWAKPKIYFNSMMKKSTIMDEEAASGGEFEIERIPTCMSE  757

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQL---LHIQRSEVSGKDN-PINSNLGYPHCTT  489
            AR KDLVP+ NY+Q PK QQ R    N ++   +  + S++SG       S LG P    
Sbjct  758  ARPKDLVPIVNYMQTPKSQQTRAPAMNSKINEQVSHRGSQLSGNGRISSRSILGSPEYMI  817

Query  488  NGCIEPPYNGIEENGSNGCW---MAPETTKDIVYNNDSPKANTQLGFVNN----SQISTQ  330
            N   E P +  +  G+   W   + P  T   V NND+ K NTQ   VNN    S +  Q
Sbjct  818  NSGGEVPEHKSQIEGTE--WYNHVMPSNTISSVNNNDNLKPNTQHEIVNNRREHSNMGAQ  875

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
               VN+ I   + + HFE   +EFD
Sbjct  876  LMHVNSHIRP-ENEQHFEENEDEFD  899



>ref|XP_007021083.1| Autophagy 18 F isoform 5, partial [Theobroma cacao]
 gb|EOY12608.1| Autophagy 18 F isoform 5, partial [Theobroma cacao]
Length=731

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ   PLWA+PEIYFQS++ + I M    A GGEIEIER+PTR +E
Sbjct  641  EKHNLYISEAELQMHQARMPLWAKPEIYFQSMVMDGIKMAEENAFGGEIEIERLPTRMIE  700

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            ARSKDLVPV++YLQ PK QQ R+
Sbjct  701  ARSKDLVPVFDYLQTPKFQQARI  723



>ref|XP_007021081.1| Autophagy 18 F isoform 3 [Theobroma cacao]
 gb|EOY12606.1| Autophagy 18 F isoform 3 [Theobroma cacao]
Length=683

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ   PLWA+PEIYFQS++ + I M    A GGEIEIER+PTR +E
Sbjct  571  EKHNLYISEAELQMHQARMPLWAKPEIYFQSMVMDGIKMAEENAFGGEIEIERLPTRMIE  630

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            ARSKDLVPV++YLQ PK QQ R 
Sbjct  631  ARSKDLVPVFDYLQTPKFQQARF  653



>ref|XP_006592506.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Glycine 
max]
Length=806

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 109/205 (53%), Gaps = 18/205 (9%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPVTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRT  663
            E +H +Y S AEL MHQ  TPLW +  IYF S+    I  MD   A GGE EI++IPTR 
Sbjct  609  EKEHQLYISEAELQMHQAKTPLWGKTGIYFHSVGKEAILMMDEEAASGGEFEIDKIPTRV  668

Query  662  VEARSKDLVPVYNYLQAPKIQQQRM--FGNNDQLLHIQRSEVSGKDNPINSNLGY---PH  498
            ++ARSKDLVP+++Y+Q  K QQ R    GN   +L+ Q    S  +N   S  G+   P 
Sbjct  669  IQARSKDLVPIFDYIQTSKFQQIRTPAVGN---VLYEQLLRQSSFENGRISTRGFLSSPD  725

Query  497  CTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
            C  N   +    G E   S    +    TK  V  N++ K NT     NN +    ++  
Sbjct  726  CIPNSEFKSMIEGSEWGDS----LLSAKTKAFVNKNNTLKPNTWPEIANNRRENLNMNAH  781

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
              FVN+D  GLK++NH + + +EFD
Sbjct  782  QIFVNSDRKGLKLENHCKEKGDEFD  806



>ref|XP_008454562.1| PREDICTED: LOW QUALITY PROTEIN: autophagy-related protein 18f 
[Cucumis melo]
Length=906

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 111/208 (53%), Gaps = 30/208 (14%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH   TPLW +PEIYFQ +  + + +D     G E++IERI TR VE
Sbjct  715  ERYHLYISEAELQMHAARTPLWTKPEIYFQVMGRDGVKIDEIDHPG-ELDIERITTRMVE  773

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF-GNNDQLLHIQRS--------EVSGKDNPINSNLGY  504
            ARSKDLVPV++YLQ+ KI Q R    ++DQLL  Q+S              NP +S  G 
Sbjct  774  ARSKDLVPVFDYLQSSKISQPRYLNSSSDQLLQQQKSGQFENGRQSWRSAANPQDSVFG-  832

Query  503  PHCTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNS----QIS  336
                         NG E  G +G  +  E TK IV   + P++ TQ   VN+      + 
Sbjct  833  -------------NGREVTGGHGYKVVTE-TKGIVNEPECPRSQTQFSNVNSCTESISME  878

Query  335  TQAKFVNNDIDG-LKMKNHFEGEVEEFD  255
            +Q K VNN     L+++NHFE   +EF+
Sbjct  879  SQPKSVNNHHKSVLEVENHFEDLGDEFE  906



>ref|XP_003541014.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Glycine 
max]
Length=900

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 109/205 (53%), Gaps = 18/205 (9%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPVTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRT  663
            E +H +Y S AEL MHQ  TPLW +  IYF S+    I  MD   A GGE EI++IPTR 
Sbjct  703  EKEHQLYISEAELQMHQAKTPLWGKTGIYFHSVGKEAILMMDEEAASGGEFEIDKIPTRV  762

Query  662  VEARSKDLVPVYNYLQAPKIQQQRM--FGNNDQLLHIQRSEVSGKDNPINSNLGY---PH  498
            ++ARSKDLVP+++Y+Q  K QQ R    GN   +L+ Q    S  +N   S  G+   P 
Sbjct  763  IQARSKDLVPIFDYIQTSKFQQIRTPAVGN---VLYEQLLRQSSFENGRISTRGFLSSPD  819

Query  497  CTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
            C  N   +    G E   S    +    TK  V  N++ K NT     NN +    ++  
Sbjct  820  CIPNSEFKSMIEGSEWGDS----LLSAKTKAFVNKNNTLKPNTWPEIANNRRENLNMNAH  875

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
              FVN+D  GLK++NH + + +EFD
Sbjct  876  QIFVNSDRKGLKLENHCKEKGDEFD  900



>gb|KHN36337.1| Breast carcinoma-amplified sequence 3 like [Glycine soja]
Length=900

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 109/205 (53%), Gaps = 18/205 (9%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPVTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRT  663
            E +H +Y S AEL MHQ  TPLW +  IYF S+    I  MD   A GGE EI++IPTR 
Sbjct  703  EKEHQLYISEAELQMHQAKTPLWGKTGIYFHSVGKEAILMMDEEAASGGEFEIDKIPTRV  762

Query  662  VEARSKDLVPVYNYLQAPKIQQQRM--FGNNDQLLHIQRSEVSGKDNPINSNLGY---PH  498
            ++ARSKDLVP+++Y+Q  K QQ R    GN   +L+ Q    S  +N   S  G+   P 
Sbjct  763  IQARSKDLVPIFDYIQTSKFQQIRTPAVGN---VLYEQLLRQSSFENGRISTRGFLSSPD  819

Query  497  CTTNGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ----ISTQ  330
            C  N   +    G E   S    +    TK  V  N++ K NT     NN +    ++  
Sbjct  820  CIPNSEFKSMIEGSEWGDS----LLSAKTKAFVNKNNTLKPNTWPEIANNRRENLNMNAH  875

Query  329  AKFVNNDIDGLKMKNHFEGEVEEFD  255
              FVN+D  GLK++NH + + +EFD
Sbjct  876  QIFVNSDRKGLKLENHCKEKGDEFD  900



>ref|XP_009794099.1| PREDICTED: autophagy-related protein 18f-like [Nicotiana sylvestris]
Length=861

 Score =   115 bits (288),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 17/171 (10%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH+P  PLWA+PE++FQS + + I +  +G CGGE E+E I T  VE
Sbjct  692  EKHHIYISEAELQMHKPQNPLWAKPEVFFQSFVRDRIYV-VDG-CGGEAEVEVIATHMVE  749

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQ-RSEVSGKDNPINSNLGYPHCTTNGC  480
            ARSK L PV+N+LQA K QQ R+  ++D    +  R EVS      NS L       +GC
Sbjct  750  ARSKHLYPVFNHLQASKTQQGRLHVHSDNGQKLSPRPEVSE-----NSKL----MLNSGC  800

Query  479  IEPPYNGIE-----ENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ  342
                 + IE     E   N   M    ++D + + DSP+A T+L FVNN++
Sbjct  801  ASIDGSSIELHHCRETACNSLRMTSHKSRDFINSRDSPEAATRLDFVNNTR  851



>ref|XP_011030885.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Populus 
euphratica]
Length=770

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AELHMHQP  PLWA+PEIYFQS++   I +D   A  GEIEIERIPTR +E
Sbjct  689  EKHYLYISEAELHMHQPRFPLWAKPEIYFQSMMTEGIKVDDADALQGEIEIERIPTRMIE  748

Query  656  ARSKDLVPVYNYLQAPKIQQQR  591
            ARSKDLVP+++YLQ PK    R
Sbjct  749  ARSKDLVPLFDYLQTPKFLHTR  770



>ref|XP_007132977.1| hypothetical protein PHAVU_011G140900g [Phaseolus vulgaris]
 gb|ESW04971.1| hypothetical protein PHAVU_011G140900g [Phaseolus vulgaris]
Length=925

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 112/204 (55%), Gaps = 16/204 (8%)
 Frame = -3

Query  830  QHMYXSXAELHMHQPVTPLWARPEIYFQSILFND-ISMDANGACGGEIEIERIPTRTVEA  654
             H+Y S AEL MH+  TPLWA+ EIYF S+   D + MD   A GGE EIE+IPTR +EA
Sbjct  726  HHLYISEAELQMHEAKTPLWAKTEIYFHSVAKEDTLMMDEKAASGGEFEIEKIPTRVIEA  785

Query  653  RSKDLVPVYNYLQAPKIQQQRMFGNNDQL----LHIQRSEV--SGKDNPINSNLGYPHCT  492
            R KDLVP+ +++Q  K Q  R     ++L    LH Q S++   G+ +P + +   P C 
Sbjct  786  RLKDLVPILDFIQTSKFQYTRTPAVENKLNAPFLH-QNSKLFEKGRISPGSRS---PGCM  841

Query  491  TN-GCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNS----QISTQA  327
            TN G     +NG  E         P   + +V NN++ K +T+   VNN     ++    
Sbjct  842  TNSGGNIAEFNGGFEGNEWDEGSIPAEAEGLVNNNNTLKPDTRPETVNNRRGHIEMDVHH  901

Query  326  KFVNNDIDGLKMKNHFEGEVEEFD  255
             FVN+D  GLK++N  E +  +FD
Sbjct  902  MFVNSDRKGLKLENPHEEKEGDFD  925



>gb|KJB13576.1| hypothetical protein B456_002G082200 [Gossypium raimondii]
Length=833

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MH+   PLWA+PEIYFQS++ + I M    A GGEIEIE    +T+E
Sbjct  689  EKHNLYISEAELQMHEARMPLWAKPEIYFQSMVMDGIKMAEGNAFGGEIEIENFSAQTIE  748

Query  656  ARSKDLVPVYNYLQAPKIQQQRM---FGNNDQLLHIQRSEV--SGKDNPINSNLGYPHCT  492
            ARSK+LVPV++Y+Q PK QQ  +   + NN+  L  QRSE+   G+ +  +++      T
Sbjct  749  ARSKNLVPVFDYVQTPKFQQTSIPTVYSNNNGCLLHQRSELPEDGRLSCRSTSGSLDFMT  808

Query  491  TNG-CIEPPYNGIEENGSNGCWM  426
             NG  +   + GI+E G NG  M
Sbjct  809  ENGAAVAELHTGIKETGLNGTNM  831



>gb|KJB13574.1| hypothetical protein B456_002G082200 [Gossypium raimondii]
Length=827

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 87/140 (62%), Gaps = 6/140 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MH+   PLWA+PEIYFQS++ + I M    A GGEIEIE    +T+E
Sbjct  689  EKHNLYISEAELQMHEARMPLWAKPEIYFQSMVMDGIKMAEGNAFGGEIEIENFSAQTIE  748

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEV--SGKDNPINSNLGYPHCTTNG  483
            ARSK+LVPV++Y+Q PK QQ     NN  LLH QRSE+   G+ +  +++      T NG
Sbjct  749  ARSKNLVPVFDYVQTPKFQQTS--NNNGCLLH-QRSELPEDGRLSCRSTSGSLDFMTENG  805

Query  482  -CIEPPYNGIEENGSNGCWM  426
              +   + GI+E G NG  M
Sbjct  806  AAVAELHTGIKETGLNGTNM  825



>ref|XP_011095317.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Sesamum 
indicum]
Length=789

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   MY S AELHMHQ   PLWAR EIYFQS+L +  +MD  GAC GE EIER+P R +E
Sbjct  700  EKNQMYISEAELHMHQNQNPLWARSEIYFQSMLTDGSNMDEEGACNGETEIERVPIRMLE  759

