BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12580

Length=914
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008221466.1|  PREDICTED: histone-lysine N-methyltransferas...    353   2e-115   Prunus mume [ume]
gb|KJB50383.1|  hypothetical protein B456_008G168000                    343   2e-114   Gossypium raimondii
ref|XP_007222801.1|  hypothetical protein PRUPE_ppa005021mg             350   3e-114   Prunus persica
ref|XP_004228642.1|  PREDICTED: histone-lysine N-methyltransferas...    348   1e-113   Solanum lycopersicum
ref|XP_007045259.1|  Rubisco methyltransferase family protein iso...    347   4e-113   
ref|XP_011463173.1|  PREDICTED: histone-lysine N-methyltransferas...    344   6e-113   Fragaria vesca subsp. vesca
gb|KJB50381.1|  hypothetical protein B456_008G168000                    343   8e-113   Gossypium raimondii
ref|XP_009351546.1|  PREDICTED: histone-lysine N-methyltransferas...    346   1e-112   Pyrus x bretschneideri [bai li]
ref|XP_007045258.1|  Rubisco methyltransferase family protein iso...    348   1e-111   
ref|XP_004297442.1|  PREDICTED: histone-lysine N-methyltransferas...    343   3e-111   Fragaria vesca subsp. vesca
ref|XP_008381743.1|  PREDICTED: histone-lysine N-methyltransferas...    343   4e-111   Malus domestica [apple tree]
ref|XP_002281246.1|  PREDICTED: histone-lysine N-methyltransferas...    342   6e-111   Vitis vinifera
gb|KJB50382.1|  hypothetical protein B456_008G168000                    342   7e-111   Gossypium raimondii
ref|XP_009768042.1|  PREDICTED: histone-lysine N-methyltransferas...    339   9e-110   Nicotiana sylvestris
ref|XP_009611032.1|  PREDICTED: histone-lysine N-methyltransferas...    338   3e-109   Nicotiana tomentosiformis
gb|KHG01954.1|  Histone-lysine N-methyltransferase setd3                337   5e-109   Gossypium arboreum [tree cotton]
ref|XP_010107630.1|  Histone-lysine N-methyltransferase setd3           337   6e-109   
gb|KHG01953.1|  Histone-lysine N-methyltransferase setd3                337   1e-108   Gossypium arboreum [tree cotton]
ref|XP_002312458.2|  hypothetical protein POPTR_0008s13380g             336   2e-108   
ref|XP_011024040.1|  PREDICTED: histone-lysine N-methyltransferas...    335   4e-108   Populus euphratica
ref|XP_008389174.1|  PREDICTED: histone-lysine N-methyltransferas...    335   4e-108   
ref|XP_007045257.1|  Rubisco methyltransferase family protein iso...    338   1e-107   
ref|XP_010271179.1|  PREDICTED: histone-lysine N-methyltransferas...    333   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_002525993.1|  conserved hypothetical protein                     332   3e-107   
ref|XP_006580887.1|  PREDICTED: histone-lysine N-methyltransferas...    327   6e-106   
ref|XP_010499150.1|  PREDICTED: histone-lysine N-methyltransferas...    328   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010477988.1|  PREDICTED: histone-lysine N-methyltransferas...    326   9e-105   Camelina sativa [gold-of-pleasure]
emb|CDY27576.1|  BnaA09g28310D                                          317   1e-104   Brassica napus [oilseed rape]
ref|XP_002890701.1|  hypothetical protein ARALYDRAFT_472886             324   4e-104   
ref|XP_006307219.1|  hypothetical protein CARUB_v10008819mg             325   6e-104   
ref|XP_006367610.1|  PREDICTED: histone-lysine N-methyltransferas...    323   8e-104   Solanum tuberosum [potatoes]
ref|XP_007160424.1|  hypothetical protein PHAVU_002G320700g             323   1e-103   Phaseolus vulgaris [French bean]
ref|XP_003630935.1|  SET domain-containing protein                      323   2e-103   Medicago truncatula
emb|CDY27575.1|  BnaA09g28320D                                          322   2e-103   Brassica napus [oilseed rape]
ref|XP_004503402.1|  PREDICTED: histone-lysine N-methyltransferas...    323   2e-103   
ref|XP_009113825.1|  PREDICTED: histone-lysine N-methyltransferas...    322   3e-103   Brassica rapa
gb|KHN21605.1|  Histone-lysine N-methyltransferase setd3                320   4e-103   Glycine soja [wild soybean]
ref|XP_011070578.1|  PREDICTED: histone-lysine N-methyltransferas...    320   2e-102   Sesamum indicum [beniseed]
emb|CDX84966.1|  BnaC05g20890D                                          319   4e-102   
emb|CDP16308.1|  unnamed protein product                                318   1e-101   Coffea canephora [robusta coffee]
ref|XP_012072298.1|  PREDICTED: histone-lysine N-methyltransferas...    317   2e-101   Jatropha curcas
ref|XP_012072299.1|  PREDICTED: histone-lysine N-methyltransferas...    317   2e-101   Jatropha curcas
gb|AAK68776.1|  Unknown protein                                         313   5e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113827.1|  PREDICTED: histone-lysine N-methyltransferas...    315   2e-100   Brassica rapa
ref|XP_006448172.1|  hypothetical protein CICLE_v10015103mg             310   8e-100   
ref|XP_010460423.1|  PREDICTED: histone-lysine N-methyltransferas...    312   2e-99    Camelina sativa [gold-of-pleasure]
gb|AAM65946.1|  unknown                                                 312   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564222.1|  rubisco methyltransferase-like protein                312   2e-99    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44512.1|  hypothetical protein AALP_AA1G266300                    310   2e-98    Arabis alpina [alpine rockcress]
gb|EYU30121.1|  hypothetical protein MIMGU_mgv1a005562mg                308   6e-98    Erythranthe guttata [common monkey flower]
ref|XP_006448170.1|  hypothetical protein CICLE_v10015103mg             308   6e-98    Citrus clementina [clementine]
ref|XP_003530864.1|  PREDICTED: histone-lysine N-methyltransferas...    306   4e-97    Glycine max [soybeans]
ref|XP_006469244.1|  PREDICTED: histone-lysine N-methyltransferas...    305   1e-96    Citrus sinensis [apfelsine]
ref|XP_006415823.1|  hypothetical protein EUTSA_v10007532mg             305   2e-96    Eutrema salsugineum [saltwater cress]
gb|KHN16537.1|  Histone-lysine N-methyltransferase setd3                299   2e-94    Glycine soja [wild soybean]
gb|KCW85968.1|  hypothetical protein EUGRSUZ_B02671                     292   1e-92    Eucalyptus grandis [rose gum]
ref|XP_010556222.1|  PREDICTED: histone-lysine N-methyltransferas...    293   9e-92    Tarenaya hassleriana [spider flower]
gb|KCW85966.1|  hypothetical protein EUGRSUZ_B02669                     286   2e-91    Eucalyptus grandis [rose gum]
ref|XP_010043959.1|  PREDICTED: histone-lysine N-methyltransferas...    291   3e-91    Eucalyptus grandis [rose gum]
gb|KDO60744.1|  hypothetical protein CISIN_1g0129692mg                  282   3e-91    Citrus sinensis [apfelsine]
ref|XP_010046478.1|  PREDICTED: uncharacterized protein LOC104435421    285   1e-89    
ref|XP_004150615.1|  PREDICTED: uncharacterized protein LOC101210959    284   2e-88    Cucumis sativus [cucumbers]
ref|XP_008467099.1|  PREDICTED: histone-lysine N-methyltransferas...    281   4e-88    Cucumis melo [Oriental melon]
ref|XP_008467097.1|  PREDICTED: histone-lysine N-methyltransferas...    280   6e-87    Cucumis melo [Oriental melon]
ref|XP_008467098.1|  PREDICTED: histone-lysine N-methyltransferas...    279   1e-86    Cucumis melo [Oriental melon]
ref|XP_010906939.1|  PREDICTED: histone-lysine N-methyltransferas...    279   2e-86    Elaeis guineensis
ref|XP_010681928.1|  PREDICTED: histone-lysine N-methyltransferas...    277   1e-85    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008809406.1|  PREDICTED: histone-lysine N-methyltransferas...    276   3e-85    Phoenix dactylifera
ref|XP_006647850.1|  PREDICTED: histone-lysine N-methyltransferas...    269   2e-82    Oryza brachyantha
gb|EEC73951.1|  hypothetical protein OsI_08832                          267   9e-82    Oryza sativa Indica Group [Indian rice]
ref|NP_001048036.1|  Os02g0733800                                       266   2e-81    
gb|ACF87938.1|  unknown                                                 259   1e-80    Zea mays [maize]
ref|NP_001151430.1|  SET domain containing protein                      260   5e-79    Zea mays [maize]
emb|CDY66565.1|  BnaAnng22450D                                          254   4e-78    Brassica napus [oilseed rape]
ref|XP_004953834.1|  PREDICTED: histone-lysine N-methyltransferas...    257   5e-78    Setaria italica
ref|XP_002454330.1|  hypothetical protein SORBIDRAFT_04g028760          257   7e-78    Sorghum bicolor [broomcorn]
ref|XP_003570495.1|  PREDICTED: histone-lysine N-methyltransferas...    252   4e-76    Brachypodium distachyon [annual false brome]
dbj|BAK03360.1|  predicted protein                                      251   7e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006828432.2|  PREDICTED: histone-lysine N-methyltransferas...    243   2e-72    Amborella trichopoda
ref|XP_011628004.1|  PREDICTED: histone-lysine N-methyltransferas...    242   4e-72    
ref|XP_011628008.1|  PREDICTED: histone-lysine N-methyltransferas...    241   4e-72    
gb|ADE75732.1|  unknown                                                 235   3e-71    Picea sitchensis
ref|XP_009113823.1|  PREDICTED: histone-lysine N-methyltransferas...    237   2e-70    Brassica rapa
gb|EMT12546.1|  hypothetical protein F775_52053                         238   3e-70    
ref|XP_009420293.1|  PREDICTED: histone-lysine N-methyltransferas...    231   8e-68    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS70598.1|  hypothetical protein M569_04159                         209   4e-60    Genlisea aurea
ref|XP_002964620.1|  hypothetical protein SELMODRAFT_81798              178   5e-48    
ref|XP_008221467.1|  PREDICTED: histone-lysine N-methyltransferas...    175   6e-48    
ref|XP_002989522.1|  hypothetical protein SELMODRAFT_129980             177   1e-47    
gb|EMS47111.1|  hypothetical protein TRIUR3_10865                       166   1e-45    Triticum urartu
ref|XP_001759585.1|  predicted protein                                  166   8e-45    
dbj|BAD26590.1|  SET-domain transcriptional regulator                   154   2e-42    Citrullus lanatus [wild melon]
ref|XP_006448171.1|  hypothetical protein CICLE_v10015103mg             160   5e-42    
gb|EEE57758.1|  hypothetical protein OsJ_08284                          154   2e-39    Oryza sativa Japonica Group [Japonica rice]
gb|ACN35906.1|  unknown                                                 130   7e-33    Zea mays [maize]
ref|XP_001703025.1|  predicted protein                                  130   1e-30    Chlamydomonas reinhardtii
ref|XP_002955706.1|  hypothetical protein VOLCADRAFT_106928             125   6e-29    Volvox carteri f. nagariensis
ref|XP_001421544.1|  predicted protein                                  123   2e-28    Ostreococcus lucimarinus CCE9901
ref|XP_005644202.1|  SET domain-containing protein                      122   5e-28    Coccomyxa subellipsoidea C-169
ref|XP_004513627.1|  PREDICTED: uncharacterized protein LOC101503917    112   1e-25    
ref|XP_002506068.1|  set domain protein                                 106   3e-22    Micromonas commoda
ref|XP_003083454.1|  N-methyltransferase (ISS)                        96.7    5e-19    
emb|CEG00242.1|  Rubisco LS methyltransferase, substrate-binding ...  97.1    6e-19    Ostreococcus tauri
ref|XP_005843772.1|  hypothetical protein CHLNCDRAFT_139898           82.8    2e-14    Chlorella variabilis
ref|XP_011399030.1|  Histone-lysine N-methyltransferase setd3         75.5    5e-12    Auxenochlorella protothecoides
ref|XP_003611129.1|  hypothetical protein MTR_5g010630                67.4    1e-10    
emb|CBJ25550.1|  set domain protein                                   68.9    1e-09    Ectocarpus siliculosus
ref|XP_010051807.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  65.5    2e-08    Eucalyptus grandis [rose gum]
emb|CDP04370.1|  unnamed protein product                              64.3    4e-08    Coffea canephora [robusta coffee]
emb|CBJ32910.1|  conserved unknown protein                            62.8    4e-08    Ectocarpus siliculosus
ref|XP_008812568.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  62.8    1e-07    
gb|KIY92646.1|  lysine N-methylase                                    62.4    1e-07    Monoraphidium neglectum
gb|AES94087.2|  histone-lysine N-methyltransferase                    58.5    2e-07    Medicago truncatula
ref|XP_010914287.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  61.6    3e-07    
ref|XP_004232623.1|  PREDICTED: uncharacterized protein LOC101252...  61.2    5e-07    Solanum lycopersicum
ref|XP_010316519.1|  PREDICTED: uncharacterized protein LOC101252...  60.5    7e-07    Solanum lycopersicum
ref|XP_010260759.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  60.5    7e-07    Nelumbo nucifera [Indian lotus]
ref|XP_010260758.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  60.1    9e-07    Nelumbo nucifera [Indian lotus]
ref|XP_008383258.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  59.7    1e-06    
ref|XP_008383257.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  59.7    1e-06    
ref|XP_008383261.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  59.3    2e-06    
ref|XP_008383259.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  59.3    2e-06    
ref|XP_009368551.1|  PREDICTED: uncharacterized protein LOC103958...  59.3    2e-06    Pyrus x bretschneideri [bai li]
ref|XP_009368554.1|  PREDICTED: uncharacterized protein LOC103958...  58.9    2e-06    Pyrus x bretschneideri [bai li]
ref|XP_009368553.1|  PREDICTED: uncharacterized protein LOC103958...  58.9    2e-06    Pyrus x bretschneideri [bai li]
ref|XP_009340259.1|  PREDICTED: uncharacterized protein LOC103932...  58.9    2e-06    Pyrus x bretschneideri [bai li]
ref|XP_009368552.1|  PREDICTED: uncharacterized protein LOC103958...  58.9    2e-06    Pyrus x bretschneideri [bai li]
ref|XP_009340263.1|  PREDICTED: uncharacterized protein LOC103932...  58.9    3e-06    Pyrus x bretschneideri [bai li]
ref|XP_009340261.1|  PREDICTED: uncharacterized protein LOC103932...  58.9    3e-06    Pyrus x bretschneideri [bai li]
ref|XP_009340260.1|  PREDICTED: uncharacterized protein LOC103932...  58.5    3e-06    Pyrus x bretschneideri [bai li]
gb|AFW81290.1|  hypothetical protein ZEAMMB73_810642                  58.2    4e-06    
ref|XP_003062743.1|  predicted protein                                58.5    4e-06    Micromonas pusilla CCMP1545
gb|ACL53482.1|  unknown                                               58.2    4e-06    Zea mays [maize]
ref|XP_011460532.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  57.8    5e-06    Fragaria vesca subsp. vesca
ref|NP_001146209.1|  hypothetical protein                             57.4    8e-06    Zea mays [maize]
ref|XP_011096855.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  57.4    8e-06    Sesamum indicum [beniseed]
ref|XP_008654830.1|  PREDICTED: hypothetical protein isoform X1       57.0    8e-06    
ref|XP_006363171.1|  PREDICTED: uncharacterized protein LOC102593...  57.0    1e-05    Solanum tuberosum [potatoes]
ref|XP_004295521.2|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  56.6    1e-05    Fragaria vesca subsp. vesca
ref|XP_007212018.1|  hypothetical protein PRUPE_ppa004855mg           56.6    1e-05    
ref|XP_006363170.1|  PREDICTED: uncharacterized protein LOC102593...  56.2    2e-05    Solanum tuberosum [potatoes]
ref|XP_002275523.2|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  55.8    2e-05    Vitis vinifera
ref|XP_002528137.1|  conserved hypothetical protein                   55.8    2e-05    Ricinus communis
ref|XP_008346064.1|  PREDICTED: uncharacterized protein LOC103409022  55.5    2e-05    
gb|KHN47735.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...  55.8    2e-05    Glycine soja [wild soybean]
ref|XP_010649327.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  55.8    2e-05    Vitis vinifera
ref|XP_010537041.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  55.5    3e-05    Tarenaya hassleriana [spider flower]
ref|XP_006448593.1|  hypothetical protein CICLE_v10015087mg           55.5    3e-05    Citrus clementina [clementine]
ref|XP_011022311.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  55.5    3e-05    Populus euphratica
ref|XP_010100625.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...  55.5    3e-05    Morus notabilis
ref|XP_009617274.1|  PREDICTED: uncharacterized protein LOC104109...  55.5    3e-05    Nicotiana tomentosiformis
ref|XP_009617275.1|  PREDICTED: uncharacterized protein LOC104109...  55.1    4e-05    Nicotiana tomentosiformis
gb|KDO77209.1|  hypothetical protein CISIN_1g011639mg                 55.1    4e-05    Citrus sinensis [apfelsine]
ref|XP_012065974.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  54.7    5e-05    
gb|KDO77207.1|  hypothetical protein CISIN_1g011639mg                 54.7    5e-05    Citrus sinensis [apfelsine]
ref|XP_012065975.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  54.7    5e-05    Jatropha curcas
ref|XP_012065976.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  54.7    5e-05    
gb|KDO77210.1|  hypothetical protein CISIN_1g011639mg                 54.7    6e-05    Citrus sinensis [apfelsine]
gb|KDP43135.1|  hypothetical protein JCGZ_26668                       54.7    6e-05    Jatropha curcas
ref|XP_010537049.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  54.7    6e-05    Tarenaya hassleriana [spider flower]
ref|XP_009772611.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  54.3    8e-05    Nicotiana sylvestris
gb|KFK28655.1|  hypothetical protein AALP_AA7G027900                  53.9    1e-04    Arabis alpina [alpine rockcress]
ref|XP_004487895.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  52.8    2e-04    Cicer arietinum [garbanzo]
ref|XP_004487894.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...  52.8    2e-04    Cicer arietinum [garbanzo]
ref|XP_005716618.1|  unnamed protein product                          52.0    3e-04    Chondrus crispus [carageen]
ref|XP_008618202.1|  hypothetical protein SDRG_13880                  52.0    4e-04    Saprolegnia diclina VS20
ref|XP_001417016.1|  predicted protein                                51.6    5e-04    Ostreococcus lucimarinus CCE9901
ref|XP_002440355.1|  hypothetical protein SORBIDRAFT_09g030160        51.6    6e-04    Sorghum bicolor [broomcorn]