Query  656  ARSKDLVPVYNYLQAPKIQQQR  591
            ARSKDLVPV++Y+ APK Q  R
Sbjct  760  ARSKDLVPVFDYIHAPKYQWGR  781



>ref|XP_010931238.1| PREDICTED: autophagy-related protein 18f-like [Elaeis guineensis]
Length=890

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 107/200 (54%), Gaps = 17/200 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S  EL MH    PLWA+ EI FQ +   +I  D +    GEIEIERIPTRT+E
Sbjct  700  ENYHLYISEVELQMHADRIPLWAKSEICFQVMTDENIKADNSNTSSGEIEIERIPTRTIE  759

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTT-NGC  480
            ARSKDL+PV++Y++ P+ QQ R    N  LL  Q+S +S       S+     C + N  
Sbjct  760  ARSKDLIPVFDYIRTPRFQQSR----NGPLLR-QKSGLSEGRLSSRSSCSSLECMSENAA  814

Query  479  IEPPYNGIEENGSNGCW--MAPETTKDIVYNN-DSPKANTQLGFVNNSQ---ISTQAKFV  318
            +    NG +ENG    W   + E  +  V N+ DSP   + L FVN+S+   +  Q + V
Sbjct  815  LTELPNGTDENG----WSRSSAEANEGFVNNHMDSPVLKSHLEFVNDSEGLNMEAQLESV  870

Query  317  NNDIDGLKMKNHFEGEVEEF  258
            NN  + LK +  F     +F
Sbjct  871  NNK-ENLKTETQFSDYDNDF  889



>ref|XP_008800488.1| PREDICTED: autophagy-related protein 18h-like isoform X2 [Phoenix 
dactylifera]
Length=890

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 104/192 (54%), Gaps = 12/192 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH    PLWA+ EI FQ ++  +I  D +    GEIEIERIPTRT+E
Sbjct  699  ENHHLYISEAELQMHADHVPLWAKSEICFQVMMDQNIKADNSNMLSGEIEIERIPTRTIE  758

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTT-NGC  480
            +RS DL+PV++Y+Q  + +Q R    N  LL  +     G      S+     C + N  
Sbjct  759  SRSNDLIPVFDYIQTCRCRQSR----NSPLLCQKSGPAEGGMLSCRSSCCLLDCMSENTA  814

Query  479  IEPPYNGIEENGSNGCWMAPETTKDIVYNN--DSPKANTQLGFVNNSQ-ISTQAKFVNND  309
            +    N I++NG N    + E  K+   NN  DS    +QL FVN S+ +  +A+F + D
Sbjct  815  VTELPNAIDKNGRN---QSSEEFKEGFVNNHMDSSNMKSQLDFVNYSEGLKMEAQFESVD  871

Query  308  -IDGLKMKNHFE  276
              + LK + HFE
Sbjct  872  NKENLKTETHFE  883



>ref|XP_008800486.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Phoenix 
dactylifera]
Length=898

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 105/196 (54%), Gaps = 12/196 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH    PLWA+ EI FQ ++  +I  D +    GEIEIERIPTRT+E
Sbjct  699  ENHHLYISEAELQMHADHVPLWAKSEICFQVMMDQNIKADNSNMLSGEIEIERIPTRTIE  758

Query  656  ARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTT  489
            +RS DL+PV++Y+Q  + +Q R+       N  LL  +     G      S+     C +
Sbjct  759  SRSNDLIPVFDYIQTCRCRQSRVNSFDMNRNSPLLCQKSGPAEGGMLSCRSSCCLLDCMS  818

Query  488  -NGCIEPPYNGIEENGSNGCWMAPETTKDIVYNN--DSPKANTQLGFVNNSQ-ISTQAKF  321
             N  +    N I++NG N    + E  K+   NN  DS    +QL FVN S+ +  +A+F
Sbjct  819  ENTAVTELPNAIDKNGRN---QSSEEFKEGFVNNHMDSSNMKSQLDFVNYSEGLKMEAQF  875

Query  320  VNND-IDGLKMKNHFE  276
             + D  + LK + HFE
Sbjct  876  ESVDNKENLKTETHFE  891



>ref|XP_010062964.1| PREDICTED: autophagy-related protein 18f [Eucalyptus grandis]
 gb|KCW70126.1| hypothetical protein EUGRSUZ_F03423 [Eucalyptus grandis]
Length=910

 Score =   108 bits (271),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 108/201 (54%), Gaps = 13/201 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AEL MHQ   P WA+P I FQ +L  D+S     A  GEIEIE+I T  +E
Sbjct  716  EKHHFYISEAELQMHQAQIPSWAKPGIIFQVMLAEDVSSYEENASEGEIEIEKISTHVIE  775

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVSGKDN-PINSNLGYPHCTT  489
            ARSKDLVPV++YLQ  K Q  RM     N++  +  Q S +S + +    S+L       
Sbjct  776  ARSKDLVPVFDYLQMSKNQHARMVNTNSNSNGRVQYQPSALSERGSFSCRSSL-----KG  830

Query  488  NGCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ---ISTQAKFV  318
            +G      + IEE    G  M P+ +K+ V +N S    T+   VN  +   +    + V
Sbjct  831  SGFAVAQQDRIEETALYGLMM-PKESKEFVNSNVSMNPETRPETVNKREGMNLEDPLENV  889

Query  317  NNDIDGLKMKNHFEGEVEEFD  255
            N++ +GL+M+N+FE E +E D
Sbjct  890  NSNKEGLRMENNFEDEGDELD  910



>gb|KHN27976.1| Breast carcinoma-amplified sequence 3 like [Glycine soja]
Length=913

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 104/188 (55%), Gaps = 14/188 (7%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGAC-GGEIEIERIPTRTV  660
            E   +Y S AEL MH+  T LWA+PEIYF S+L     MD   A  GGE EIE +PT  +
Sbjct  719  EEHLLYISEAELQMHEAQTSLWAKPEIYFHSMLQESTIMDEEAAASGGEFEIESMPTCMI  778

Query  659  EARSKDLVPVYNYLQAPKIQQQRM----FGNNDQLLH-IQRSEVSGKDNPINSNLGYPHC  495
            EARSKDLVP+++++Q PK+ Q R        N+QLLH   R   +G+ +P  + L  P  
Sbjct  779  EARSKDLVPIFDHIQTPKVPQTRTPAMDSKTNEQLLHRSSRLAGNGRISP-RTILESPES  837

Query  494  TTNG--CIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNN--SQISTQA  327
             T     +    +GIE    +   +A ET  + V NND+ + NTQ   VNN    ++T A
Sbjct  838  VTKAGDAVSEFRSGIEGTEWDNHLVASETL-NFVNNNDTFRPNTQHEIVNNRMEHLNTGA  896

Query  326  K--FVNND  309
               +VN+D
Sbjct  897  HLMYVNSD  904



>gb|KHG21819.1| Breast carcinoma-amplified sequence 3 [Gossypium arboreum]
Length=833

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 84/140 (60%), Gaps = 6/140 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MH+   PLWA+PEIYFQS++ + I M    A GGEIEIE    + +E
Sbjct  689  EKHNLYISEAELQMHEARMPLWAKPEIYFQSMVMDGIKMAEENASGGEIEIENFSAQMIE  748

Query  656  ARSKDLVPVYNYLQAPKIQQQRM---FGNNDQLLHIQRSEV--SGKDNPINSNLGYPHCT  492
            ARSK LVPV++Y+Q PK  Q  +   + NN+  L  QRS +  +G+ +  +S+      T
Sbjct  749  ARSKSLVPVFDYVQTPKFPQTSIPTVYTNNNGCLLHQRSGLPENGRLSCRSSSGSLDFMT  808

Query  491  TNG-CIEPPYNGIEENGSNG  435
             NG  +   + GI+E G NG
Sbjct  809  ENGAAVAELHTGIQETGLNG  828



>gb|KJB13575.1| hypothetical protein B456_002G082200 [Gossypium raimondii]
Length=791

 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MH+   PLWA+PEIYFQS++ + I M    A GGEIEIE    +T+E
Sbjct  689  EKHNLYISEAELQMHEARMPLWAKPEIYFQSMVMDGIKMAEGNAFGGEIEIENFSAQTIE  748

Query  656  ARSKDLVPVYNYLQAPKIQQQR  591
            ARSK+LVPV++Y+Q PK QQ R
Sbjct  749  ARSKNLVPVFDYVQTPKFQQTR  770



>ref|XP_010908141.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Elaeis 
guineensis]
Length=895

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 105/193 (54%), Gaps = 14/193 (7%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S  EL MH    PLWA+ EI FQ ++  +I  D +    GEIEIERIPT T+E
Sbjct  701  ENHHLYVSEVELQMHTDHVPLWAKSEIRFQVMMDENIKADNSNMLSGEIEIERIPTCTIE  760

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVS--GKDNPINSNLGYPHCTTNG  483
            +RSKDL+PV++Y+Q  + QQ R     +  L  Q+  ++  G+ +  +S         N 
Sbjct  761  SRSKDLIPVFDYIQTSRFQQSR-----NGPLPCQKCGLAEEGRLSCRSSCCSLDSMPENA  815

Query  482  CIEPPYNGIEENGSNGCWMAPETTKDIVYNN-DSPKANTQLGFVNNSQ---ISTQAKFVN  315
             +    N I++N  +    + E  +  V N+ +SP   TQL FVN S+   +  Q + V+
Sbjct  816  AVTEIPNAIDKNDRHQS--SAEAKEGFVNNHMNSPNMKTQLEFVNYSEGLKMEAQLESVD  873

Query  314  NDIDGLKMKNHFE  276
            N  + LKM+ HFE
Sbjct  874  NKKN-LKMEPHFE  885



>ref|XP_010908142.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Elaeis 
guineensis]
Length=892

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 105/193 (54%), Gaps = 14/193 (7%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S  EL MH    PLWA+ EI FQ ++  +I  D +    GEIEIERIPT T+E
Sbjct  698  ENHHLYVSEVELQMHTDHVPLWAKSEIRFQVMMDENIKADNSNMLSGEIEIERIPTCTIE  757

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVS--GKDNPINSNLGYPHCTTNG  483
            +RSKDL+PV++Y+Q  + QQ R     +  L  Q+  ++  G+ +  +S         N 
Sbjct  758  SRSKDLIPVFDYIQTSRFQQSR-----NGPLPCQKCGLAEEGRLSCRSSCCSLDSMPENA  812

Query  482  CIEPPYNGIEENGSNGCWMAPETTKDIVYNN-DSPKANTQLGFVNNSQ---ISTQAKFVN  315
             +    N I++N  +    + E  +  V N+ +SP   TQL FVN S+   +  Q + V+
Sbjct  813  AVTEIPNAIDKNDRHQS--SAEAKEGFVNNHMNSPNMKTQLEFVNYSEGLKMEAQLESVD  870

Query  314  NDIDGLKMKNHFE  276
            N  + LKM+ HFE
Sbjct  871  NKKN-LKMEPHFE  882



>gb|KJB45596.1| hypothetical protein B456_007G314600 [Gossypium raimondii]
Length=773

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  ++Y S AEL MHQ  TPLWA+PEIYFQS+L +DI+M    A  GEIEIE + TR   
Sbjct  688  EKHNLYISEAELQMHQAQTPLWAKPEIYFQSMLMDDINMADENAFVGEIEIEMLLTRMTG  747

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF  585
             R K LVPV++YLQ+ K QQ R F
Sbjct  748  TRKKSLVPVFDYLQSFKFQQARWF  771



>ref|XP_004487613.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Cicer 
arietinum]
Length=784

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MHQ   P WA+P+IYF S++     MD   A GGE EIERIPT   E
Sbjct  698  DGHHLYISEAELQMHQAQVPPWAKPKIYFNSMMKKSTIMDEEAASGGEFEIERIPTCMSE  757

Query  656  ARSKDLVPVYNYLQAPKIQQQR  591
            AR KDLVP+ NY+Q PK QQ R
Sbjct  758  ARPKDLVPIVNYMQTPKSQQTR  779



>ref|XP_007149695.1| hypothetical protein PHAVU_005G091300g [Phaseolus vulgaris]
 gb|ESW21689.1| hypothetical protein PHAVU_005G091300g [Phaseolus vulgaris]
Length=889

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 99/183 (54%), Gaps = 17/183 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MHQ  T LW++PEIYF S+L  + +++A     GE EIE+IPT  +E
Sbjct  710  EKHHLYISEAELQMHQAQTSLWSKPEIYFHSML-QEPNIEA--PSEGEFEIEKIPTCVIE  766

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTN  486
            ARSKDLVP+ +Y Q+P +QQ R       +DQL H       G     N  +        
Sbjct  767  ARSKDLVPIVDYFQSPNLQQTRTSIDRKRDDQLSH------HGLRPSGNGRISSRTDDDG  820

Query  485  GCIEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNNSQ--ISTQAK--FV  318
              +    +GIE    +   M P  T   V N+D+ K NTQ   VNN +  ++T+A+  FV
Sbjct  821  DALSEFKSGIEGTEWDNHVM-PSETVSFVNNSDTFKPNTQHEIVNNRREHLNTEAQLMFV  879

Query  317  NND  309
            N+D
Sbjct  880  NSD  882



>ref|XP_010694257.1| PREDICTED: autophagy-related protein 18f isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=864

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 90/187 (48%), Gaps = 29/187 (16%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+   PLWARPEIYFQS++ + I +D     GGE+EIERIP RT E
Sbjct  679  ERNQLYISEAELQMHEQQVPLWARPEIYFQSMMNDAIKVDGENT-GGEMEIERIPVRTFE  737

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCI  477
            ARS+DLVPV +Y+  PK                  S V+  D+   S      C      
Sbjct  738  ARSRDLVPVSDYVDTPKPLPASF----------SLSRVAAADSKFESQQLRQLCKV----  783

Query  476  EPPYNGIEENGSNGCWMAP------ETTKDIVYNNDSPK--ANTQLGFVNNS----QIST  333
              P +G    GS    ++P      E    I  N D  +   +  LG+VN +    ++S+
Sbjct  784  --PQDGTLSTGSKAHALSPLTDIGVELILGIGENKDGSRNLTDATLGYVNTNDCPERLSS  841

Query  332  QAKFVNN  312
            +   VNN
Sbjct  842  ELDIVNN  848



>ref|XP_010694259.1| PREDICTED: autophagy-related protein 18f isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=859

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 90/187 (48%), Gaps = 34/187 (18%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+   PLWARPEIYFQS++ + I +D     GGE+EIERIP RT E
Sbjct  679  ERNQLYISEAELQMHEQQVPLWARPEIYFQSMMNDAIKVDGENT-GGEMEIERIPVRTFE  737

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCI  477
            ARS+DLVPV +Y+  PK    R               V+  D+   S      C      
Sbjct  738  ARSRDLVPVSDYVDTPKPLPAR---------------VAAADSKFESQQLRQLCKV----  778

Query  476  EPPYNGIEENGSNGCWMAP------ETTKDIVYNNDSPK--ANTQLGFVNNS----QIST  333
              P +G    GS    ++P      E    I  N D  +   +  LG+VN +    ++S+
Sbjct  779  --PQDGTLSTGSKAHALSPLTDIGVELILGIGENKDGSRNLTDATLGYVNTNDCPERLSS  836

Query  332  QAKFVNN  312
            +   VNN
Sbjct  837  ELDIVNN  843



>ref|XP_010908143.1| PREDICTED: autophagy-related protein 18f-like isoform X3 [Elaeis 
guineensis]
Length=839

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S  EL MH    PLWA+ EI FQ ++  +I  D +    GEIEIERIPT T+E
Sbjct  701  ENHHLYVSEVELQMHTDHVPLWAKSEIRFQVMMDENIKADNSNMLSGEIEIERIPTCTIE  760

Query  656  ARSKDLVPVYNYLQAPKIQQQR  591
            +RSKDL+PV++Y+Q  + QQ R
Sbjct  761  SRSKDLIPVFDYIQTSRFQQSR  782



>gb|EPS70907.1| hypothetical protein M569_03850, partial [Genlisea aurea]
Length=701

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  HMY S AEL MHQ   PLW R EIY+Q +L +   ++   + GGEIE+E++P   +E
Sbjct  623  EKYHMYISEAELQMHQNTNPLWLRSEIYYQLMLADPFDVE-EASVGGEIEVEKLPIHKLE  681

Query  656  ARSKDLVPVYNYLQAPKIQQ  597
            ARSKDL+PVYNY+Q P  QQ
Sbjct  682  ARSKDLIPVYNYVQTPLFQQ  701



>ref|XP_008800489.1| PREDICTED: autophagy-related protein 18f-like isoform X3 [Phoenix 
dactylifera]
Length=796

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH    PLWA+ EI FQ ++  +I  D +    GEIEIERIPTRT+E
Sbjct  699  ENHHLYISEAELQMHADHVPLWAKSEICFQVMMDQNIKADNSNMLSGEIEIERIPTRTIE  758

Query  656  ARSKDLVPVYNYLQAPKIQQQR  591
            +RS DL+PV++Y+Q  + +Q R
Sbjct  759  SRSNDLIPVFDYIQTCRCRQSR  780



>gb|EYU33601.1| hypothetical protein MIMGU_mgv1a003709mg [Erythranthe guttata]
Length=568

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 99/202 (49%), Gaps = 46/202 (23%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E    Y S AEL MH+   PLW RPE+YFQS++      + +    GEIEIER+  RT+E
Sbjct  405  EKHKKYISEAELQMHRNPNPLWGRPEVYFQSMV-----SEGSNVNEGEIEIERVAIRTLE  459

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCI  477
            ARSKDLVPVY+YLQ    QQ R +  N +                           NG I
Sbjct  460  ARSKDLVPVYDYLQ---FQQGRSYVKNSE--------------------------KNGRI  490

Query  476  EPPYNGIEENGSNGCWMAPETTK--DIVYNNDSPKANTQLGFV------NNSQISTQAKF  321
            +P  +G E   S+G  +  ET++   +  N+ S   NT++  V       NS   +Q + 
Sbjct  491  QPQGSGSE---SDGVDLLGETSRGSSVNTNDRSTMKNTRVASVVNTTTRENSVRESQIRS  547

Query  320  VNNDIDGLKMKNHFEGEVEEFD  255
            V+N  DG    ++   EV++FD
Sbjct  548  VHNR-DGSNNMDNESAEVDQFD  568



>ref|XP_006592885.1| PREDICTED: autophagy-related protein 18f-like [Glycine max]
Length=809

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGAC-GGEIEIERIPTRTV  660
            E   +Y S AEL MH+  T LWA+P IYF S+L     MD   A  GGE EIE +PT  +
Sbjct  719  EEHLLYISEAELQMHEAQTSLWAKPVIYFHSMLQESTIMDEEAAASGGEFEIESMPTCMI  778

Query  659  EARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHI  558
            EARSKDLVP+++++Q PK+ Q R   +ND L+  
Sbjct  779  EARSKDLVPIFDHIQTPKVPQTR---SNDNLIQF  809



>gb|ERN10464.1| hypothetical protein AMTR_s01464p00006980, partial [Amborella 
trichopoda]
Length=640

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH   TP+W RPE+YFQ  L +++ M+       EIEIER+PTRT+E
Sbjct  560  EKHHLYISNAELQMHHAQTPIWVRPEMYFQVFLMDNVRMEKLNDLYEEIEIERVPTRTIE  619

Query  656  ARSKDLVPVYNYLQAPKI  603
            ARSKDLVPV + L   K 
Sbjct  620  ARSKDLVPVIDSLPDSKF  637



>ref|XP_011625098.1| PREDICTED: LOW QUALITY PROTEIN: autophagy-related protein 18f, 
partial [Amborella trichopoda]
Length=699

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH   TP+W RPE+YFQ  L +++ M+       EIEIER+PTRT+E
Sbjct  619  EKHHLYISNAELQMHHAQTPIWVRPEMYFQVFLMDNVRMEKLNDLYEEIEIERVPTRTIE  678

Query  656  ARSKDLVPVYNYLQAPKIQ  600
            ARSKDLVPV + L   K  
Sbjct  679  ARSKDLVPVIDSLPDSKFS  697



>ref|XP_011621063.1| PREDICTED: autophagy-related protein 18f [Amborella trichopoda]
Length=805

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH   TP+W RPE+YFQ  L +++ M+       EIEIER+PTRT+E
Sbjct  653  EKHHLYISNAELQMHHAQTPIWVRPEMYFQVFLMDNVRMENLNDLYEEIEIERVPTRTIE  712

Query  656  ARSKDLVPVYNYLQAPKIQQQR  591
            ARSKDLVPV + L   K    R
Sbjct  713  ARSKDLVPVIDSLPNSKFSGFR  734



>gb|ERM99845.1| hypothetical protein AMTR_s00098p00100110, partial [Amborella 
trichopoda]
Length=700

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H+Y S AEL MH   TP+W RPE+YFQ  L +++ M+       EIEIER+PTRT+E
Sbjct  620  EKHHLYISNAELQMHHAQTPIWVRPEMYFQVFLMDNVRMENLNDLYEEIEIERVPTRTIE  679

Query  656  ARSKDLVPVYNYL  618
            ARSKDLVPV + L
Sbjct  680  ARSKDLVPVIDSL  692



>ref|XP_009402870.1| PREDICTED: autophagy-related protein 18f-like [Musa acuminata 
subsp. malaccensis]
Length=892

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 98/193 (51%), Gaps = 21/193 (11%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S  ELH+H+  TPLWA+ E+ FQ ++  +I    +    GEIEIE+I + T+E
Sbjct  693  ETHHAYLSEVELHVHEACTPLWAKSEVCFQVMIDENIKEHYSSNIHGEIEIEKITSCTIE  752

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGN-NDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGC  480
             RSKDL+PV++YLQ P  QQ R   +  ++L  I R +         S L      ++  
Sbjct  753  TRSKDLIPVFDYLQTPMFQQPRTTASVVNKLGSIPRQK---------SGLLESGRLSHRS  803

Query  479  IEPPYNGIEENGSNGCWMAPETTKDIVYNNDSPK-ANTQLGFVNNSQ----ISTQAKFVN  315
                 + I +N +    MA E   DI  N+ S   AN   GFV+N+     I  Q KFVN
Sbjct  804  SSSSLDCISDNAT----MA-ELPNDISGNDWSRSFANANKGFVHNTTNSQNIRGQLKFVN  858

Query  314  NDIDGLKMKNHFE  276
               D LK++   E
Sbjct  859  GS-DDLKLEAQLE  870



>ref|XP_006475223.1| PREDICTED: autophagy-related protein 18f-like isoform X4 [Citrus 
sinensis]
Length=790

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PTR VE
Sbjct  720  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTRMVE  779

Query  656  ARSKDL  639
            ARSKDL
Sbjct  780  ARSKDL  785



>ref|XP_006363524.1| PREDICTED: autophagy-related protein 18f-like isoform X2 [Solanum 
tuberosum]
Length=826

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 101/195 (52%), Gaps = 23/195 (12%)
 Frame = -3

Query  830  QHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVEAR  651
             H+Y S AEL MH+P   +WA+PE++F+S + + I +D  G  GGE EIE IPT  VEAR
Sbjct  647  HHIYISEAELQMHRPHNQVWAKPEVFFRSFVMDRIHLDDEG--GGEAEIEVIPTHIVEAR  704

Query  650  SKDLVPVY-NYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCIE  474
            SK L PVY ++LQA K       G   Q L     EVS + N +  N G   C++    E
Sbjct  705  SKHLFPVYCHHLQASK------SGKASQQLR-PSPEVS-ESNKLKLNSGC-ECSSLSMDE  755

Query  473  PP---YNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNN---SQISTQAKFVNN  312
                 ++G  E   +      +T    V ++D    N+ + +VN+   +  +TQ+KFVN 
Sbjct  756  SSIELHHG-RETVRDSVGAICQTASAFVNSSD----NSSIDYVNDIRSTMETTQSKFVNT  810

Query  311  DIDGLKMKNHFEGEV  267
            ++   K   H E E 
Sbjct  811  NLGVTKTVTHLEDEA  825



>ref|XP_006363523.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Solanum 
tuberosum]
Length=869

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 101/195 (52%), Gaps = 23/195 (12%)
 Frame = -3

Query  830  QHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVEAR  651
             H+Y S AEL MH+P   +WA+PE++F+S + + I +D  G  GGE EIE IPT  VEAR
Sbjct  690  HHIYISEAELQMHRPHNQVWAKPEVFFRSFVMDRIHLDDEG--GGEAEIEVIPTHIVEAR  747

Query  650  SKDLVPVY-NYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCIE  474
            SK L PVY ++LQA K       G   Q L     EVS + N +  N G   C++    E
Sbjct  748  SKHLFPVYCHHLQASK------SGKASQQLR-PSPEVS-ESNKLKLNSGC-ECSSLSMDE  798

Query  473  PP---YNGIEENGSNGCWMAPETTKDIVYNNDSPKANTQLGFVNN---SQISTQAKFVNN  312
                 ++G  E   +      +T    V ++D    N+ + +VN+   +  +TQ+KFVN 
Sbjct  799  SSIELHHG-RETVRDSVGAICQTASAFVNSSD----NSSIDYVNDIRSTMETTQSKFVNT  853

Query  311  DIDGLKMKNHFEGEV  267
            ++   K   H E E 
Sbjct  854  NLGVTKTVTHLEDEA  868



>gb|KDO52934.1| hypothetical protein CISIN_1g002446mg [Citrus sinensis]
Length=701

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  H+Y S AEL MH P  PLWA+P+IYFQS++  D  M       GEIEIER PTR +E
Sbjct  631  DKHHLYISEAELQMHPPRIPLWAKPQIYFQSMMIKDFKMGEENFLKGEIEIERFPTRMIE  690

Query  656  ARSKDL  639
            ARSKDL
Sbjct  691  ARSKDL  696



>ref|XP_010539276.1| PREDICTED: autophagy-related protein 18f isoform X2 [Tarenaya 
hassleriana]
Length=773