>ref|XP_008221466.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
 ref|XP_008245922.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Prunus mume]
Length=481

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 202/238 (85%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+Q+++  D KMLVKV+A   I+++D L LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  246  HSFKPNAIILQDQDDRDVKMLVKVVAETGIKQNDCLVLNYGCLNNDLFLLDYGFVIPSNP  305

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFS PSPWQ+EIL QL LDGE P LKV +GG ELV
Sbjct  306  YDCIELKYDGALLDAASMAAGVSSPNFSVPSPWQKEILCQLKLDGEAPLLKVCLGGSELV  365

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++DME+V+   +D LKS+SVE   PLG ANE+AA RTV ALCVIALGH
Sbjct  366  EGRLLAALRVVLASDMETVQKLDLDKLKSISVE--APLGIANELAAFRTVIALCVIALGH  423

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE+LL++ VS +T LAI+FRI+KKSVIIDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  424  FPTKIMEDESLLQKGVSDSTQLAIQFRIEKKSVIIDVMRDLTRRVKLLASKETATAQG  481



>gb|KJB50383.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=269

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 204/236 (86%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA I+QE++AG+ KML+KV+A   I++SD L LNYGCL+ND FLLDYGFV+PSNP
Sbjct  36   HSFNSNARILQEQDAGNPKMLIKVVAEREIKQSDPLLLNYGCLSNDFFLLDYGFVIPSNP  95

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+EIL QLNLDGE P+LKVTIGGPELV
Sbjct  96   YDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQEILFQLNLDGEVPNLKVTIGGPELV  155

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LSND E V+ + +  LKSLS E   PLG ANEVAA RT+ ALCVIALGH
Sbjct  156  EGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--GPLGVANEVAAFRTIIALCVIALGH  213

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVIIDVMRDLT+RVKLLLSKE+ TA
Sbjct  214  FPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVIIDVMRDLTKRVKLLLSKETTTA  269



>ref|XP_007222801.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
 gb|EMJ24000.1| hypothetical protein PRUPE_ppa005021mg [Prunus persica]
Length=481

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 202/238 (85%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+Q+++  D  MLVKV+A   I+++D L LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  246  HSFKPNAIILQDQDDRDVTMLVKVVAETGIKQNDCLVLNYGCLNNDLFLLDYGFVIPSNP  305