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = -3

Query  827  HMYXSXAELHMHQP-VTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRTVEA  654
             +Y S AEL  HQP   PLWA+P++ FQS+    + ++D   A  GEI++ERI T  +EA
Sbjct  640  RLYISEAELLTHQPRCPPLWAKPKVSFQSVALKGVVALDKENATKGEIDVERIRTCLIEA  699

Query  653  RSKDLVPVYNYLQAPKIQQQRMFGNN  576
            RSK LVPV+NY+Q  K +Q R+F ++
Sbjct  700  RSKHLVPVFNYIQPVKFRQLRVFASD  725



>ref|XP_006644820.1| PREDICTED: autophagy-related protein 18g-like isoform X2 [Oryza 
brachyantha]
Length=845

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 84/175 (48%), Gaps = 10/175 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  + Y S +EL  H   TPLW+R  ++FQ +    +  D+ G   GEIEIE++ TR +E
Sbjct  660  DNHNFYISESELQTHVVPTPLWSRSGMHFQVMGDGTLEADSTGTISGEIEIEKVQTRNIE  719

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS-GKDNPINSNLGYPHCTT  489
            +RSK+L+PV+  L A + QQ R+     N   LL  Q+S  S        S+     C +
Sbjct  720  SRSKNLIPVFESLHASRFQQTRVSTPDSNRYGLLQRQKSGFSEDGRLSCRSSCSSLDCMS  779

Query  488  NGCIEPPYNG----IEENGSNGCWMAPETT--KDIVYNNDSPKANTQLGFVNNSQ  342
             G I    NG    + E+        P      ++V N  S     QLGFVNN +
Sbjct  780  EGPISTDDNGFGQCLVEDSGGAVNKDPNVNARSELVNNTQSLNTEAQLGFVNNKE  834



>ref|XP_006644819.1| PREDICTED: autophagy-related protein 18g-like isoform X1 [Oryza 
brachyantha]
Length=794

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 84/175 (48%), Gaps = 10/175 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            +  + Y S +EL  H   TPLW+R  ++FQ +    +  D+ G   GEIEIE++ TR +E
Sbjct  609  DNHNFYISESELQTHVVPTPLWSRSGMHFQVMGDGTLEADSTGTISGEIEIEKVQTRNIE  668

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS-GKDNPINSNLGYPHCTT  489
            +RSK+L+PV+  L A + QQ R+     N   LL  Q+S  S        S+     C +
Sbjct  669  SRSKNLIPVFESLHASRFQQTRVSTPDSNRYGLLQRQKSGFSEDGRLSCRSSCSSLDCMS  728

Query  488  NGCIEPPYNG----IEENGSNGCWMAPETT--KDIVYNNDSPKANTQLGFVNNSQ  342
             G I    NG    + E+        P      ++V N  S     QLGFVNN +
Sbjct  729  EGPISTDDNGFGQCLVEDSGGAVNKDPNVNARSELVNNTQSLNTEAQLGFVNNKE  783



>ref|XP_010694260.1| PREDICTED: autophagy-related protein 18f isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=855

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 86/187 (46%), Gaps = 38/187 (20%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+   PLWARPE    S++ + I +D     GGE+EIERIP RT E
Sbjct  679  ERNQLYISEAELQMHEQQVPLWARPE----SMMNDAIKVDGENT-GGEMEIERIPVRTFE  733

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCI  477
            ARS+DLVPV +Y+  PK    R               V+  D+   S      C      
Sbjct  734  ARSRDLVPVSDYVDTPKPLPAR---------------VAAADSKFESQQLRQLCKV----  774

Query  476  EPPYNGIEENGSNGCWMAP------ETTKDIVYNNDSPK--ANTQLGFVNNS----QIST  333
              P +G    GS    ++P      E    I  N D  +   +  LG+VN +    ++S+
Sbjct  775  --PQDGTLSTGSKAHALSPLTDIGVELILGIGENKDGSRNLTDATLGYVNTNDCPERLSS  832

Query  332  QAKFVNN  312
            +   VNN
Sbjct  833  ELDIVNN  839



>ref|XP_010694258.1| PREDICTED: autophagy-related protein 18f isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=860

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 63/187 (34%), Positives = 86/187 (46%), Gaps = 33/187 (18%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E   +Y S AEL MH+   PLWARPE    S++ + I +D     GGE+EIERIP RT E
Sbjct  679  ERNQLYISEAELQMHEQQVPLWARPE----SMMNDAIKVDGENT-GGEMEIERIPVRTFE  733

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSGKDNPINSNLGYPHCTTNGCI  477
            ARS+DLVPV +Y+  PK                  S V+  D+   S      C      
Sbjct  734  ARSRDLVPVSDYVDTPKPLPASF----------SLSRVAAADSKFESQQLRQLCKV----  779

Query  476  EPPYNGIEENGSNGCWMAP------ETTKDIVYNNDSPK--ANTQLGFVNNS----QIST  333
              P +G    GS    ++P      E    I  N D  +   +  LG+VN +    ++S+
Sbjct  780  --PQDGTLSTGSKAHALSPLTDIGVELILGIGENKDGSRNLTDATLGYVNTNDCPERLSS  837

Query  332  QAKFVNN  312
            +   VNN
Sbjct  838  ELDIVNN  844



>ref|XP_010539275.1| PREDICTED: autophagy-related protein 18f isoform X1 [Tarenaya 
hassleriana]
Length=775

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = -3

Query  827  HMYXSXAELHMHQP-VTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRTVEA  654
             +Y S AEL  HQP   PLWA+P++ FQS+    + ++D   A  GEI++ERI T  +EA
Sbjct  640  RLYISEAELLTHQPRCPPLWAKPKVSFQSVALKGVVALDKENATKGEIDVERIRTCLIEA  699

Query  653  RSKDLVPVYNYLQAPKIQQ--QRMFGNN  576
            RSK LVPV+NY+Q  K +Q   R+F ++
Sbjct  700  RSKHLVPVFNYIQPVKFRQLSSRVFASD  727



>ref|XP_010539277.1| PREDICTED: autophagy-related protein 18f isoform X3 [Tarenaya 
hassleriana]
Length=743

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -3

Query  824  MYXSXAELHMHQP-VTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRTVEAR  651
            +Y S AEL  HQP   PLWA+P++ FQS+    + ++D   A  GEI++ERI T  +EAR
Sbjct  609  LYISEAELLTHQPRCPPLWAKPKVSFQSVALKGVVALDKENATKGEIDVERIRTCLIEAR  668

Query  650  SKDLVPVYNYLQAPKIQQ--QRMFGNN  576
            SK LVPV+NY+Q  K +Q   R+F ++
Sbjct  669  SKHLVPVFNYIQPVKFRQLSSRVFASD  695



>ref|XP_010539278.1| PREDICTED: autophagy-related protein 18f isoform X4 [Tarenaya 
hassleriana]
Length=735

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 4/87 (5%)
 Frame = -3

Query  824  MYXSXAELHMHQP-VTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRTVEAR  651
            +Y S AEL  HQP   PLWA+P++ FQS+    + ++D   A  GEI++ERI T  +EAR
Sbjct  601  LYISEAELLTHQPRCPPLWAKPKVSFQSVALKGVVALDKENATKGEIDVERIRTCLIEAR  660

Query  650  SKDLVPVYNYLQAPKIQQ--QRMFGNN  576
            SK LVPV+NY+Q  K +Q   R+F ++
Sbjct  661  SKHLVPVFNYIQPVKFRQLSSRVFASD  687



>emb|CDY47444.1| BnaC09g31130D [Brassica napus]
Length=742

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 53/82 (65%), Gaps = 2/82 (2%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRT  663
            E +H MY S AEL M+QP   PLW R    FQ ++      +++   GGE+EI+ I TRT
Sbjct  574  EDKHQMYMSEAELQMYQPSRLPLWGRRHFRFQELVLKRDDEESSNGGGGEMEIDGIQTRT  633

Query  662  VEARSKDLVPVYNYLQAPKIQQ  597
            +EAR++DLVP + YL +PK QQ
Sbjct  634  IEARTRDLVPAWGYLHSPKSQQ  655



>ref|NP_001044475.2| Os01g0786900 [Oryza sativa Japonica Group]
 gb|EAZ13789.1| hypothetical protein OsJ_03714 [Oryza sativa Japonica Group]
 dbj|BAG95260.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06389.2| Os01g0786900 [Oryza sativa Japonica Group]
Length=870

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 10/175 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H   TPLW+R  ++FQ +    +  D  G   GE+EIE++ TR +E
Sbjct  685  ENHNFYISESELQTHVVPTPLWSRSGMHFQVMGDGALEADNTGIISGELEIEKLQTRNIE  744

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS-GKDNPINSNLGYPHCTT  489
            +RSK+L+PV+  L   + QQ R+     N   LL  Q+S  S        S+     C +
Sbjct  745  SRSKNLIPVFESLHTSRFQQSRVSTPDSNKYGLLQRQKSGFSEDGRLSCRSSSSSLDCMS  804

Query  488  NGCIEPPYNG----IEENGSNGCWMAPETT--KDIVYNNDSPKANTQLGFVNNSQ  342
             G I    NG    + E+        P      ++V N  S     QLGFVNN +
Sbjct  805  EGPISTDDNGFGQCLVEDSGGAVNKNPNVNPRSELVNNTQSLNTEAQLGFVNNKE  859



>gb|EAY76096.1| hypothetical protein OsI_04020 [Oryza sativa Indica Group]
Length=870

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 10/175 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H   TPLW+R  ++FQ +    +  D  G   GE+EIE++ TR +E
Sbjct  685  ENHNFYISESELQTHVVPTPLWSRSGMHFQVMGDGALEADNTGIISGELEIEKLQTRNIE  744

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS-GKDNPINSNLGYPHCTT  489
            +RSK+L+PV+  L   + QQ R+     N   LL  Q+S  S        S+     C +
Sbjct  745  SRSKNLIPVFESLHTSRFQQSRVSTPDSNKYGLLQRQKSGFSEDGRLSCRSSSSSLDCMS  804

Query  488  NGCIEPPYNG----IEENGSNGCWMAPETT--KDIVYNNDSPKANTQLGFVNNSQ  342
             G I    NG    + E+        P      ++V N  S     QLGFVNN +
Sbjct  805  EGPISTDDNGFGQCLVEDSGGAVNKNPNVNPRSELVNNTQSLNTEAQLGFVNNKE  859



>dbj|BAD53258.1| breast carcinoma amplified sequence 3-like protein [Oryza sativa 
Japonica Group]
Length=756

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 82/175 (47%), Gaps = 10/175 (6%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H   TPLW+R  ++FQ +    +  D  G   GE+EIE++ TR +E
Sbjct  571  ENHNFYISESELQTHVVPTPLWSRSGMHFQVMGDGALEADNTGIISGELEIEKLQTRNIE  630

Query  656  ARSKDLVPVYNYLQAPKIQQQRMF---GNNDQLLHIQRSEVS-GKDNPINSNLGYPHCTT  489
            +RSK+L+PV+  L   + QQ R+     N   LL  Q+S  S        S+     C +
Sbjct  631  SRSKNLIPVFESLHTSRFQQSRVSTPDSNKYGLLQRQKSGFSEDGRLSCRSSSSSLDCMS  690

Query  488  NGCIEPPYNG----IEENGSNGCWMAPETT--KDIVYNNDSPKANTQLGFVNNSQ  342
             G I    NG    + E+        P      ++V N  S     QLGFVNN +
Sbjct  691  EGPISTDDNGFGQCLVEDSGGAVNKNPNVNPRSELVNNTQSLNTEAQLGFVNNKE  745



>ref|XP_008674950.1| PREDICTED: autophagy-related protein 18f [Zea mays]
 tpg|DAA57317.1| TPA: hypothetical protein ZEAMMB73_495531 [Zea mays]
Length=865

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 49/178 (28%), Positives = 86/178 (48%), Gaps = 16/178 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E +++Y S +EL  H   TPLW++  I+FQ +    +  D      GE+E+E++ T  +E
Sbjct  680  ENRNLYISQSELQTHVVQTPLWSKSRIHFQVMEGETLEADNADVISGEVEVEKVQTHNIE  739

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQ---LLHIQRSEVSGKDNPINSNLGY------  504
            +RSK+L+PV++ L   + QQ R+   ++    LL  Q+S +S        +         
Sbjct  740  SRSKNLIPVFDSLHTSRFQQTRLNAPDNSRCGLLQRQKSGISEDGRLSRRSSCSSLDCMS  799

Query  503  --PHCTTNGCIEPPYNGIEENGSNGCWMAPETT--KDIVYNNDSPKANTQLGFVNNSQ  342
              P  + +G        + ++ S+     P      ++V N  S K+  QLGFVN+ +
Sbjct  800  EGPKSSDDGAFS---KYVVDDNSSAVINNPSVKFHAELVNNTGSLKSEAQLGFVNSEE  854



>ref|XP_004970215.1| PREDICTED: autophagy-related protein 18g-like [Setaria italica]
Length=868

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 3/102 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E ++ Y S +EL  H   TPLW+R  I+FQ +    +  D      GE+E+E+I T  +E
Sbjct  683  ENRNFYISQSELQTHVVQTPLWSRSGIHFQVMEGETLEADNLDITSGEVEVEKIQTHNIE  742

Query  656  ARSKDLVPVYNYLQAPKIQQQRM---FGNNDQLLHIQRSEVS  540
            +RSK+LVPV++ L   + QQ RM     N  +LL  Q+S +S
Sbjct  743  SRSKNLVPVFDSLHTSRFQQTRMNTPDNNRYELLQRQKSGIS  784



>ref|XP_004251478.2| PREDICTED: autophagy-related protein 18f-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010313650.1| PREDICTED: autophagy-related protein 18f-like isoform X1 [Solanum 
lycopersicum]
Length=770

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  830  QHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVEAR  651
             H+Y S AEL MH+P   +WA+PE+ F+S + + I +D  G   GE E+E IPTR VEA+
Sbjct  682  HHIYISEAELQMHKPHNQVWAKPEVSFRSFVMDRIHLDDEGR--GEAEVEVIPTRMVEAK  739

Query  650  SKDLVPVYNYLQA  612
            SK L P  N+  A
Sbjct  740  SKRLFPALNFTMA  752



>ref|XP_010313652.1| PREDICTED: autophagy-related protein 18f-like isoform X3 [Solanum 
lycopersicum]
Length=693

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  830  QHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVEAR  651
             H+Y S AEL MH+P   +WA+PE+ F+S + + I +D  G   GE E+E IPTR VEA+
Sbjct  605  HHIYISEAELQMHKPHNQVWAKPEVSFRSFVMDRIHLDDEGR--GEAEVEVIPTRMVEAK  662

Query  650  SKDLVPVYNYLQA  612
            SK L P  N+  A
Sbjct  663  SKRLFPALNFTMA  675



>ref|XP_010232446.1| PREDICTED: autophagy-related protein 18f [Brachypodium distachyon]
Length=874

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 85/179 (47%), Gaps = 18/179 (10%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H   TP+W++  ++FQ I+      D +    GE EIE++ TR +E
Sbjct  689  ENHNYYISESELQTHVVQTPVWSKSGVHFQVIVGRTAEADNSDTVSGETEIEKVWTRNIE  748

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQ---LLHIQRSEVSGKDNPINSNLGYPHCTTN  486
            +RSK+L+PV+  L   + QQ R+   + +   LL  Q+S  S        +     C++ 
Sbjct  749  SRSKNLIPVFESLHTSRFQQPRVSTPDSKRSGLLQQQKSGFSADGRLSRRS----SCSSL  804

Query  485  GCIEPPYNGIEENGSNGCWMAPETT-----------KDIVYNNDSPKANTQLGFVNNSQ  342
             C+    N  ++NGS    +    T            ++V N +S     QLGFVN+ +
Sbjct  805  DCMSEVPNSTDDNGSTQYLVEDSATAVNMISNVNHQAELVNNTESLNPEAQLGFVNSKE  863



>ref|NP_200284.1| autophagy 18F-like protein [Arabidopsis thaliana]
 sp|Q9FH32.1|AT18F_ARATH RecName: Full=Autophagy-related protein 18f; Short=AtATG18f [Arabidopsis 
thaliana]
 dbj|BAB09939.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96531.1| autophagy 18F-like protein [Arabidopsis thaliana]
Length=763

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELH-MHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRT  663
            + +H+Y   AE    H P   PLWAR +  FQ ++ N    + +G  G E+EIE I TRT
Sbjct  618  DKRHLYIYEAEQQQTHLPTQLPLWARRKFRFQELVLNR-GEEISGGGGREMEIEGIQTRT  676

Query  662  VEARSKDLVPVYNYLQAPKIQQ  597
            +EAR++DLVPV+ YLQ+P+ QQ
Sbjct  677  IEARTRDLVPVWGYLQSPRSQQ  698



>ref|XP_006401541.1| hypothetical protein EUTSA_v10012811mg [Eutrema salsugineum]
 gb|ESQ42994.1| hypothetical protein EUTSA_v10012811mg [Eutrema salsugineum]
Length=711

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            +   +Y S AEL M+ P   PLWAR +  FQ ++  D++  ++G  GGE+EIE I TRT+
Sbjct  630  DNHQLYISEAELQMYHPSQKPLWARRKFRFQELVL-DLNEVSSGCGGGEMEIEDIQTRTI  688

Query  659  EARSKDLVPVYNYLQAPKIQQ  597
            EAR++DLVPV+    +P+ QQ
Sbjct  689  EARTRDLVPVWG--SSPRSQQ  707



>emb|CDM84501.1| unnamed protein product [Triticum aestivum]
Length=874

 Score = 69.3 bits (168),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H    P+W+R  ++FQ I  + +   A     GEIEIE++ T  VE
Sbjct  685  ENHNYYISESELQTHVVQIPVWSRSGVHFQEIGSDTLEAYATDNISGEIEIEKVQTYNVE  744

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            +RSK+L+PV++ L   + QQ RM
Sbjct  745  SRSKNLIPVFDSLHTSRFQQTRM  767



>dbj|BAJ88459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=314

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H    P+W+R  ++FQ I    +   A     GEIEIE++ T  VE
Sbjct  125  EKHNYYISESELQTHVAQIPVWSRSGVHFQVIGSGTLEAYATDNNSGEIEIEKVQTHNVE  184

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            +RSK+L+PV+  L   + QQ R+
Sbjct  185  SRSKNLIPVFESLHTSRFQQTRV  207



>dbj|BAJ89507.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=708

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H    P+W+R  ++FQ I    +   A     GEIEIE++ T  VE
Sbjct  519  EKHNYYISESELQTHVAQIPVWSRSGVHFQVIGSGTLEAYATDNISGEIEIEKVQTHNVE  578

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            +RSK+L+PV+  L   + QQ R+
Sbjct  579  SRSKNLIPVFESLHTSRFQQTRV  601



>gb|EMS62994.1| Breast carcinoma-amplified sequence 3-like protein [Triticum 
urartu]
Length=854

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H    P+W+R  ++FQ I  + +   A     GEIEIE++ T  VE
Sbjct  665  ENHNYYISESELQTHVVQIPVWSRSGVHFQVIGSDTLEAYATDNISGEIEIEKVQTYNVE  724

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            +RSK+L+PV++ L   + QQ R+
Sbjct  725  SRSKNLIPVFDSLHTSRFQQTRV  747



>ref|XP_010443049.1| PREDICTED: autophagy-related protein 18f-like [Camelina sativa]
Length=742

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -3

Query  836  EXQHMYXSXAELHMH-QPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            + +H++   AEL MH Q   PLWAR +  FQ ++ N     ++G  GGE+EIE I TRT+
Sbjct  624  DKRHLFIFEAELQMHLQTQLPLWARRKFRFQELVLNPGGEISSGEGGGEMEIEDIQTRTI  683

Query  659  EARSKDLVPVYNYLQAPKIQQ  597
            EAR++DLVPV+ YLQ+P+ +Q
Sbjct  684  EARTRDLVPVWGYLQSPRSEQ  704



>gb|EMT21334.1| hypothetical protein F775_31166 [Aegilops tauschii]
Length=807

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H    P+W+R  ++FQ I  + +   A     GEIEIE++ +  VE
Sbjct  636  ENHNYYISESELQTHVVQIPVWSRSGVHFQVIGSDTLEAYATDNISGEIEIEKVQSYNVE  695

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            +RSK+L+PV++ L   + QQ R+
Sbjct  696  SRSKNLIPVFDSLHTSRFQQTRV  718



>dbj|BAJ99624.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=912

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  + Y S +EL  H    P+W+R  ++FQ I    +   A     GEIEIE++ T  VE
Sbjct  723  EKHNYYISESELQTHVAQIPVWSRSGVHFQVIGSGTLEAYATDNISGEIEIEKVQTHNVE  782

Query  656  ARSKDLVPVYNYLQAPKIQQQRM  588
            +RSK+L+PV+  L   + QQ R+
Sbjct  783  SRSKNLIPVFESLHTSRFQQTRV  805



>ref|XP_010475693.1| PREDICTED: autophagy-related protein 18f-like, partial [Camelina 
sativa]
Length=735

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMH-QPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            + +H++   AEL MH Q   PLWAR +  FQ ++ N     +    G     + I TRT+
Sbjct  586  DKRHLFIFEAELQMHLQTQLPLWARRKFRFQELVLNRGGEISGEGGGEMEIED-IQTRTI  644

Query  659  EARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLH  561
            EAR++DLVPV+ YLQ+P+ +Q  +  + D ++H
Sbjct  645  EARTRDLVPVWGYLQSPRSEQ--VINDTDIMIH  675



>ref|XP_010482879.1| PREDICTED: autophagy-related protein 18f-like [Camelina sativa]
Length=747

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -3

Query  836  EXQHMYXSXAELHMH-QPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            + +H++   AEL MH Q   PLWAR +  FQ ++ N     ++G  GGE+EIE I TRT+
Sbjct  626  DQRHLFIFEAELQMHLQTQLPLWARRKFRFQELVLNRGGEISSGEGGGEMEIEGIQTRTI  685

Query  659  EARSKDLVPVYNYLQAPKIQQ  597
            EAR++DLVPV+ YLQ+P+ +Q
Sbjct  686  EARTRDLVPVWGYLQSPRSEQ  706



>ref|XP_009120004.1| PREDICTED: autophagy-related protein 18f-like [Brassica rapa]
Length=741

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRT  663
            E +H MY S AEL M+QP   PLW R    FQ ++ N    +++   GGE+EIE I TRT
Sbjct  573  EDKHQMYMSEAELLMYQPSRLPLWGRRHFRFQELVLNRDDEESSNGGGGEMEIEGIQTRT  632

Query  662  VEARSKDLVPVYNYLQAPKIQQ  597
            +EAR++DLVP + YL +PK QQ
Sbjct  633  IEARTRDLVPAWGYLHSPKSQQ  654



>gb|EYU33600.1| hypothetical protein MIMGU_mgv1a003709mg [Erythranthe guttata]
Length=551

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E    Y S AEL MH+   PLW RPE+YFQS++      + +    GEIEIER+  RT+E
Sbjct  405  EKHKKYISEAELQMHRNPNPLWGRPEVYFQSMV-----SEGSNVNEGEIEIERVAIRTLE  459

Query  656  ARS  648
            ARS
Sbjct  460  ARS  462



>emb|CDY52567.1| BnaC03g71750D [Brassica napus]
Length=141

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = -3

Query  773  WARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVEARSKDLVPVYNYLQAPKIQQ  597
            + R    FQ  +  D+  ++NG  GGE+EIE I TRTVEAR++ LVPV+ YLQ+ K QQ
Sbjct  10   FGRRNFRFQEWVL-DVDEESNGCGGGEMEIEGIQTRTVEARTRGLVPVWGYLQSSKPQQ  67



>ref|XP_006280045.1| hypothetical protein CARUB_v10025923mg [Capsella rubella]
 ref|XP_006280046.1| hypothetical protein CARUB_v10025923mg [Capsella rubella]
 gb|EOA12943.1| hypothetical protein CARUB_v10025923mg [Capsella rubella]
 gb|EOA12944.1| hypothetical protein CARUB_v10025923mg [Capsella rubella]
Length=771

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            + +H+Y   AEL  + P   PLWAR    FQ ++ N     +    G E+EI  I TRT+
Sbjct  626  DKRHLYIFEAELQTYLPAQLPLWARRNFRFQELVLNRGEEISGEGGG-EMEILDIQTRTI  684

Query  659  EARSKDLVPVYNYLQAPKIQQ  597
            EAR++DLVPV+ YLQ+P+ QQ
Sbjct  685  EARTRDLVPVWGYLQSPRSQQ  705



>emb|CDY43025.1| BnaA03g11720D [Brassica napus]
Length=760

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            +   MY S AEL M++P   PLW R    FQ  +  D+  ++NG  GGE+EIE I TRTV
Sbjct  621  DKHQMYMSEAELQMYEPTQLPLWGRRNFRFQEWVL-DVDEESNGGGGGEMEIEGIQTRTV  679

Query  659  EARSKDLVPVYNYLQAPKIQQ  597
            EAR++ LVPV+ YLQ+PK QQ
Sbjct  680  EARTRGLVPVWGYLQSPKPQQ  700



>ref|XP_009132428.1| PREDICTED: autophagy-related protein 18f-like [Brassica rapa]
Length=759

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            +   MY S AEL M++P   PLW R    FQ  +  D+  ++NG  G E+E+E I TRTV
Sbjct  621  DKHQMYMSEAELQMYEPTQLPLWGRRNFRFQEWVL-DVDEESNGGGG-EMELEGIQTRTV  678