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFS+PSPWQ+EIL QL LDGE P LKV +GG ELV
Sbjct  306  YDCIELKYDGALLDAASMAAGVSSPNFSAPSPWQKEILCQLKLDGEAPLLKVCLGGSELV  365

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++DME+V+   +D LKS+SVE   P+G ANE+AA RT+ ALCVIALGH
Sbjct  366  EGRLLAALRVVLASDMETVQKLDLDKLKSISVE--APIGIANELAAFRTIIALCVIALGH  423

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE+LL++ VS +T LAI+FRI+KKSVIIDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  424  FPTKIMEDESLLQKGVSDSTQLAIQFRIEKKSVIIDVMRDLTRRVKLLASKETATAQG  481



>ref|XP_004228642.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Solanum 
lycopersicum]
Length=471

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 200/231 (87%), Gaps = 2/231 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNAEIVQE    +  MLVK++A   I+++D L LNYGCL++DLFLLDYGFV+PSNP
Sbjct  243  HSFDPNAEIVQEEANTNRNMLVKMVAGREIKQNDPLLLNYGCLSSDLFLLDYGFVIPSNP  302

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAG  SPNFSSPSPWQ++ILS LNLDG N DLKVT+GG ELV
Sbjct  303  YDCIELKYDAALLDAASMAAGFTSPNFSSPSPWQQQILSHLNLDGPNSDLKVTLGGGELV  362

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LSND E+V+ H ++TLKSL+VE   PLG + EV+ALRTV ALCVIALGH
Sbjct  363  EGRLLAALRVVLSNDEEAVKQHDLETLKSLTVE--APLGISTEVSALRTVVALCVIALGH  420

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSK  218
            FPTKIMED++LLKQNVS TT+LA++FRIQKKS+I+DVMRDL++RVKLLL+K
Sbjct  421  FPTKIMEDKSLLKQNVSPTTELALQFRIQKKSLIVDVMRDLSKRVKLLLAK  471



>ref|XP_007045259.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY01091.1| Rubisco methyltransferase family protein isoform 3 [Theobroma 
cacao]
Length=473

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 202/236 (86%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+IVQE++ G+ KML+KV+A + I+++D L L+YGCL+ND FLLDYGFV+PSNP
Sbjct  240  HSFNPNAQIVQEQDVGNSKMLIKVVAEKDIKQNDPLLLHYGCLSNDFFLLDYGFVMPSNP  299

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD AL+DAASMAAGV SPNFS+P+PWQR++LSQL LDGE  +LKV IGGPELV
Sbjct  300  YDYIELKYDGALMDAASMAAGVSSPNFSAPAPWQRQVLSQLKLDGEASNLKVIIGGPELV  359

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL++ALR  LSNDME V+ + ++ LKSLS E   PLG ANEVA  RT+ ALCVIALGH
Sbjct  360  EGRLLSALRVILSNDMELVQRYDLNVLKSLSAE--APLGFANEVAVFRTIIALCVIALGH  417

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIM+DE+ +KQ V  +T+LAI+FRIQKKSVIIDVMRDLT+RVKLL SKE+ TA
Sbjct  418  FPTKIMDDESQMKQGVPVSTELAIQFRIQKKSVIIDVMRDLTKRVKLLSSKETTTA  473



>ref|XP_011463173.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Fragaria vesca subsp. vesca]
Length=387

 Score =   344 bits (882),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 203/238 (85%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+Q+++  + KMLVKV+A   I+++D LELNYG L+NDLFLLDYGFVVPSNP
Sbjct  152  HSFKPNARILQDQDDRNKKMLVKVVAETEIKQNDCLELNYGGLSNDLFLLDYGFVVPSNP  211

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD A LDAASMAAG  SP+FS+P+PWQ+EIL QL LDGE P LKV +GG E+V
Sbjct  212  YDCIELKYDGAFLDAASMAAGESSPSFSAPAPWQKEILCQLKLDGEAPLLKVCLGGSEVV  271

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D+E+V+ H ++TLKS+SVE   PLG ANEVAA RTV ALCVIALGH
Sbjct  272  EGRLLAALRVVLASDVETVQKHDLNTLKSISVE--APLGIANEVAAFRTVIALCVIALGH  329

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTK+MEDE++L++ VS +T+LAI+FRI KKSVIIDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  330  FPTKLMEDESILQKGVSDSTELAIQFRILKKSVIIDVMRDLTRRVKLLSSKETATAQG  387



>gb|KJB50381.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=362

 Score =   343 bits (879),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 204/236 (86%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA I+QE++AG+ KML+KV+A   I++SD L LNYGCL+ND FLLDYGFV+PSNP
Sbjct  129  HSFNSNARILQEQDAGNPKMLIKVVAEREIKQSDPLLLNYGCLSNDFFLLDYGFVIPSNP  188

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+EIL QLNLDGE P+LKVTIGGPELV
Sbjct  189  YDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQEILFQLNLDGEVPNLKVTIGGPELV  248

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LSND E V+ + +  LKSLS E   PLG ANEVAA RT+ ALCVIALGH
Sbjct  249  EGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--GPLGVANEVAAFRTIIALCVIALGH  306

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVIIDVMRDLT+RVKLLLSKE+ TA
Sbjct  307  FPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVIIDVMRDLTKRVKLLLSKETTTA  362



>ref|XP_009351546.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Pyrus x 
bretschneideri]
Length=484

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 199/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQ+++  + KMLVKV+A   I+ +D L LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  249  HSFNPNAAIVQDQDNRNMKMLVKVVAETEIKENDGLVLNYGCLNNDLFLLDYGFVIPSNP  308

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFS+PSPWQ+EIL  L LDGE P LKV +GG ELV
Sbjct  309  YDCIELKYDGALLDAASMAAGVSSPNFSAPSPWQKEILCLLKLDGEAPLLKVCLGGSELV  368

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D+E+V+   ++ LKS+S E   PLG ANE+AA RTV ALCVIALGH
Sbjct  369  EGRLLAALRVVLADDIETVQKQDLNKLKSISAE--APLGIANELAAFRTVIALCVIALGH  426

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE+LL + VS +T LAI+FRIQKKSVIIDVMRDLTRRVKLL SKE+ T+Q 
Sbjct  427  FPTKIMEDESLLSRGVSDSTQLAIQFRIQKKSVIIDVMRDLTRRVKLLASKETTTSQG  484



>ref|XP_007045258.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY01090.1| Rubisco methyltransferase family protein isoform 2 [Theobroma 
cacao]
Length=609

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/236 (70%), Positives = 202/236 (86%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+IVQE++ G+ KML+KV+A + I+++D L L+YGCL+ND FLLDYGFV+PSNP
Sbjct  376  HSFNPNAQIVQEQDVGNSKMLIKVVAEKDIKQNDPLLLHYGCLSNDFFLLDYGFVMPSNP  435

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD AL+DAASMAAGV SPNFS+P+PWQR++LSQL LDGE  +LKV IGGPELV
Sbjct  436  YDYIELKYDGALMDAASMAAGVSSPNFSAPAPWQRQVLSQLKLDGEASNLKVIIGGPELV  495

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL++ALR  LSNDME V+ + ++ LKSLS E   PLG ANEVA  RT+ ALCVIALGH
Sbjct  496  EGRLLSALRVILSNDMELVQRYDLNVLKSLSAE--APLGFANEVAVFRTIIALCVIALGH  553

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIM+DE+ +KQ V  +T+LAI+FRIQKKSVIIDVMRDLT+RVKLL SKE+ TA
Sbjct  554  FPTKIMDDESQMKQGVPVSTELAIQFRIQKKSVIIDVMRDLTKRVKLLSSKETTTA  609



>ref|XP_004297442.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Fragaria vesca subsp. vesca]
Length=482

 Score =   343 bits (879),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 203/238 (85%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+Q+++  + KMLVKV+A   I+++D LELNYG L+NDLFLLDYGFVVPSNP
Sbjct  247  HSFKPNARILQDQDDRNKKMLVKVVAETEIKQNDCLELNYGGLSNDLFLLDYGFVVPSNP  306

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD A LDAASMAAG  SP+FS+P+PWQ+EIL QL LDGE P LKV +GG E+V
Sbjct  307  YDCIELKYDGAFLDAASMAAGESSPSFSAPAPWQKEILCQLKLDGEAPLLKVCLGGSEVV  366

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D+E+V+ H ++TLKS+SVE   PLG ANEVAA RTV ALCVIALGH
Sbjct  367  EGRLLAALRVVLASDVETVQKHDLNTLKSISVE--APLGIANEVAAFRTVIALCVIALGH  424

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTK+MEDE++L++ VS +T+LAI+FRI KKSVIIDVMRDLTRRVKLL SKE+ATAQ 
Sbjct  425  FPTKLMEDESILQKGVSDSTELAIQFRILKKSVIIDVMRDLTRRVKLLSSKETATAQG  482



>ref|XP_008381743.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=483

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 199/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQ+++  + KMLVKV+A   I+ +D L LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  248  HSFNPNAAIVQDQDNRNMKMLVKVVAETEIKENDGLALNYGCLNNDLFLLDYGFVIPSNP  307

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALLDAASMAAGV SPNF++PSPWQ+EIL QL LDGE P LKV +GG ELV
Sbjct  308  YDSIELKYDGALLDAASMAAGVSSPNFNAPSPWQKEILCQLKLDGEAPLLKVCLGGSELV  367

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D+E+V+   ++ LKS+S E   PLG ANE+A  RTV ALCVIALGH
Sbjct  368  EGRLLAALRVVLADDIETVQKQDLNKLKSMSAE--APLGIANELAVFRTVIALCVIALGH  425

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE+LL + VS +T+LAI+FRIQKKS IIDVMR+LTRRVKLL SKE+ATAQ 
Sbjct  426  FPTKIMEDESLLSKGVSDSTELAIQFRIQKKSAIIDVMRNLTRRVKLLASKETATAQG  483



>ref|XP_002281246.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Vitis vinifera]
 emb|CBI26837.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 203/238 (85%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+IVQE++AG   ML+KV+A   I++ D L LNYGCLNND FLLDYGFV+PSNP
Sbjct  248  HSFNPNAQIVQEQDAGSTNMLIKVVAETQIKQDDNLVLNYGCLNNDFFLLDYGFVIPSNP  307

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFSSP+PWQ++ILSQLNLDGE P LKV +GG ELV
Sbjct  308  YDCIELKYDGALLDAASMAAGVMSPNFSSPAPWQQQILSQLNLDGEAPVLKVNLGGSELV  367

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D+E+V+ H ++TLKSL+ E   PLG +NEVAALRTV ALCVIALGH
Sbjct  368  EGRLLAALRVLLASDLETVQKHDLNTLKSLAAE--APLGISNEVAALRTVIALCVIALGH  425

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDEALLKQ VS + +LAI+FRIQKKSVIIDVMR LT RVKLL SKE  +AQ 
Sbjct  426  FPTKIMEDEALLKQGVSGSAELAIQFRIQKKSVIIDVMRGLTSRVKLLSSKEKISAQG  483



>gb|KJB50382.1| hypothetical protein B456_008G168000 [Gossypium raimondii]
Length=475

 Score =   342 bits (876),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 204/236 (86%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA I+QE++AG+ KML+KV+A   I++SD L LNYGCL+ND FLLDYGFV+PSNP
Sbjct  242  HSFNSNARILQEQDAGNPKMLIKVVAEREIKQSDPLLLNYGCLSNDFFLLDYGFVIPSNP  301

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+EIL QLNLDGE P+LKVTIGGPELV
Sbjct  302  YDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQEILFQLNLDGEVPNLKVTIGGPELV  361

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LSND E V+ + +  LKSLS E   PLG ANEVAA RT+ ALCVIALGH
Sbjct  362  EGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--GPLGVANEVAAFRTIIALCVIALGH  419

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVIIDVMRDLT+RVKLLLSKE+ TA
Sbjct  420  FPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVIIDVMRDLTKRVKLLLSKETTTA  475



>ref|XP_009768042.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
sylvestris]
Length=476

 Score =   339 bits (869),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 203/234 (87%), Gaps = 2/234 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNAEIVQE E  +  MLVKV+A   I+++D   LNYGCL+NDLFLLDYGFV+PSNP
Sbjct  244  HSFDPNAEIVQEEENRNRNMLVKVVAGRQIKQNDPFLLNYGCLSNDLFLLDYGFVIPSNP  303

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SP FSSPSPWQ++ILS LNLDG+N DLKVT+GG ELV
Sbjct  304  YDCIELKYDAALLDAASMAAGVSSPKFSSPSPWQQQILSHLNLDGQNSDLKVTLGGRELV  363

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LSND E+V+ H ++ LKSL+VE   PLGT+ EVAALRT+ ALCVIALGH
Sbjct  364  EGRLLAALRVVLSNDEETVQQHDLEALKSLTVE--VPLGTSTEVAALRTIVALCVIALGH  421

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESA  209
            FPTKIMEDE+LLKQNVS TT+LA++FRIQKKS I+DVMRDL++RVKLLL+KESA
Sbjct  422  FPTKIMEDESLLKQNVSPTTELALQFRIQKKSFIVDVMRDLSKRVKLLLAKESA  475



>ref|XP_009611032.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nicotiana 
tomentosiformis]
Length=476

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 206/234 (88%), Gaps = 2/234 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNAEIVQE E  +  MLVKV+A   I+++D+L LNYGCL++DLFLLDYGFV+PSNP
Sbjct  244  HSFDPNAEIVQEEENRNRNMLVKVVAGRQIKQNDSLLLNYGCLSSDLFLLDYGFVIPSNP  303

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SP FSSPSPWQ++ILS LNLDG+N DLKVT+GG ELV
Sbjct  304  YDCIELKYDAALLDAASMAAGVSSPKFSSPSPWQQQILSHLNLDGQNSDLKVTLGGRELV  363

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LS+D E+V+ H ++TLKSL+VE   PLG + EVAALRT+ ALCVIALGH
Sbjct  364  EGRLLAALRVVLSDDEEAVQQHDLETLKSLTVE--APLGISTEVAALRTIVALCVIALGH  421

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESA  209
            FPTKIMEDE+LLKQNVS TT+LA++FRIQKKS+I+DVMRDL++RVKLLL+KESA
Sbjct  422  FPTKIMEDESLLKQNVSPTTELALQFRIQKKSLIVDVMRDLSKRVKLLLAKESA  475



>gb|KHG01954.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=476

 Score =   337 bits (864),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 205/237 (86%), Gaps = 3/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEH-IQRSDALELNYGCLNNDLFLLDYGFVVPSN  734
            HSF+PNA I+QE++AG+ KML+K  ++E  I++SD L LNYGCL+ND FLLDYGFV+PSN
Sbjct  242  HSFNPNARILQEQDAGNPKMLIKAGSSEREIKQSDPLLLNYGCLSNDFFLLDYGFVIPSN  301

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPEL  554
            PYD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+EIL QLNLDGE P+LKVTIGGPEL
Sbjct  302  PYDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQEILFQLNLDGEVPNLKVTIGGPEL  361

Query  553  VEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALG  374
            VEGRL+AALR  LSND E V+ + +  LKSLS E   PLG ANEVAA RT+ ALCVIALG
Sbjct  362  VEGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--GPLGVANEVAAFRTIIALCVIALG  419

Query  373  HFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            HFPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVIIDVMRDLT+RVK+LLSKE+ TA
Sbjct  420  HFPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVIIDVMRDLTKRVKVLLSKETTTA  476



>ref|XP_010107630.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
 gb|EXC16432.1| Histone-lysine N-methyltransferase setd3 [Morus notabilis]
Length=469

 Score =   337 bits (863),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 172/237 (73%), Positives = 203/237 (86%), Gaps = 2/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE+ A +GKMLVKV+A   I+++D L LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  234  HSFEPNARIVQEQGAENGKMLVKVVAETEIKQNDPLALNYGCLNNDLFLLDYGFVIPSNP  293

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIELRYD ALLDAASMAAGV SP+FSSPSPWQ+ IL QL LDGE P+LKVT+GGPELV
Sbjct  294  YDCIELRYDGALLDAASMAAGVSSPSFSSPSPWQQLILKQLGLDGEAPNLKVTLGGPELV  353

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  ++N++++V  H ++TLKSLS E   PLG  NE+AA RTV ALCVIALGH
Sbjct  354  DGRLLAALRVLVANNLQAVEKHDLETLKSLSAE--APLGVTNEIAAFRTVIALCVIALGH  411

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE+LLK+ VS + +LA+ FRIQKKS+IIDV++DLTRRVKLL SKE+ TAQ
Sbjct  412  FPTKIMEDESLLKEGVSGSLELAVTFRIQKKSLIIDVIKDLTRRVKLLSSKETVTAQ  468



>gb|KHG01953.1| Histone-lysine N-methyltransferase setd3 [Gossypium arboreum]
Length=505

 Score =   337 bits (864),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 205/237 (86%), Gaps = 3/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEH-IQRSDALELNYGCLNNDLFLLDYGFVVPSN  734
            HSF+PNA I+QE++AG+ KML+K  ++E  I++SD L LNYGCL+ND FLLDYGFV+PSN
Sbjct  271  HSFNPNARILQEQDAGNPKMLIKAGSSEREIKQSDPLLLNYGCLSNDFFLLDYGFVIPSN  330

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPEL  554
            PYD IEL+YD AL+DAASMAAGV SPNFSSP+PWQ+EIL QLNLDGE P+LKVTIGGPEL
Sbjct  331  PYDHIELKYDGALMDAASMAAGVSSPNFSSPAPWQQEILFQLNLDGEVPNLKVTIGGPEL  390

Query  553  VEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALG  374
            VEGRL+AALR  LSND E V+ + +  LKSLS E   PLG ANEVAA RT+ ALCVIALG
Sbjct  391  VEGRLLAALRVLLSNDREMVQRYDLSVLKSLSAE--GPLGVANEVAAFRTIIALCVIALG  448

Query  373  HFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            HFPTKIM+DE+LLKQ VS +T+LAI+FR+QKKSVIIDVMRDLT+RVK+LLSKE+ TA
Sbjct  449  HFPTKIMDDESLLKQGVSVSTELAIQFRMQKKSVIIDVMRDLTKRVKVLLSKETTTA  505



>ref|XP_002312458.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
 gb|EEE89825.2| hypothetical protein POPTR_0008s13380g [Populus trichocarpa]
Length=479

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 202/237 (85%), Gaps = 2/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            H+F+PNA+I+QE++AG  KML+K +A   I+++DA+ LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  244  HAFNPNAQIIQEQDAGSAKMLIKAVAETPIKQNDAILLNYGCLNNDLFLLDYGFVIPSNP  303

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD A LDAAS+AAGV SP FSSP+PWQ++ LSQLNLDGE  +LKVT+GG ELV
Sbjct  304  YDCIELKYDGAFLDAASVAAGVSSPKFSSPAPWQQQFLSQLNLDGEAANLKVTLGGQELV  363

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L++DME VR H MDTLKSLS +   PLG ANEVAA RT+ ALCVIAL H
Sbjct  364  DGRLLAALRVLLASDMEMVRKHDMDTLKSLSAD--APLGIANEVAAYRTIIALCVIALEH  421

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE+ L+Q VSA+T+LAI+FRIQKKSVIIDVMRDLTRR K LLSK++   Q
Sbjct  422  FPTKIMEDESSLRQGVSASTELAIQFRIQKKSVIIDVMRDLTRRAKSLLSKDTTACQ  478



>ref|XP_011024040.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Populus 
euphratica]
Length=479

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 201/237 (85%), Gaps = 2/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            H F+PNA+I+QE++AG  KML+K +A   I+++DA+ LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  244  HDFNPNAQIIQEQDAGSAKMLIKAVAETPIKQNDAILLNYGCLNNDLFLLDYGFVIPSNP  303

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD A LDAAS+AAGV SP FSSP+PWQ++ LSQLNLDGE  +LKVT+GG ELV
Sbjct  304  YDCIELKYDGAFLDAASVAAGVSSPKFSSPAPWQQQFLSQLNLDGEAANLKVTLGGQELV  363

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L++DME VR H MDTLKSLS +   PLG ANEVAA RTV ALCVIAL H
Sbjct  364  DGRLLAALRVLLASDMEMVRKHDMDTLKSLSAD--APLGIANEVAAYRTVIALCVIALEH  421

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE+ L+Q VSA+T+LAI+FRIQKKSVIIDVMR+LTRR K LLSK++   Q
Sbjct  422  FPTKIMEDESSLRQGVSASTELAIQFRIQKKSVIIDVMRNLTRRAKSLLSKDTTACQ  478



>ref|XP_008389174.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Malus 
domestica]
Length=478

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 194/238 (82%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQ+++  + KMLVKV+A   I+ +D L LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  243  HSFNPNAAIVQDQDDRNMKMLVKVVAETEIKENDGLVLNYGCLNNDLFLLDYGFVIPSNP  302

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFS+PSPWQ+EIL QL LDGE   LKV +GG ELV
Sbjct  303  YDCIELKYDGALLDAASMAAGVSSPNFSAPSPWQKEILCQLKLDGEALLLKVCLGGSELV  362