Query  659  EARSKDLVPVYNYLQAPKIQQ  597
            EAR++ LVPV+ YLQ+PK QQ
Sbjct  679  EARTRGLVPVWGYLQSPKPQQ  699



>ref|XP_001753206.1| predicted protein [Physcomitrella patens]
 gb|EDQ81835.1| predicted protein [Physcomitrella patens]
Length=1064

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 63/120 (53%), Gaps = 11/120 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQ--PVTPLWARPEIYFQSILF-----NDISMDANGACGGEIEIER  678
            E Q  + S AEL M+Q  PV P+WA+ +I F  +L      + +    +    GE EIER
Sbjct  639  EMQRWFMSNAELQMYQARPV-PIWAKSKIQFHVMLSGTPEESKVEDYPSEDGVGETEIER  697

Query  677  IPTRTVEARSKDLVPVYNYLQA-PKIQQQRMFGNNDQLLHIQRS--EVSGKDNPINSNLG  507
            IPTR VE R KDLVP+   LQ   K+Q  R    +D L  +  +  ++ G + P +  +G
Sbjct  698  IPTRVVEVRKKDLVPLIERLQIYTKVQDSRDISVSDTLPGVSNAHEQIHGAEGPQDGFIG  757



>emb|CDY42477.1| BnaA10g08530D [Brassica napus]
Length=741

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -3

Query  836  EXQH-MYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRT  663
            E +H MY S AEL M+QP   PLW R    FQ ++ N    + NG  G E+EIE I TRT
Sbjct  573  EDKHQMYMSEAELQMYQPSRLPLWGRRHFRFQELVLNRDDEERNGGGG-EMEIEGIQTRT  631

Query  662  VEARSKDLVPVYNYLQAPKIQQ  597
            +EAR++DLVP + YL +PK QQ
Sbjct  632  IEARTRDLVPAWGYLHSPKSQQ  653



>ref|XP_001780210.1| predicted protein [Physcomitrella patens]
 gb|EDQ54969.1| predicted protein [Physcomitrella patens]
Length=784

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQ--PVTPLWARPEIYFQSILFNDISMD--ANGACGGEIEIERIPT  669
            E Q  + S AE+  HQ  PV P+WA+ +I F  ++ +DIS D  A    G EIEIE   T
Sbjct  700  EMQRFFMSNAEVQTHQASPV-PIWAKTKIQFH-VMLSDISKDPEAGDLFGDEIEIENFST  757

Query  668  RTVEARSKDLVPVYNYLQ  615
            R V  R KDLVPV   LQ
Sbjct  758  RVVVVRRKDLVPVIERLQ  775



>gb|ERN07493.1| hypothetical protein AMTR_s00019p00257260 [Amborella trichopoda]
Length=1026

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSIL--FNDISMDANGACGGEIEIERIPTRT  663
            E  H+Y S AE+ ++    P+W + +I F  ++    D     NG  GGEIEIE+IP   
Sbjct  692  EKFHVYISNAEVQINSGRIPIWQKSKIRFYLMMPTSADEKFGMNGNYGGEIEIEKIPICE  751

Query  662  VEARSKDLVPVYNYLQAPKIQQQ  594
            VE R KDL+PV+++ ++ +  Q 
Sbjct  752  VEIRRKDLLPVFDHFRSFQSDQS  774



>ref|XP_001784306.1| predicted protein [Physcomitrella patens]
 gb|EDQ50868.1| predicted protein [Physcomitrella patens]
Length=1250

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 6/80 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVT-PLWARPEIYFQSIL---FNDISMDANGACGG--EIEIERI  675
            E Q  + S AE+ MHQ  + P+WA+ +I F  +L     ++      +  G  EIEIERI
Sbjct  700  ELQRWFMSNAEVQMHQSRSVPIWAKSKIQFHVMLPGTSKELEAGKYPSLDGVEEIEIERI  759

Query  674  PTRTVEARSKDLVPVYNYLQ  615
            PTR VE R KDLVPV   LQ
Sbjct  760  PTRIVEVRRKDLVPVIERLQ  779



>ref|XP_006845818.2| PREDICTED: autophagy-related protein 18h [Amborella trichopoda]
Length=1397

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -3

Query  836   EXQHMYXSXAELHMHQPVTPLWARPEIYFQSIL--FNDISMDANGACGGEIEIERIPTRT  663
             E  H+Y S AE+ ++    P+W + +I F  ++    D     NG  GGEIEIE+IP   
Sbjct  1063  EKFHVYISNAEVQINSGRIPIWQKSKIRFYLMMPTSADEKFGMNGNYGGEIEIEKIPICE  1122

Query  662   VEARSKDLVPVYNYLQAPKIQQ  597
             VE R KDL+PV+++ ++ +  Q
Sbjct  1123  VEIRRKDLLPVFDHFRSFQSDQ  1144



>emb|CDY52569.1| BnaC03g71770D [Brassica napus]
Length=759

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 3/81 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            +   MY S AEL M++P   PLW R    FQ  +  D+  ++NG  G E+EIE I TRTV
Sbjct  621  DKHQMYMSEAELQMYEPSQLPLWGRRNFRFQDWVL-DVDEESNGGGG-EMEIEGIQTRTV  678

Query  659  EARSKDLVPVYNYLQAPKIQQ  597
            EAR++ LVPV+ YLQ+PK QQ
Sbjct  679  EARTRGLVPVWGYLQSPKPQQ  699



>gb|KDP23568.1| hypothetical protein JCGZ_23401 [Jatropha curcas]
Length=982

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDIS---MDANGACGGEIEIERIPTR  666
            E  H+Y S AE+ M     PLW + ++YF  I   D +   +  + ACG EIE+E++P +
Sbjct  683  EPSHLYLSNAEVQMSSWRIPLWQKSKVYFYIISHLDTTERNVIEDLACG-EIEVEKVPVQ  741

Query  665  TVEARSKDLVPVYNYLQ  615
             VE + KDL+PV+++  
Sbjct  742  EVEIKRKDLLPVFDHFH  758



>ref|XP_012089136.1| PREDICTED: autophagy-related protein 18h [Jatropha curcas]
Length=983

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDIS---MDANGACGGEIEIERIPTR  666
            E  H+Y S AE+ M     PLW + ++YF  I   D +   +  + ACG EIE+E++P +
Sbjct  683  EPSHLYLSNAEVQMSSWRIPLWQKSKVYFYIISHLDTTERNVIEDLACG-EIEVEKVPVQ  741

Query  665  TVEARSKDLVPVYNYLQ  615
             VE + KDL+PV+++  
Sbjct  742  EVEIKRKDLLPVFDHFH  758



>ref|XP_001753777.1| predicted protein [Physcomitrella patens]
 gb|EDQ81529.1| predicted protein [Physcomitrella patens]
Length=1494

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 9/90 (10%)
 Frame = -3

Query  836   EXQHMYXSXAELHMHQ--PVTPLWARPEIYFQSILF---NDISMD--ANGACGGEIEIER  678
             E Q  + S AE+ MHQ  PV P+WA  +I F  +L     ++ +D   +G    EIEIE 
Sbjct  992   EMQRWFMSNAEVQMHQARPV-PIWAESKIQFHVMLSGTPKELEIDNCLSGDGVEEIEIET  1050

Query  677   IPTRTVEARSKDLVPVYNYLQA-PKIQQQR  591
             IPTR VE R KDL+PV   LQ   K+Q  R
Sbjct  1051  IPTRIVEVRRKDLIPVIERLQNFTKVQGAR  1080



>ref|XP_006382658.1| hypothetical protein POPTR_0005s04210g [Populus trichocarpa]
 gb|ERP60455.1| hypothetical protein POPTR_0005s04210g [Populus trichocarpa]
Length=973

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 8/88 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILF-----NDISMDANGACGGEIEIERIP  672
            E  H Y S AE+ M     PLW + ++YF ++        +IS D  G    EIEIE++P
Sbjct  686  EPSHWYLSNAEVQMSFWRIPLWQKSKMYFYAMSHLGPKEENISEDQTGQ---EIEIEKVP  742

Query  671  TRTVEARSKDLVPVYNYLQAPKIQQQRM  588
               VE R KDL+PV+++    K + Q +
Sbjct  743  VHEVEIRRKDLLPVFDHFHRVKTKMQGL  770



>ref|XP_002866056.1| hypothetical protein ARALYDRAFT_495551 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42315.1| hypothetical protein ARALYDRAFT_495551 [Arabidopsis lyrata subsp. 
lyrata]
Length=767

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 9/82 (11%)
 Frame = -3

Query  830  QHMYXSXAELHMHQPV-TPLWARPEIYFQSILFN---DISMDANGACGGEIEIERIPTRT  663
            +H+Y   AE   H P   PLW R +  FQ +  N   DIS          I+     TRT
Sbjct  626  RHLYIFEAEQQTHLPTQLPLWERRKFRFQKLALNRGEDISGGGGEMEIEGIQ-----TRT  680

Query  662  VEARSKDLVPVYNYLQAPKIQQ  597
            +EAR++DLVPV+ YL +P+ QQ
Sbjct  681  IEARTRDLVPVWGYLHSPRSQQ  702



>ref|XP_010522678.1| PREDICTED: autophagy-related protein 18g isoform X1 [Tarenaya 
hassleriana]
Length=933

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 5/102 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M   V P+W   +I F  +     S  A+ + GGE EIE++ T  VE
Sbjct  696  ESSHCYLSNAEVQMISGVLPVWQNSKISFHVM----DSPRADSSAGGEFEIEKVTTHGVE  751

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNN-DQLLHIQRSEVSGK  534
             + K L+PV+++  + K   +  F  N      ++  +V+GK
Sbjct  752  IKQKKLLPVFDHFHSMKTTWEDRFSMNYTHTSKLESHQVNGK  793



>ref|XP_009629586.1| PREDICTED: autophagy-related protein 18h-like isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDIS-MDANGA-CGGEIEIERIPTRT  663
            +  H Y S AE+ +     P+W + +IYF ++  +     D +G+   GEIEIE+IP   
Sbjct  564  DRSHWYLSNAEVQLKSGRIPVWQKSKIYFCTMSLSGYEEQDLSGSFSAGEIEIEKIPVNE  623

Query  662  VEARSKDLVPVYNYLQ  615
            VE R KDL+PV+++  
Sbjct  624  VEIRRKDLLPVFDHFH  639



>ref|XP_010522679.1| PREDICTED: autophagy-related protein 18g isoform X2 [Tarenaya 
hassleriana]
Length=928

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 5/102 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M   V P+W   +I F  +     S  A+ + GGE EIE++ T  VE
Sbjct  691  ESSHCYLSNAEVQMISGVLPVWQNSKISFHVM----DSPRADSSAGGEFEIEKVTTHGVE  746

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNN-DQLLHIQRSEVSGK  534
             + K L+PV+++  + K   +  F  N      ++  +V+GK
Sbjct  747  IKQKKLLPVFDHFHSMKTTWEDRFSMNYTHTSKLESHQVNGK  788



>ref|XP_006433227.1| hypothetical protein CICLE_v10000138mg [Citrus clementina]
 ref|XP_006480213.1| PREDICTED: autophagy-related protein 18h-like [Citrus sinensis]
 gb|ESR46467.1| hypothetical protein CICLE_v10000138mg [Citrus clementina]
Length=1006

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSI--LFNDISMDANGACGGEIEIERIPTRT  663
            +  HMY S AE+HM     P+W   +I+F ++  L  D    A    GGE E+E IP   
Sbjct  692  DRSHMYISNAEVHMSSGRIPVWQNYKIHFYTMSPLETDEYGSAQEYDGGETELENIPAHC  751

Query  662  VEARSKDLVPVYNYLQA  612
            +E R KDL+P++++  +
Sbjct  752  IEIRRKDLLPLFDHFHS  768



>ref|XP_008246534.1| PREDICTED: autophagy-related protein 18h isoform X1 [Prunus mume]
 ref|XP_008246535.1| PREDICTED: autophagy-related protein 18h isoform X2 [Prunus mume]
Length=991

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSI--LFNDISMDANGACGGEIEIERIPTRT  663
            E  H+Y S AE+H++    P+W + +IYF ++  L            GGE+EIE++P   
Sbjct  687  ERSHLYLSNAEVHINSGRIPIWQKSKIYFYTMSPLGASELNFTKDLTGGEMEIEKVPVHE  746

Query  662  VEARSKDLVPV  630
            VE R KDL+PV
Sbjct  747  VEIRRKDLLPV  757



>ref|XP_004230156.1| PREDICTED: autophagy-related protein 18h-like [Solanum lycopersicum]
Length=982

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 8/79 (10%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFN-----DISMDANGACGGEIEIERIP  672
            +  H Y S AE+ +     P+W + +IYF ++  +     DIS     +  GEIEIE+IP
Sbjct  682  DRSHWYLSNAEVQLKSGRIPIWQKSKIYFCTMSLSGYEEQDIS---RSSAAGEIEIEKIP  738