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            E RL+AALR  L++D E+V+ H ++ LKS+S E   PLG ANE+AA RTV ALCVIALGH
Sbjct  363  EXRLLAALRVVLADDKETVQKHDLNKLKSISAE--APLGIANELAAFRTVIALCVIALGH  420

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE+LL + VS +T LAI+FRI KKSVIIDVMRDLT+RVK L SKE+   + 
Sbjct  421  FPTKIMEDESLLSKGVSDSTQLAIQFRIXKKSVIIDVMRDLTKRVKFLASKETVATKG  478



>ref|XP_007045257.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY01089.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=630

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 202/251 (80%), Gaps = 17/251 (7%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVK---------------VIAAEHIQRSDALELNYGCLNN  776
            HSF+PNA+IVQE++ G+ KML+K               V+A + I+++D L L+YGCL+N
Sbjct  382  HSFNPNAQIVQEQDVGNSKMLIKAAQSFAHTSHFLSYQVVAEKDIKQNDPLLLHYGCLSN  441

Query  775  DLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDG  596
            D FLLDYGFV+PSNPYD IEL+YD AL+DAASMAAGV SPNFS+P+PWQR++LSQL LDG
Sbjct  442  DFFLLDYGFVMPSNPYDYIELKYDGALMDAASMAAGVSSPNFSAPAPWQRQVLSQLKLDG  501

Query  595  ENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVA  416
            E  +LKV IGGPELVEGRL++ALR  LSNDME V+ + ++ LKSLS E   PLG ANEVA
Sbjct  502  EASNLKVIIGGPELVEGRLLSALRVILSNDMELVQRYDLNVLKSLSAE--APLGFANEVA  559

Query  415  ALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRV  236
              RT+ ALCVIALGHFPTKIM+DE+ +KQ V  +T+LAI+FRIQKKSVIIDVMRDLT+RV
Sbjct  560  VFRTIIALCVIALGHFPTKIMDDESQMKQGVPVSTELAIQFRIQKKSVIIDVMRDLTKRV  619

Query  235  KLLLSKESATA  203
            KLL SKE+ TA
Sbjct  620  KLLSSKETTTA  630



>ref|XP_010271179.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=494

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 202/238 (85%), Gaps = 3/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+IVQE+   +  MLVKV+A  HI+R D + L+YGCLNNDLFLLDYGFV+ SNP
Sbjct  260  HSFNPNAQIVQEKNIRNSNMLVKVVAEAHIKRDDTILLDYGCLNNDLFLLDYGFVILSNP  319

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIELRYD ALLDAASMAAGV SPNFSSP+ WQ++IL+QLNL GE+  LKV++GG ELV
Sbjct  320  YDCIELRYDGALLDAASMAAGVSSPNFSSPTQWQQQILAQLNLQGEDALLKVSLGGTELV  379

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L+NDME+V+ H + TLKSL+ E   PLG +NEVAALRTV ALCVIALGH
Sbjct  380  EGRLLAALRVLLANDMETVQKHDLSTLKSLTAE--APLGISNEVAALRTVIALCVIALGH  437

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE+LLK   S  T+LAI+FR+QKKSVIIDVMRDLTRRVK+LLSKE+A AQ 
Sbjct  438  FPTKIMEDESLLK-GASGPTELAIQFRVQKKSVIIDVMRDLTRRVKILLSKETAIAQG  494



>ref|XP_002525993.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36417.1| conserved hypothetical protein [Ricinus communis]
Length=473

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 205/238 (86%), Gaps = 4/238 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+++QE + G+ KML+K  A + I+++D+L +NYGCLNND+FLLDYGFV+PSNP
Sbjct  240  HSFNPNAQVLQEHDPGNAKMLIK--AKKPIEQADSLLINYGCLNNDIFLLDYGFVIPSNP  297

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFSSP+ WQ++ILSQLNLDG+ P LKVTIGG EL+
Sbjct  298  YDCIELKYDGALLDAASMAAGVSSPNFSSPARWQQKILSQLNLDGDAPILKVTIGGQELI  357

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L+NDME V+ H +D LKSLSV    PLG ANEV A RTV ALCVIALGH
Sbjct  358  EGRLLAALRVLLANDMEIVQKHDLDALKSLSV--IAPLGIANEVDAFRTVIALCVIALGH  415

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIM+DE+LLK +VSA+T+LAI+FRIQKKSVIIDVMRDLTRRVK LLSK+ +T Q 
Sbjct  416  FPTKIMDDESLLKPDVSASTELAIQFRIQKKSVIIDVMRDLTRRVKSLLSKDMSTTQG  473



>ref|XP_006580887.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=419

 Score =   327 bits (838),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 193/238 (81%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE++  D KM VKV+A   I+  D L L YGCLNNDLFLLDYGFV+ SNP
Sbjct  184  HSFNPNARIVQEQDTSDSKMKVKVVAETAIKEDDPLLLCYGCLNNDLFLLDYGFVMHSNP  243

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAAS AAGV SPNFS+P+PWQ  ILSQLNL GE PDLKV++GG E V
Sbjct  244  YDCIELKYDGALLDAASTAAGVSSPNFSTPAPWQELILSQLNLAGETPDLKVSLGGQETV  303

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LS ++E+++ + +  L+SL  E   PLG ANE+A  RT+ ALCVIALGH
Sbjct  304  EGRLLAALRVILSTNVETMQKYDLSILQSLDAE--APLGVANEIAVFRTLIALCVIALGH  361

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIM+DE+LLKQ  S +T+LAI++RIQKKSVIIDVM++L+RR+KL+ SKE+ TA+ 
Sbjct  362  FPTKIMDDESLLKQGASGSTELAIQYRIQKKSVIIDVMKNLSRRLKLVSSKETTTAEG  419



>ref|XP_010499150.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Camelina sativa]
 ref|XP_010499151.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Camelina sativa]
Length=479

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 189/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN  I+QE+   D   LVKV+A   ++ +D L LNYGCL+N+ FLLDYGFV+ SNP
Sbjct  245  HSFKPNVRIIQEQNGADSNTLVKVVAETEVKENDPLLLNYGCLSNEFFLLDYGFVIESNP  304

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            Y+ IEL+YD  L+DAASMAAGV SP FSSP+PWQR++LSQLNL GE P+LKVTIGGPE V
Sbjct  305  YETIELKYDEQLMDAASMAAGVSSPKFSSPAPWQRQLLSQLNLAGEIPNLKVTIGGPEPV  364

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  L  D+  V  H +DTLKSLS     PLG ANE+A LRTV ALCVIAL H
Sbjct  365  EGRLLAAIRILLCGDLVEVEKHDLDTLKSLS--STAPLGIANEMAVLRTVIALCVIALSH  422

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA++KQ VSAT +L++++RIQKKSVIIDVMRDLTRRVKLL SKE+ +A
Sbjct  423  FPTKIMEDEAIIKQGVSATAELSVKYRIQKKSVIIDVMRDLTRRVKLLSSKETPSA  478



>ref|XP_010477988.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477989.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
 ref|XP_010477990.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Camelina 
sativa]
Length=479

 Score =   326 bits (836),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN  I+QE+   D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  245  HSFKPNVRIIQEQNGADSNTLVKVVAETEVRENDPLLLNYGCLSNDFFLLDYGFVIESNP  304

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQR++LSQLNL GE P+LKVTIGGPE V
Sbjct  305  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQRQLLSQLNLAGEIPNLKVTIGGPEPV  364

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  L  D+  V  H +DTLKSLS     PLG ANE+A LRTV ALCVIAL H
Sbjct  365  EGRLLAAIRILLCGDLVEVEKHDLDTLKSLS--STAPLGIANEMAVLRTVIALCVIALSH  422

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA+++Q VSAT +L+I++RIQKKSVIIDVM+DLTRRVK L SKE+  A
Sbjct  423  FPTKIMEDEAIIEQGVSATAELSIKYRIQKKSVIIDVMKDLTRRVKALSSKETPNA  478



>emb|CDY27576.1| BnaA09g28310D [Brassica napus]
Length=238

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 185/236 (78%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF  N +I+QE++  D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFVV SNP
Sbjct  4    HSFSANVKIIQEQDGSDSNTLVKVVAETQVKENDQLLLNYGCLSNDFFLLDYGFVVESNP  63

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            +D IEL+YD  LLDAASMAAGV SP FSSP+PWQ ++LSQLNL G+  DLKVTIGG E V
Sbjct  64   FDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQHQLLSQLNLAGKLQDLKVTIGGQETV  123

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  LS ++  V  H ++TLKSLS     PLG ANE+A  RTV ALCVIAL H
Sbjct  124  EGRLLAAIRILLSGELVEVEKHDLETLKSLS--STAPLGVANEIATFRTVIALCVIALSH  181

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA+LKQ VS T +L+I++RIQKK +IIDVM+DLTRRVKLL ++E+ +A
Sbjct  182  FPTKIMEDEAILKQGVSDTAELSIKYRIQKKPMIIDVMKDLTRRVKLLSAQETPSA  237



>ref|XP_002890701.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66960.1| hypothetical protein ARALYDRAFT_472886 [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   324 bits (831),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN +I+QE+   +   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  237  HSFKPNVKIIQEQNGAESNTLVKVVAETELKENDPLLLNYGCLSNDFFLLDYGFVIESNP  296

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQ ++LSQLNL GE P+LKVTIGGPE V
Sbjct  297  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQHQLLSQLNLAGEMPNLKVTIGGPEPV  356

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  L  +M  V  H +DTLKSLS     PLG ANE+A  RTV ALCVIAL H
Sbjct  357  EGRLLAAIRILLCGEMVEVEKHDLDTLKSLSA--IAPLGIANEIAVFRTVIALCVIALSH  414

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA++K+ V AT +L+I++RIQKKSVIIDVM+DLTRRVKLL SKE+ TA
Sbjct  415  FPTKIMEDEAIIKKGVPATAELSIKYRIQKKSVIIDVMKDLTRRVKLLSSKETPTA  470



>ref|XP_006307219.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 ref|XP_006307220.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40117.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
 gb|EOA40118.1| hypothetical protein CARUB_v10008819mg, partial [Capsella rubella]
Length=532

 Score =   325 bits (834),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN  I+QE+   D   LVKV+A   I+ +D L LNYGCL+ND FLLDYGFV+ +NP
Sbjct  298  HSFKPNVRIIQEQNGADSNALVKVVAETEIKENDPLLLNYGCLSNDFFLLDYGFVIEANP  357

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQR++LS+LNL GE P+LKVTIGGPE V
Sbjct  358  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQRQLLSKLNLAGEIPNLKVTIGGPEPV  417

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  L  ++  V  H +DTLKSLS     PLG ANE+A  RTV ALCVIAL H
Sbjct  418  EGRLLAAIRILLCGELVEVEKHDLDTLKSLSF--TAPLGIANEIAVFRTVIALCVIALSH  475

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA++KQ VSAT +L+I++RIQKKSVIIDVM+DLTRRVKLL S E+ TA
Sbjct  476  FPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVIIDVMKDLTRRVKLLSSMETPTA  531



>ref|XP_006367610.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Solanum 
tuberosum]
Length=475

 Score =   323 bits (829),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 200/231 (87%), Gaps = 2/231 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNAEIVQE    D  MLVKV+A + I+++D L LNYGCL++DLFLLDYGFV+PSNP
Sbjct  247  HSFDPNAEIVQEEANSDRNMLVKVVAGKEIKQNDPLLLNYGCLSSDLFLLDYGFVIPSNP  306

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SP+FSSPSPWQ++ILS LNLDG N +LKVT+GG ELV
Sbjct  307  YDCIELKYDAALLDAASMAAGVSSPSFSSPSPWQQQILSHLNLDGPNSNLKVTLGGGELV  366

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALRA LSND E+V+ H ++TLKSL+VE   PLG + EV ALRTV ALCVIALGH
Sbjct  367  EGRLLAALRAVLSNDEEAVKQHDLETLKSLTVE--APLGISTEVLALRTVVALCVIALGH  424

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSK  218
            FPTKIMEDE+LLKQNVS TT+LA++F IQKKS+I+DVMRDL+++VK LL+K
Sbjct  425  FPTKIMEDESLLKQNVSPTTELALQFIIQKKSLIVDVMRDLSKKVKSLLAK  475



>ref|XP_007160424.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
 gb|ESW32418.1| hypothetical protein PHAVU_002G320700g [Phaseolus vulgaris]
Length=465

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 193/238 (81%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQ+ +    KM VKV+A   I+  D L L YGCLNND FLLDYGFV+ SNP
Sbjct  230  HSFNPNARIVQQEDTSSMKMQVKVVAETAIKEDDPLLLCYGCLNNDFFLLDYGFVMHSNP  289

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAAS AAGV SPNFS+P+PWQ+ ILSQLNL GE PDLKV++GG E V
Sbjct  290  YDCIELKYDGALLDAASTAAGVSSPNFSAPAPWQQLILSQLNLFGETPDLKVSLGGQETV  349

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LS++ME+V+ + + TL+SL VE   PLG AN++A  RT+ ALCVIAL H
Sbjct  350  EGRLVAALRIVLSSNMETVQKYDLSTLQSLDVE--APLGVANDIAVFRTLIALCVIALEH  407

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIM+DE+LLKQ  S +T+LAI++RIQKK VIIDVM++L+RRVKLL SKE+ATA+ 
Sbjct  408  FPTKIMDDESLLKQGASGSTELAIQYRIQKKCVIIDVMKNLSRRVKLLSSKETATAEG  465



>ref|XP_003630935.1| SET domain-containing protein [Medicago truncatula]
 gb|AET05411.1| histone-lysine N-methyltransferase setd3-like protein [Medicago 
truncatula]
Length=482

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 199/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE+E G  KM VKV+A + I+  D L L YGCL+NDLFLLDYGFV+ SNP
Sbjct  247  HSFNPNARIVQEQETGSTKMWVKVVAEKAIKEDDPLLLCYGCLSNDLFLLDYGFVIQSNP  306

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFS+P+PWQ  ILSQLNL GE PDLKV++GG E++
Sbjct  307  YDCIELKYDGALLDAASMAAGVSSPNFSTPAPWQELILSQLNLAGETPDLKVSLGGQEII  366

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++DM SV+ H ++TLKSL+ E   PLG AN++A  RT+ ALCVIALGH
Sbjct  367  EGRLLAALRVLLASDMASVQKHDLNTLKSLNAE--APLGVANDLAVFRTLIALCVIALGH  424

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTK+M+DE+LLKQ  S +T+LAI+FRIQKKSVIIDVM++L+R+VKLL SKE+ TA+ 
Sbjct  425  FPTKLMDDESLLKQGASGSTELAIQFRIQKKSVIIDVMKNLSRKVKLLSSKETVTAEG  482



>emb|CDY27575.1| BnaA09g28320D [Brassica napus]
Length=475

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN +I+QE++  D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFVV SNP
Sbjct  241  HSFSPNVKIIQEQDGSDSNTLVKVVAETQVKENDPLLLNYGCLSNDFFLLDYGFVVESNP  300

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  LLDAASMAAGV SP FSSP+PWQ ++LSQLNL G+ PDLKVTIGG E V
Sbjct  301  YDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQHQLLSQLNLAGKMPDLKVTIGGQETV  360

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  LS+D+  V  H ++ LKSLS     PLG ANE+A  RTV ALCVIAL H
Sbjct  361  EGRLLAAIRILLSSDLVEVEKHDLEELKSLSF--TAPLGVANEIATFRTVIALCVIALSH  418

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA+LKQ VS T +L+I++RIQKKS+IIDVM+DLTRRVKLL ++E+ +A
Sbjct  419  FPTKIMEDEAILKQGVSDTAELSIKYRIQKKSMIIDVMKDLTRRVKLLSAQETPSA  474



>ref|XP_004503402.1| PREDICTED: histone-lysine N-methyltransferase setd3-like, partial 
[Cicer arietinum]
Length=490

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 201/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE+EAG  KM VKV+A + I+  D L L YGCL+NDLFLLDYGFV+ SNP
Sbjct  255  HSFNPNARIVQEQEAGSTKMRVKVVAEKAIKEDDPLLLCYGCLSNDLFLLDYGFVIHSNP  314

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAAS+AAGV SP FS+P+PWQ+ ILSQLNL GE PDLKV++GG E++
Sbjct  315  YDCIELKYDGALLDAASIAAGVSSPKFSTPAPWQQLILSQLNLAGEAPDLKVSVGGQEII  374

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++DME+V+ + ++TLKSL  E   PLG AN++A  RT+ ALCVIALGH
Sbjct  375  EGRLLAALRVLLTSDMETVQKYDLNTLKSLDAE--APLGVANDIAVFRTLIALCVIALGH  432

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTK+M+DE+LLKQ  S +T+LAI+FRIQKKSVIIDVM++L+RRVKLL SKE+ TA+S
Sbjct  433  FPTKLMDDESLLKQGASGSTELAIQFRIQKKSVIIDVMKNLSRRVKLLSSKETVTAES  490



>ref|XP_009113825.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
 ref|XP_009113826.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Brassica rapa]
Length=474

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN +I+QE++  D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  240  HSFSPNVKIIQEQDGSDSNTLVKVVAETQVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  299

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  LLDAASMAAGV SP FSSP+PWQ ++LSQLNL G+ PDLKVTIGG E V
Sbjct  300  YDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQHQLLSQLNLAGKMPDLKVTIGGQETV  359

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  LS+D+  V  H ++ LKSLS     PLG ANE+A  RTV ALCVIAL H
Sbjct  360  EGRLLAAIRILLSSDLVEVEKHDLEVLKSLS--STAPLGVANEIATFRTVIALCVIALSH  417

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA+LKQ VS T +L+I++RIQKKS+IIDVM+DLTRRVKLL ++E+ +A
Sbjct  418  FPTKIMEDEAILKQGVSDTAELSIKYRIQKKSMIIDVMKDLTRRVKLLSAQETPSA  473



>gb|KHN21605.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=423

 Score =   320 bits (820),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 192/238 (81%), Gaps = 4/238 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE++  D KM  KV+A   I+  D L L YGCLNNDLFLLDYGFV+ SNP
Sbjct  190  HSFNPNARIVQEQDTSDSKM--KVVAETAIKEDDPLLLCYGCLNNDLFLLDYGFVMHSNP  247

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAAS AAGV SPNFS+P+PWQ  ILSQLNL GE PDLKV++GG E V
Sbjct  248  YDCIELKYDGALLDAASTAAGVSSPNFSTPAPWQELILSQLNLAGETPDLKVSLGGQETV  307

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  LS ++E+++ + +  L+SL  E   PLG ANE+A  RT+ ALCVIALGH
Sbjct  308  EGRLLAALRVILSTNVETMQKYDLSILQSLDAE--APLGVANEIAVFRTLIALCVIALGH  365

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPT+IM+DE+LLKQ  S +T+LAI++RIQKKSVIIDVM++L+RR+KL+ SKE+ TA+ 
Sbjct  366  FPTQIMDDESLLKQGASGSTELAIQYRIQKKSVIIDVMKNLSRRLKLVSSKETTTAEG  423



>ref|XP_011070578.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Sesamum 
indicum]
Length=482

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/237 (74%), Positives = 199/237 (84%), Gaps = 2/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNAEIVQE+EA +  MLVKVIA + I++ D LELNYGCLNNDLFLLDYGFV+PSNP
Sbjct  248  HSFMPNAEIVQEKEANNESMLVKVIAGKQIKQDDPLELNYGCLNNDLFLLDYGFVIPSNP  307

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YDPALLDAASMAAGV SPNFSSPSPWQ+ IL QLNLDGEN DLKV IGG ELV
Sbjct  308  YDCIELKYDPALLDAASMAAGVSSPNFSSPSPWQQRILLQLNLDGENSDLKVRIGGSELV  367

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            E RL+AALR  LSND E+V    + T+KS++ E   PLGT+NE A  RT+ ALCVIALGH
Sbjct  368  EDRLLAALRVLLSNDREAVEKQDLATIKSINSE--APLGTSNEAATFRTMIALCVIALGH  425

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE+ LK+ VS TT+LA+R+R+QKKSVIID MRDL RRVKLL SKES T+Q
Sbjct  426  FPTKIMEDESTLKEKVSTTTELAVRYRVQKKSVIIDAMRDLIRRVKLLSSKESITSQ  482



>emb|CDX84966.1| BnaC05g20890D [Brassica napus]
Length=471

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN +I+QE++  D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  237  HSFSPNVKIIQEQDGSDSNTLVKVVAETQVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  296

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  LLDAASMAAGV SP FSSP+PWQ ++LSQLNL G+ P+LKVTIGG + V
Sbjct  297  YDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQHQLLSQLNLAGKMPNLKVTIGGQDTV  356

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  LS ++  V  H ++TLKSLS     PLG ANE+AA RTV ALCVIAL H
Sbjct  357  EGRLLAAIRILLSGELVEVEKHDLETLKSLS--STAPLGIANEIAAFRTVIALCVIALSH  414