Query  671  TRTVEARSKDLVPVYNYLQ  615
               VE R KDL+PV+++  
Sbjct  739  VNEVEVRRKDLLPVFDHFH  757



>ref|XP_007030763.1| Autophagy 18 H [Theobroma cacao]
 gb|EOY11265.1| Autophagy 18 H [Theobroma cacao]
Length=1402

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = -3

Query  836   EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGAC-GGEIEIERIPTRTV  660
             +  H+Y + AE+ +     P+W  P + F ++  + + +D    C GGEIEIE+IP   V
Sbjct  1136  DQSHLYLANAEVQISSGRIPIWQNPRVSFYTM--SPLGLDE---CNGGEIEIEKIPAHEV  1190

Query  659   EARSKDLVPVYNYLQ  615
             E R +DL+PV+ + Q
Sbjct  1191  EIRQRDLLPVFEHFQ  1205



>emb|CDP17988.1| unnamed protein product [Coffea canephora]
Length=1087

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 6/78 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDIS----MDANGACGGEIEIERIPT  669
            +  H Y S AE+ +     P+W + +IYF ++          +D N   GGEIEIE+IP 
Sbjct  738  DRSHWYLSNAEVQLRSGRMPIWQKSKIYFYTMSHGGYEEQNLVDVN--TGGEIEIEKIPA  795

Query  668  RTVEARSKDLVPVYNYLQ  615
              VE R ++L+PV+++ +
Sbjct  796  TEVEIRRRELLPVFDHFR  813



>ref|XP_010660037.1| PREDICTED: autophagy-related protein 18h [Vitis vinifera]
Length=983

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSI--LFNDISMDANGACGGEIEIERIPTRT  663
            E  H Y S AE+ +     P+W + +IYF ++  L +D   +     GGEIEIE+ P + 
Sbjct  668  ERLHWYLSNAEVQIRSGRIPIWQKSKIYFFTMDPLVSD-ECNFTKDTGGEIEIEKFPVQE  726

Query  662  VEARSKDLVPVYNYLQ  615
            VE + KDL+PV+++  
Sbjct  727  VEIKRKDLLPVFDHFH  742



>emb|CBI34324.3| unnamed protein product [Vitis vinifera]
Length=807

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSI--LFNDISMDANGACGGEIEIERIPTRT  663
            E  H Y S AE+ +     P+W + +IYF ++  L +D   +     GGEIEIE+ P + 
Sbjct  635  ERLHWYLSNAEVQIRSGRIPIWQKSKIYFFTMDPLVSD-ECNFTKDTGGEIEIEKFPVQE  693

Query  662  VEARSKDLVPVYNYLQ  615
            VE + KDL+PV+++  
Sbjct  694  VEIKRKDLLPVFDHFH  709



>emb|CAN80611.1| hypothetical protein VITISV_035392 [Vitis vinifera]
Length=754

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSI--LFNDISMDANGACGGEIEIERIPTRT  663
            E  H Y S AE+ +     P+W + +IYF ++  L +D   +     GGEIEIE+ P + 
Sbjct  671  ERLHWYLSNAEVQIRSGRIPIWQKSKIYFFTMDPLVSD-ECNFTKDTGGEIEIEKFPVQE  729

Query  662  VEARSKDLVPVYNYLQ  615
            VE + KDL+PV+++  
Sbjct  730  VEIKRKDLLPVFDHFH  745



>ref|XP_010242571.1| PREDICTED: autophagy-related protein 18h-like [Nelumbo nucifera]
Length=1470

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -3

Query  836   EXQHMYXSXAELHMHQPVTPLWARPEIYFQSI--LFNDISMDANGACGGEIEIERIPTRT  663
             E  H Y S AE+ ++    P+W + +I F  +  L  +         GGEIEIE++P   
Sbjct  1153  ERPHWYLSNAEVQINSGRIPIWQKSKISFYMMIPLRTNERWPTKDCAGGEIEIEKVPVHE  1212

Query  662   VEARSKDLVPVYNYLQAPK  606
             VE R KDL+PV+++  + K
Sbjct  1213  VEIRRKDLLPVFDHFHSIK  1231



>ref|XP_006361891.1| PREDICTED: autophagy-related protein 18h-like [Solanum tuberosum]
Length=983

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 44/79 (56%), Gaps = 8/79 (10%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFN-----DISMDANGACGGEIEIERIP  672
            +  H Y S AE+ +     P+W + ++YF ++  +     DIS     +  GEIEIE+IP
Sbjct  683  DRSHWYLSNAEVQLKSGRIPIWQKSKMYFCTMSLSGYEEQDIS---RSSAAGEIEIEKIP  739

Query  671  TRTVEARSKDLVPVYNYLQ  615
               VE R KDL+PV+++  
Sbjct  740  VNEVEVRRKDLLPVFDHFH  758



>ref|XP_009629585.1| PREDICTED: autophagy-related protein 18h-like isoform X1 [Nicotiana 
tomentosiformis]
Length=986

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDIS-MDANGA-CGGEIEIERIPTRT  663
            +  H Y S AE+ +     P+W + +IYF ++  +     D +G+   GEIEIE+IP   
Sbjct  686  DRSHWYLSNAEVQLKSGRIPVWQKSKIYFCTMSLSGYEEQDLSGSFSAGEIEIEKIPVNE  745

Query  662  VEARSKDLVPVYNYLQ  615
            VE R KDL+PV+++  
Sbjct  746  VEIRRKDLLPVFDHFH  761



>gb|KHG13083.1| Breast carcinoma-amplified sequence 3 [Gossypium arboreum]
Length=999

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQS---ILFNDISMDANGACGGEIEIERIPTR  666
            +  H+Y S AE+ +     P+W   ++ F +   + F +    A+ + GGEIE+E++P  
Sbjct  694  DRSHLYLSNAEVQISSGRIPVWQNSKVSFYTMSPVGFEEHKFTADQS-GGEIELEQMPAH  752

Query  665  TVEARSKDLVPVYNYLQAPKIQQQRMFG  582
             VE R KDL+PV+ +    + +  R FG
Sbjct  753  EVEIRQKDLLPVFEHFHRLQSEWNRGFG  780



>ref|XP_002512315.1| breast carcinoma amplified sequence, putative [Ricinus communis]
 gb|EEF49767.1| breast carcinoma amplified sequence, putative [Ricinus communis]
Length=991

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 11/97 (11%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDI-SMDANGACGGEIEIERIPTRTV  660
            E  H+Y S AE+ M      LW + ++ F  I  ND+ ++D     GGE E+E  P + V
Sbjct  683  EQSHLYLSNAEVQMSSWRISLWQKSKMSFYVI--NDLETIDIGDHTGGEFEVENAPVQEV  740

Query  659  EARSKDLVPVYNYLQAPKIQQQRMFGN-NDQLLHIQR  552
            E R KDL+PV+++         R F   ND+ L+ +R
Sbjct  741  EVRRKDLLPVFDHF-------HRTFSTGNDRCLNGER  770



>gb|KJB82598.1| hypothetical protein B456_013G203700 [Gossypium raimondii]
Length=999

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 47/88 (53%), Gaps = 4/88 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQS---ILFNDISMDANGACGGEIEIERIPTR  666
            +  H+Y S AE+ +     P+W   ++ F +   + F +    A+   GGEIE+E++P  
Sbjct  694  DRSHLYLSNAEVQISSGRIPVWQNSKVSFYTMSPVGFEEHKFTAD-LSGGEIELEQMPAH  752

Query  665  TVEARSKDLVPVYNYLQAPKIQQQRMFG  582
             VE R KDL+PV+ +    + +  R FG
Sbjct  753  EVEIRQKDLLPVFEHFHRLQSEWNRGFG  780



>ref|XP_010111879.1| Breast carcinoma-amplified sequence 3 [Morus notabilis]
 gb|EXC31844.1| Breast carcinoma-amplified sequence 3 [Morus notabilis]
Length=1047

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 10/79 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGA------CGGEIEIERI  675
            E  H+Y S AE+ ++    P+W + +IY     F    ++ N A       GGEIEIE+I
Sbjct  720  ERSHLYISNAEVQINSGRIPIWQKSKIYS----FTMSPLEVNYANLTENPSGGEIEIEKI  775

Query  674  PTRTVEARSKDLVPVYNYL  618
            P   VE + KDL+PV+++ 
Sbjct  776  PVTEVEIKRKDLLPVFDHF  794



>ref|XP_009113417.1| PREDICTED: autophagy-related protein 18h-like isoform X2 [Brassica 
rapa]
Length=868

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGA-CGGEIEIERIPTRTV  660
            E  H+Y + AE+ ++    P+W   EI F  +L +   M+ +    GGEIEIE++    V
Sbjct  631  EKHHVYLANAEVMINSGRKPIWQNSEISFYPLLNDGKKMNLHHHHGGGEIEIEKVSANEV  690

Query  659  EARSKDLVPVYNYLQAPKIQQQRMF  585
            + R KDL+PV++  Q+     +R F
Sbjct  691  DIRRKDLLPVFDNFQSVYSSMRRGF  715



>ref|XP_009113416.1| PREDICTED: autophagy-related protein 18h-like isoform X1 [Brassica 
rapa]
Length=869

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGA-CGGEIEIERIPTRTV  660
            E  H+Y + AE+ ++    P+W   EI F  +L +   M+ +    GGEIEIE++    V
Sbjct  632  EKHHVYLANAEVMINSGRKPIWQNSEISFYPLLNDGKKMNLHHHHGGGEIEIEKVSANEV  691

Query  659  EARSKDLVPVYNYLQAPKIQQQRMF  585
            + R KDL+PV++  Q+     +R F
Sbjct  692  DIRRKDLLPVFDNFQSVYSSMRRGF  716



>ref|XP_002973317.1| hypothetical protein SELMODRAFT_442028 [Selaginella moellendorffii]
 gb|EFJ25691.1| hypothetical protein SELMODRAFT_442028 [Selaginella moellendorffii]
Length=806

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 10/75 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            E Q  Y S AE+ + Q    P+WA+P +YF ++L  D           E+EIE++P + +
Sbjct  581  ELQRWYMSNAEVQISQARPLPIWAKPNVYFHALLVKD---------NQELEIEKMPHQVI  631

Query  659  EARSKDLVPVYNYLQ  615
            E R KDL P+ + LQ
Sbjct  632  EIRRKDLKPLVDRLQ  646



>ref|XP_006847948.1| PREDICTED: autophagy-related protein 18f [Amborella trichopoda]
 ref|XP_011624680.1| PREDICTED: autophagy-related protein 18f [Amborella trichopoda]
 gb|ERN09529.1| hypothetical protein AMTR_s00029p00138620 [Amborella trichopoda]
Length=968

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -3

Query  821  YXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            Y S AEL  HQ   P+W +P+I FQ+++ + I+ + +G   G+IEIE IPTR +
Sbjct  688  YVSNAELQTHQAGVPVWDKPKISFQAMVIDYIAEELDGIHDGDIEIEIIPTRPI  741



>ref|XP_002976587.1| hypothetical protein SELMODRAFT_443277 [Selaginella moellendorffii]
 gb|EFJ22256.1| hypothetical protein SELMODRAFT_443277 [Selaginella moellendorffii]
Length=855

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 10/75 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPV-TPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTV  660
            E Q  Y S AE+ + Q    P+WA+P +YF ++L  D           E+EIE++P + +
Sbjct  627  ELQRWYMSNAEVQISQARPLPIWAKPNVYFHALLVKD---------NQELEIEKMPHQVI  677

Query  659  EARSKDLVPVYNYLQ  615
            E R KDL P+ + LQ
Sbjct  678  EIRRKDLKPLVDRLQ  692



>ref|XP_004302468.2| PREDICTED: autophagy-related protein 18h-like [Fragaria vesca 
subsp. vesca]
Length=1452

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = -3

Query  836   EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGA---CGGEIEIERIPTR  666
             E  H+Y + AE+ ++    P+W + +IYF ++  +  +++ NG     GGEIEIE+ P  
Sbjct  1133  ECSHLYLANAEVQINSGRIPIWQKSKIYFYTMSTSG-AIEQNGTKDLTGGEIEIEKFPVH  1191

Query  665   TVEARSKDLVPV  630
              VE R K+L+PV
Sbjct  1192  EVEVRRKNLLPV  1203



>ref|XP_009373952.1| PREDICTED: autophagy-related protein 18h-like [Pyrus x bretschneideri]
Length=1432

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 12/76 (16%)
 Frame = -3

Query  836   EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANG-------ACGGEIEIER  678
             E  H+Y S AE+ ++    P+W + +IYF ++     S  A G         GGE+EIE+
Sbjct  1133  ERSHIYLSNAEVQINSGRIPIWQKSKIYFYTM-----SPSAAGELNFGKDLTGGEMEIEK  1187

Query  677   IPTRTVEARSKDLVPV  630
             +P   VE R KDL+PV
Sbjct  1188  VPVHEVEMRQKDLLPV  1203



>ref|XP_011023512.1| PREDICTED: autophagy-related protein 18h-like [Populus euphratica]
Length=989