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDE +LKQ VS T +L+I++RIQKKS+IIDVM+DLTRRVKLL ++E+ +A
Sbjct  415  FPTKIMEDEGILKQGVSDTAELSIKYRIQKKSMIIDVMKDLTRRVKLLSAQETPSA  470



>emb|CDP16308.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 199/235 (85%), Gaps = 3/235 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNAEIVQE++  +G+MLVK    + I+R D L LNYG LNNDLFLLDYGFV+PSNP
Sbjct  244  HSFNPNAEIVQEQDTANGRMLVKAPGIQ-IKRDDLLLLNYGNLNNDLFLLDYGFVIPSNP  302

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDC+EL+YD ALLDAA MAAG+ SPNFSSP PWQ++ILSQLNL GE+  LK+++GG ELV
Sbjct  303  YDCVELKYDSALLDAAGMAAGISSPNFSSPLPWQQQILSQLNLRGEDAQLKISLGGSELV  362

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LSND E+V+ H + TLKSLS E   PLG +NEVAALRT+ ALCVIALGH
Sbjct  363  DGRLLAALRVILSNDKEAVQKHDLTTLKSLSAE--APLGISNEVAALRTIIALCVIALGH  420

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESAT  206
            FPTK+MEDE+LLKQ+VSA+T LAI+FRIQKK++IID MR+LTRRVK L SKES T
Sbjct  421  FPTKLMEDESLLKQSVSASTALAIQFRIQKKALIIDAMRNLTRRVKSLSSKESVT  475



>ref|XP_012072298.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Jatropha curcas]
 gb|KDP38111.1| hypothetical protein JCGZ_04754 [Jatropha curcas]
Length=482

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 201/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+I+QE++ G+ KML+KV+  E I+  D L LNYGCLNNDL LLDYGFV+PSNP
Sbjct  245  HSFNPNAKILQEQDPGNAKMLIKVVTEEPIKEEDHLLLNYGCLNNDLLLLDYGFVIPSNP  304

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFSS +PWQ++ILSQLNLD EN  LKVTIGG EL+
Sbjct  305  YDCIELKYDGALLDAASMAAGVASPNFSSAAPWQQQILSQLNLDRENSTLKVTIGGEELI  364

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L+ D E+V+ H +DTLKSLS     PLG ANE+AA RT+ ALCVIAL H
Sbjct  365  EGRLLAALRVLLTTDKEAVQKHDLDTLKSLSA--NAPLGIANEIAAFRTIIALCVIALEH  422

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIM+DE+LLKQ VSA+T+LAI+FRIQKKSVIID MRDLTRRVK LLSK + TAQ+
Sbjct  423  FPTKIMDDESLLKQGVSASTELAIQFRIQKKSVIIDTMRDLTRRVKSLLSKNTTTAQT  480



>ref|XP_012072299.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Jatropha curcas]
Length=477

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 201/238 (84%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+I+QE++ G+ KML+KV+  E I+  D L LNYGCLNNDL LLDYGFV+PSNP
Sbjct  240  HSFNPNAKILQEQDPGNAKMLIKVVTEEPIKEEDHLLLNYGCLNNDLLLLDYGFVIPSNP  299

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAASMAAGV SPNFSS +PWQ++ILSQLNLD EN  LKVTIGG EL+
Sbjct  300  YDCIELKYDGALLDAASMAAGVASPNFSSAAPWQQQILSQLNLDRENSTLKVTIGGEELI  359

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L+ D E+V+ H +DTLKSLS     PLG ANE+AA RT+ ALCVIAL H
Sbjct  360  EGRLLAALRVLLTTDKEAVQKHDLDTLKSLSA--NAPLGIANEIAAFRTIIALCVIALEH  417

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIM+DE+LLKQ VSA+T+LAI+FRIQKKSVIID MRDLTRRVK LLSK + TAQ+
Sbjct  418  FPTKIMDDESLLKQGVSASTELAIQFRIQKKSVIIDTMRDLTRRVKSLLSKNTTTAQT  475



>gb|AAK68776.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL66947.1| unknown protein [Arabidopsis thaliana]
Length=364

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 186/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+QE+   D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  130  HSFKPNARIIQEQNGADSNTLVKVVAETEVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  189

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQ ++LSQLNL GE P+LKVTIGGPE V
Sbjct  190  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQHQLLSQLNLAGEMPNLKVTIGGPEPV  249

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L  ++  V  H  DTLKSLS     P G ANE+A  RTV ALCVIAL H
Sbjct  250  EGRLLAALRILLCGELVEVEKHDSDTLKSLSA--VAPFGIANEIAVFRTVIALCVIALSH  307

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA++KQ VSAT +L+I++RIQKKSVIIDVM+DLTRRVKLL SKE+ TA
Sbjct  308  FPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVIIDVMKDLTRRVKLLSSKETPTA  363



>ref|XP_009113827.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Brassica rapa]
Length=474

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 186/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN +I+QE++  D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFVV SNP
Sbjct  240  HSFSPNVKIIQEQDGSDSNTLVKVVAETQVKENDQLLLNYGCLSNDFFLLDYGFVVESNP  299

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            +D IEL+YD  LLDAASMAAGV SP FSSP+PWQ ++LSQLNL G+  DLKVTIGG E V
Sbjct  300  FDTIELKYDEGLLDAASMAAGVASPKFSSPAPWQHQLLSQLNLAGKLQDLKVTIGGQETV  359

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  LS ++  V  H ++TLKSLS     PLG ANE+A  R V ALCVIAL H
Sbjct  360  EGRLLAAIRILLSGELVEVEKHDLETLKSLS--STAPLGVANEIATFRIVIALCVIALSH  417

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA+LKQ VS T +L+I++RIQKKS+IIDVM+DLTRRVKLL ++E+ +A
Sbjct  418  FPTKIMEDEAILKQGVSDTAELSIKYRIQKKSMIIDVMKDLTRRVKLLSAQETPSA  473



>ref|XP_006448172.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 ref|XP_006448173.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61412.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61413.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=362

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 199/237 (84%), Gaps = 4/237 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+I+QE +  D ++L+KV+A   I+++D+L LNYGCL+NDLFLLDYGFV+PSNP
Sbjct  129  HSFNPNAQIIQEED--DSQLLIKVVAETEIKQNDSLLLNYGCLSNDLFLLDYGFVMPSNP  186

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ++ILSQLNL GE   +KV++GGPELV
Sbjct  187  YDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQQILSQLNLVGETAIVKVSLGGPELV  246

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D E+V+ H ++TL+SLS E   PLG  NEVA  RT+ ALC IAL H
Sbjct  247  EGRLLAALRVLLASDSETVQKHDLNTLQSLSAE--APLGITNEVAVFRTIIALCAIALEH  304

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE+LL+Q VSA+T LAI+FRIQKK++IID+MR+L+RRVKLL SKE+   Q
Sbjct  305  FPTKIMEDESLLEQGVSASTVLAIQFRIQKKTLIIDIMRNLSRRVKLLSSKETTATQ  361



>ref|XP_010460423.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460424.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
 ref|XP_010460425.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=479

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 187/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN  I+QE+   D   LVKV+    ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  245  HSFKPNVRIIQEQNGADSNTLVKVVVETEVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  304

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQR++LSQLNL GE P+LKVTIGGPE V
Sbjct  305  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQRQLLSQLNLAGELPNLKVTIGGPEPV  364

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  L  ++  V  H +DTLKSLS     PLG ANE+A LRTV ALCVIAL H
Sbjct  365  EGRLLAAIRILLCGELVEVEKHDLDTLKSLS--STAPLGIANEMAVLRTVIALCVIALSH  422

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKI+EDEA++KQ VSAT +L+I++RIQKKSVIIDVM+DLTRRVKLL S E+ +A
Sbjct  423  FPTKIIEDEAIIKQGVSATAELSIKYRIQKKSVIIDVMKDLTRRVKLLSSMETPSA  478



>gb|AAM65946.1| unknown [Arabidopsis thaliana]
Length=471

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 186/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+QE+   D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  237  HSFKPNARIIQEQNGADSNTLVKVVAETEVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  296

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQ ++LSQLNL GE P+LKVTIGGPE V
Sbjct  297  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQHQLLSQLNLAGEMPNLKVTIGGPEPV  356

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L  ++  V  H  DTLKSLS     P G ANE+A  RTV ALCVIAL H
Sbjct  357  EGRLLAALRILLCGELVEVEKHDSDTLKSLSA--VAPFGIANEIAVFRTVIALCVIALSH  414

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA++KQ VSAT +L+I++RIQKKSVIIDVM+DLTRRVKLL SKE+ TA
Sbjct  415  FPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVIIDVMKDLTRRVKLLSSKETPTA  470



>ref|NP_564222.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAF97974.1|AC000103_24 F21J9.27 [Arabidopsis thaliana]
 gb|AEE30553.1| rubisco methyltransferase-like protein [Arabidopsis thaliana]
Length=476

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 186/236 (79%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+QE+   D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  242  HSFKPNARIIQEQNGADSNTLVKVVAETEVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  301

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQ ++LSQLNL GE P+LKVTIGGPE V
Sbjct  302  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQHQLLSQLNLAGEMPNLKVTIGGPEPV  361

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L  ++  V  H  DTLKSLS     P G ANE+A  RTV ALCVIAL H
Sbjct  362  EGRLLAALRILLCGELVEVEKHDSDTLKSLSA--VAPFGIANEIAVFRTVIALCVIALSH  419

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA++KQ VSAT +L+I++RIQKKSVIIDVM+DLTRRVKLL SKE+ TA
Sbjct  420  FPTKIMEDEAIIKQGVSATAELSIKYRIQKKSVIIDVMKDLTRRVKLLSSKETPTA  475



>gb|KFK44512.1| hypothetical protein AALP_AA1G266300 [Arabis alpina]
Length=475

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/236 (67%), Positives = 185/236 (78%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+QE+   D    VKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  241  HSFKPNARIIQEQNGADSNTFVKVVAETEVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  300

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAGV SP FSSP+PWQ + LSQLNL GE P+LKVTIGG ELV
Sbjct  301  YDTIELKYDEQLMDAASMAAGVSSPKFSSPAPWQHQFLSQLNLSGEMPNLKVTIGGSELV  360

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L  ++  V  H ++TLKSLS     PLG ANE++  RTV ALCVIAL H
Sbjct  361  EGRLLAALRILLCGELVEVEKHDLNTLKSLSA--VAPLGIANEISVFRTVIALCVIALSH  418

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA++KQ VSAT +LA+++RIQKKSVIID MRDLTRR+KLL SKE+ TA
Sbjct  419  FPTKIMEDEAIVKQGVSATAELAVQYRIQKKSVIIDAMRDLTRRIKLLCSKETPTA  474