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILF---NDISMDANGACGGEIEIERIPTR  666
            E  H+Y S AE+ M     PLW + ++YF ++     N+ +   + A G EIE+E++P  
Sbjct  686  EPSHLYLSNAEVQMSSWRIPLWQKSKMYFYAMSHLGPNEENFIEDQA-GQEIELEKVPVH  744

Query  665  TVEARSKDLVPVYNYLQAPKIQQQRMFG  582
             VE R +DL+PV+++        +R  G
Sbjct  745  EVEIRRRDLLPVFDHFHRTSEWSERAQG  772



>ref|XP_011013518.1| PREDICTED: autophagy-related protein 18h-like [Populus euphratica]
Length=989

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 4/88 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILF---NDISMDANGACGGEIEIERIPTR  666
            E  H+Y S AE+ M     PLW + ++YF ++     N+ +   + A G EIE+E++P  
Sbjct  686  EPSHLYLSNAEVQMSSWRIPLWQKSKMYFYAMSHLGPNEENFIEDQA-GQEIELEKVPVH  744

Query  665  TVEARSKDLVPVYNYLQAPKIQQQRMFG  582
             VE R +DL+PV+++        +R  G
Sbjct  745  EVEIRRRDLLPVFDHFHRTSEWSERAQG  772



>ref|XP_007208399.1| hypothetical protein PRUPE_ppa000848mg [Prunus persica]
 gb|EMJ09598.1| hypothetical protein PRUPE_ppa000848mg [Prunus persica]
Length=982

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 6/73 (8%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMD----ANGACGGEIEIERIPT  669
            E  H+Y S AE+ ++    P+W + +IYF ++  N +            GGE+EIE++P 
Sbjct  687  ERSHLYLSNAEVQINSGRIPIWQKSKIYFYTM--NPLGASELNFTKDLTGGEMEIEKVPV  744

Query  668  RTVEARSKDLVPV  630
              VE R KDL+PV
Sbjct  745  HEVEIRRKDLLPV  757



>ref|XP_010043141.1| PREDICTED: autophagy-related protein 18h [Eucalyptus grandis]
 gb|KCW85202.1| hypothetical protein EUGRSUZ_B02027 [Eucalyptus grandis]
Length=983

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDIS--MDANGACGGEIEIERIPTRT  663
            E  H+Y + AE+ M     P+W + +I+F +I        +       GE+EIE++P   
Sbjct  682  EHSHLYIANAEVQMSFGRIPIWQQSKIHFHAIGHEGAEERILIQDDFAGELEIEKVPVHE  741

Query  662  VEARSKDLVPVYNYLQ  615
            +E R KDL+PV+++ Q
Sbjct  742  IEIRRKDLLPVFDHFQ  757



>ref|XP_002319034.2| hypothetical protein POPTR_0013s02940g [Populus trichocarpa]
 gb|EEE94957.2| hypothetical protein POPTR_0013s02940g [Populus trichocarpa]
Length=989

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 8/90 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILF-----NDISMDANGACGGEIEIERIP  672
            E  H+Y S AE+ M     PLW + ++YF ++        +I  D  G    EIE+E++P
Sbjct  686  EPSHLYLSNAEVQMSSWRIPLWQKSKMYFYAMSHLGPNEENIIEDQTGQ---EIELEKVP  742

Query  671  TRTVEARSKDLVPVYNYLQAPKIQQQRMFG  582
               VE R +DL+PV+++        +R  G
Sbjct  743  VHEVEIRRRDLLPVFDHFHRTSEWSERAQG  772



>ref|XP_009403826.1| PREDICTED: autophagy-related protein 18g-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403827.1| PREDICTED: autophagy-related protein 18g-like [Musa acuminata 
subsp. malaccensis]
Length=990

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 9/102 (9%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDA--NGACGGEIEIERIPTRT  663
            E  H Y S AE+H+     P+W +  I F  +L    S++   N   GGEIE E++P   
Sbjct  688  ERSHWYLSNAEVHISAGKIPIWQKSAICF-CVLNPSKSIEGFGNDLTGGEIEFEKLPFDE  746

Query  662  VEARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQRSEVSG  537
            VE + KDL+PV+      K       G ND+++   ++  SG
Sbjct  747  VEIKRKDLLPVFEQFHCSK------SGWNDRVVGGYQTSSSG  782



>ref|XP_010070318.1| PREDICTED: autophagy-related protein 18g [Eucalyptus grandis]
 gb|KCW58976.1| hypothetical protein EUGRSUZ_H01605 [Eucalyptus grandis]
 gb|KCW58977.1| hypothetical protein EUGRSUZ_H01605 [Eucalyptus grandis]
 gb|KCW58978.1| hypothetical protein EUGRSUZ_H01605 [Eucalyptus grandis]
Length=1000

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ +     P+W +PEI   ++    IS        GE+EIE++P   +E
Sbjct  687  ERSHWYLSNAEVQVSSRRLPVWHKPEICLHTMGSPSIS----ARLAGELEIEKLPIHEIE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++  + K
Sbjct  743  IKRKELLPVFDHFHSTK  759



>ref|XP_008451647.1| PREDICTED: autophagy-related protein 18g [Cucumis melo]
Length=858

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 47/95 (49%), Gaps = 12/95 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H + S AE+ +     P+W   +IY  S      S   N   GGE EIE++P + +E
Sbjct  591  EQSHWFLSNAEVQLSSGRVPIWQNSKIYVMS------SPRINSIAGGEFEIEKVPVQEIE  644

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQR  552
             R K+L+P +++  + K       G ND+ L + R
Sbjct  645  VREKELLPCFDHCLSLK------SGCNDRGLLLGR  673



>ref|XP_008388609.1| PREDICTED: autophagy-related protein 18h-like [Malus domestica]
Length=982

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (54%), Gaps = 12/76 (16%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANG-------ACGGEIEIER  678
            E  HMY S AE+ ++    P+W + +IYF ++     S  A G         GGE+EIE+
Sbjct  683  ERSHMYLSNAEVQINSGRIPIWQKSKIYFYTM-----SPSAAGELNFGKDLTGGEMEIEK  737

Query  677  IPTRTVEARSKDLVPV  630
            +P   VE R K L+PV
Sbjct  738  VPVHEVEMRRKXLLPV  753



>ref|XP_004148874.1| PREDICTED: autophagy-related protein 18g isoform X1 [Cucumis 
sativus]
Length=967

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 47/95 (49%), Gaps = 12/95 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H + S AE+ +     P+W   +IY  S      S   N   GGE EIE++P + +E
Sbjct  697  EQSHWFLSNAEVQLSSGRLPIWQNSKIYVMS------SPRINSIAGGEFEIEKVPVQEIE  750

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQR  552
             R K+L+P +++  + K       G ND+ L + R
Sbjct  751  VREKELLPCFDHCLSLK------SGCNDRGLLLGR  779



>ref|XP_011659321.1| PREDICTED: autophagy-related protein 18g isoform X2 [Cucumis 
sativus]
Length=944

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 47/95 (49%), Gaps = 12/95 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H + S AE+ +     P+W   +IY  S      S   N   GGE EIE++P + +E
Sbjct  674  EQSHWFLSNAEVQLSSGRLPIWQNSKIYVMS------SPRINSIAGGEFEIEKVPVQEIE  727

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQR  552
             R K+L+P +++  + K       G ND+ L + R
Sbjct  728  VREKELLPCFDHCLSLK------SGCNDRGLLLGR  756



>gb|KGN44850.1| hypothetical protein Csa_7G391270 [Cucumis sativus]
Length=928

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 47/95 (49%), Gaps = 12/95 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H + S AE+ +     P+W   +IY  S      S   N   GGE EIE++P + +E
Sbjct  658  EQSHWFLSNAEVQLSSGRLPIWQNSKIYVMS------SPRINSIAGGEFEIEKVPVQEIE  711

Query  656  ARSKDLVPVYNYLQAPKIQQQRMFGNNDQLLHIQR  552
             R K+L+P +++  + K       G ND+ L + R
Sbjct  712  VREKELLPCFDHCLSLK------SGCNDRGLLLGR  740



>gb|KDO87469.1| hypothetical protein CISIN_1g001814mg [Citrus sinensis]
Length=1010

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  687  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  743  IKRKELLPVFDHFQCIK  759



>ref|XP_006444176.1| hypothetical protein CICLE_v10018690mg [Citrus clementina]
 gb|ESR57416.1| hypothetical protein CICLE_v10018690mg [Citrus clementina]
Length=838

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  687  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  743  IKRKELLPVFDHFQCIK  759



>gb|KDO87472.1| hypothetical protein CISIN_1g001814mg [Citrus sinensis]
Length=765

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  687  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  743  IKRKELLPVFDHFQCIK  759



>gb|KDO87470.1| hypothetical protein CISIN_1g001814mg [Citrus sinensis]
Length=838

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  687  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  743  IKRKELLPVFDHFQCIK  759



>gb|KDO87467.1| hypothetical protein CISIN_1g001814mg [Citrus sinensis]
Length=994

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  687  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  743  IKRKELLPVFDHFQCIK  759



>ref|XP_006444177.1| hypothetical protein CICLE_v10018690mg [Citrus clementina]
 ref|XP_006479822.1| PREDICTED: autophagy-related protein 18g-like [Citrus sinensis]
 gb|ESR57417.1| hypothetical protein CICLE_v10018690mg [Citrus clementina]
Length=994

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  687  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  743  IKRKELLPVFDHFQCIK  759



>emb|CDY64215.1| BnaC09g51640D [Brassica napus]
Length=968

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -3

Query  827  HMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGA-CGGEIEIERIPTRTVEAR  651
            H+Y + AE+ ++    P+W   EI F  +L +   M+ +    GGEIEIE++    V+ R
Sbjct  632  HVYLANAEVMINSGRKPIWQNSEISFYPMLNDGKKMNLHHHHGGGEIEIEKVSANEVDIR  691

Query  650  SKDLVPVYNYLQAPKIQQQRMF  585
             KDL+PV+++  +     +R F
Sbjct  692  RKDLLPVFDHFHSVYSSMRRGF  713



>gb|KDO87471.1| hypothetical protein CISIN_1g001814mg [Citrus sinensis]
Length=787

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  687  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  743  IKRKELLPVFDHFQCIK  759



>gb|KDO87468.1| hypothetical protein CISIN_1g001814mg [Citrus sinensis]
Length=882

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ M     P+W   +I F    F   S  AN    GE EIE++    VE
Sbjct  575  ERSHWYLSNAEVQMSSGRLPIWQSSKISF----FKMDSPRANTHASGEFEIEKVSVHEVE  630

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++ Q  K
Sbjct  631  IKRKELLPVFDHFQCIK  647



>gb|KCW58975.1| hypothetical protein EUGRSUZ_H01605 [Eucalyptus grandis]
Length=1006

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGACGGEIEIERIPTRTVE  657
            E  H Y S AE+ +     P+W +PEI   ++    IS        GE+EIE++P   +E
Sbjct  687  ERSHWYLSNAEVQVSSRRLPVWHKPEICLHTMGSPSIS----ARLAGELEIEKLPIHEIE  742

Query  656  ARSKDLVPVYNYLQAPK  606
             + K+L+PV+++  + K
Sbjct  743  IKRKELLPVFDHFHSTK  759



>ref|XP_002270856.1| PREDICTED: autophagy-related protein 18g [Vitis vinifera]
Length=988

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 10/80 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMD---ANGACGGEIEIERIPTR  666
            E  H Y S AE+ +     P+W + +I F         MD        GGE EIE++P  
Sbjct  678  ERSHWYLSNAEVQISSGRIPIWHKSKICF-------YMMDPPRVKNHVGGEFEIEKLPVH  730

Query  665  TVEARSKDLVPVYNYLQAPK  606
             VE R KDL+PV+++  + K
Sbjct  731  EVEIRRKDLLPVFDHFHSIK  750



>emb|CBI32303.3| unnamed protein product [Vitis vinifera]
Length=951

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 10/80 (13%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMD---ANGACGGEIEIERIPTR  666
            E  H Y S AE+ +     P+W + +I F         MD        GGE EIE++P  
Sbjct  678  ERSHWYLSNAEVQISSGRIPIWHKSKICF-------YMMDPPRVKNHVGGEFEIEKLPVH  730

Query  665  TVEARSKDLVPVYNYLQAPK  606
             VE R KDL+PV+++  + K
Sbjct  731  EVEIRRKDLLPVFDHFHSIK  750



>ref|XP_010550088.1| PREDICTED: autophagy-related protein 18h-like [Tarenaya hassleriana]
Length=943

 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -3

Query  836  EXQHMYXSXAELHMHQPVTPLWARPEIYFQSILFNDISMDANGA--CGGEIEIERIPTRT  663
            E   +Y + AE+ ++    P+W   +I F S+   ++  + +G    GGE EIE++ TR 
Sbjct  673  EKHQVYLANAEVQINSGRRPIWQNSKISFYSMCPPEVDGENSGVHRSGGETEIEKVSTRE  732

Query  662  VEARSKDLVPVYN  624
            +E + KDL+PV++
Sbjct  733  IEIKKKDLLPVFD  745



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798831613323