>gb|EYU30121.1| hypothetical protein MIMGU_mgv1a005562mg [Erythranthe guttata]
Length=479

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/237 (68%), Positives = 190/237 (80%), Gaps = 5/237 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNAEIVQE    +  +LVKVIA   I+R D LELNYG LNND FL+DYGFVVPSNP
Sbjct  248  HSFAPNAEIVQE---NNENVLVKVIAGAEIKRDDQLELNYGRLNNDFFLMDYGFVVPSNP  304

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD  LL+AASMAAGV +PNFSSP PWQ++IL +LNL GEN DLKV IGG ELV
Sbjct  305  YDCIELKYDSGLLEAASMAAGVSTPNFSSPLPWQQQILLRLNLHGENSDLKVRIGGSELV  364

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            E RL+AALR  LSND E+V  H++DTLKS++    PPLG +NE A  RT+ ALC+IAL H
Sbjct  365  EDRLLAALRVLLSNDKEAVEKHNLDTLKSIAS--GPPLGPSNEAAVFRTIIALCMIALSH  422

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE++L++ VS+T +LA+R+RIQKKS+IID MRD TRRVKLL  KE  +AQ
Sbjct  423  FPTKIMEDESVLEKTVSSTAELAVRYRIQKKSLIIDAMRDFTRRVKLLSEKEPVSAQ  479



>ref|XP_006448170.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61410.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=474

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 199/237 (84%), Gaps = 4/237 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+I+QE +  D ++L+KV+A   I+++D+L LNYGCL+NDLFLLDYGFV+PSNP
Sbjct  241  HSFNPNAQIIQEED--DSQLLIKVVAETEIKQNDSLLLNYGCLSNDLFLLDYGFVMPSNP  298

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ++ILSQLNL GE   +KV++GGPELV
Sbjct  299  YDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQQILSQLNLVGETAIVKVSLGGPELV  358

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D E+V+ H ++TL+SLS E   PLG  NEVA  RT+ ALC IAL H
Sbjct  359  EGRLLAALRVLLASDSETVQKHDLNTLQSLSAE--APLGITNEVAVFRTIIALCAIALEH  416

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE+LL+Q VSA+T LAI+FRIQKK++IID+MR+L+RRVKLL SKE+   Q
Sbjct  417  FPTKIMEDESLLEQGVSASTVLAIQFRIQKKTLIIDIMRNLSRRVKLLSSKETTATQ  473



>ref|XP_003530864.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Glycine 
max]
Length=472

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 193/237 (81%), Gaps = 2/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE++  + +M VKV+A   I+  D L L YGCLNNDLFLLDYGFV+ SNP
Sbjct  237  HSFNPNARIVQEQDTSNSRMQVKVVAETAIKEDDPLLLCYGCLNNDLFLLDYGFVMHSNP  296

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAAS AAGV SPNFS+P PWQ  ILSQLNL GE  DLKV++GG E V
Sbjct  297  YDCIELKYDGALLDAASTAAGVSSPNFSAPVPWQELILSQLNLAGETADLKVSLGGQETV  356

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            E RL+AALR  LS+++E+V+ + + TL+SL  E   PLG ANE+A  RT+ ALCVIALGH
Sbjct  357  EARLLAALRVLLSSNVETVQKYDLSTLQSLDAE--APLGVANEIAVFRTLIALCVIALGH  414

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIM+DE+LLKQ  S +T+LAI++RIQKKSVIIDVMR+++RR+KLL SKE+ATA+
Sbjct  415  FPTKIMDDESLLKQGASGSTELAIQYRIQKKSVIIDVMRNISRRLKLLSSKETATAE  471



>ref|XP_006469244.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Citrus 
sinensis]
Length=474

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 196/237 (83%), Gaps = 4/237 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+I+QE +  D ++L+KV+A   I+++D+L LNYGCL+ND FLLDYGFV+PSNP
Sbjct  241  HSFNPNAQIIQEED--DLQLLIKVVAETEIKQNDSLLLNYGCLSNDFFLLDYGFVMPSNP  298

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ+ ILSQLNL GE   +KV++GGPELV
Sbjct  299  YDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQRILSQLNLVGETAIVKVSLGGPELV  358

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L++D E+V+ H ++TL+SLS E   PLG  NEVA  RT+ ALC IAL H
Sbjct  359  EGRLLAALRVLLASDSETVQKHDLNTLQSLSAE--APLGITNEVAVFRTIIALCAIALEH  416

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE+LLKQ VSA+T L I+FRIQKK++IID+MR+L+RRVKLL SKE+   Q
Sbjct  417  FPTKIMEDESLLKQGVSASTVLVIQFRIQKKTLIIDIMRNLSRRVKLLSSKETTATQ  473



>ref|XP_006415823.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
 gb|ESQ34176.1| hypothetical protein EUTSA_v10007532mg [Eutrema salsugineum]
Length=474

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/236 (66%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE+   D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFV+ SNP
Sbjct  240  HSFKPNARIVQEQNGADSNTLVKVVAEAEVKENDPLLLNYGCLSNDFFLLDYGFVIESNP  299

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD  L+DAASMAAG+ SP FSS +PWQ+++LSQL+L GE P+LKVTIGGPE V
Sbjct  300  YDTIELKYDEQLMDAASMAAGISSPKFSSTAPWQQQLLSQLSLAGEMPNLKVTIGGPEPV  359

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R  L  ++  V  H +DTL+S+S     PLG ANE+A  RTV ALCVIAL H
Sbjct  360  EGRLLAAIRILLCGELVEVEKHDLDTLQSISA--IAPLGIANEIAVFRTVIALCVIALSH  417

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDEA+LKQ VS T +L+I++RIQKKSVIIDVM+DLTRRVKLL S+E++TA
Sbjct  418  FPTKIMEDEAILKQGVSDTAELSIKYRIQKKSVIIDVMKDLTRRVKLLSSQETSTA  473



>gb|KHN16537.1| Histone-lysine N-methyltransferase setd3 [Glycine soja]
Length=470

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 192/237 (81%), Gaps = 4/237 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE++  + +M  +V+A   I+  D L L YGCLNNDLFLLDYGFV+ SNP
Sbjct  237  HSFNPNARIVQEQDTSNSRM--QVVAETAIKEDDPLLLCYGCLNNDLFLLDYGFVMHSNP  294

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YDCIEL+YD ALLDAAS AAGV SPNFS+P PWQ  ILSQLNL GE  DLKV++GG E V
Sbjct  295  YDCIELKYDGALLDAASTAAGVSSPNFSAPVPWQELILSQLNLAGETADLKVSLGGQETV  354

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            E RL+AALR  LS+++E+V+ + + TL+SL  E   PLG ANE+A  RT+ ALCVIALGH
Sbjct  355  EARLLAALRVLLSSNVETVQKYDLSTLQSLDAE--APLGVANEIAVFRTLIALCVIALGH  412

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIM+DE+LLKQ  S +T+LAI++RIQKKSVIIDVMR+++RR+KLL SKE+ATA+
Sbjct  413  FPTKIMDDESLLKQGASGSTELAIQYRIQKKSVIIDVMRNISRRLKLLSSKETATAE  469



>gb|KCW85968.1| hypothetical protein EUGRSUZ_B02671 [Eucalyptus grandis]
Length=380

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 193/238 (81%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE+     +MLVKV+A + I  +D L LNYGCL+NDLFLLDYGFV+PSN 
Sbjct  145  HSFDPNARIVQEQGEEQPEMLVKVVAEKEIGANDPLLLNYGCLSNDLFLLDYGFVIPSNR  204

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALLDAAS+AAGV SPNFSSP+PWQ+EILSQLNL G+  DLKVT+GGP+LV
Sbjct  205  YDTIELKYDGALLDAASLAAGVSSPNFSSPAPWQQEILSQLNLYGDTADLKVTLGGPDLV  264

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L ++ ESV+ H + TLKS+S E   P G A EVAA RT+ ALCVIAL H
Sbjct  265  EGRLLAALRVLLESENESVQKHDLSTLKSISAE--APCGIATEVAAFRTIIALCVIALEH  322

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+DVMRDL+RR+K LLSKE+ +A+ 
Sbjct  323  FPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIVDVMRDLSRRIKSLLSKETVSAKG  380



>ref|XP_010556222.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Tarenaya 
hassleriana]
Length=477

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 191/238 (80%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+QE+   +   LVKVIA   I+ +D L LNYGCL ND FLLDYGFV+ SNP
Sbjct  242  HSFKPNARIIQEQSEENTNTLVKVIAETDIKENDPLMLNYGCLGNDFFLLDYGFVIESNP  301

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL+YD AL+DAASMAAGV SPNFSSPSPWQ + LS+LNL GE  +LKV IGGPELV
Sbjct  302  YDTVELKYDEALMDAASMAAGVSSPNFSSPSPWQSQFLSRLNLAGEASNLKVAIGGPELV  361

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L  +ME+V  H ++ LKSLSVE   PLG ANE+A  RTV ALC+IALGH
Sbjct  362  EGRLLAALRILLCCEMEAVEKHDINKLKSLSVE--APLGIANELAVFRTVIALCMIALGH  419

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDEA+LKQ VSATT+LA R+RIQKKSVIIDVMRDL+RRVK L SKE++ A S
Sbjct  420  FPTKIMEDEAVLKQGVSATTELAARYRIQKKSVIIDVMRDLSRRVKSLSSKETSQAAS  477



>gb|KCW85966.1| hypothetical protein EUGRSUZ_B02669 [Eucalyptus grandis]
Length=290

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 190/237 (80%), Gaps = 2/237 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE+     +MLVKV+A + I  +D L LNYGCL+NDLFLLDYGFV+PSN 
Sbjct  55   HSFDPNARIVQEQGEEQPEMLVKVVAEKEIGANDPLLLNYGCLSNDLFLLDYGFVIPSNR  114

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALLDAAS+AAGV S NFSSP+PWQ+EILSQLNL G+ PDLKVT+GGP+LV
Sbjct  115  YDTIELKYDGALLDAASLAAGVSSSNFSSPAPWQQEILSQLNLYGDTPDLKVTLGGPDLV  174

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L ++ ESV+ H + TLKS+S E   P G A EVAA  T+ ALCVIA  H
Sbjct  175  EGRLLAALRVLLESESESVQKHDLSTLKSISAE--APCGIATEVAAFHTIIALCVIASEH  232

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            FPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+DV RDL+RR+K LLSKE+ +A+
Sbjct  233  FPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIVDVTRDLSRRIKSLLSKETVSAK  289



>ref|XP_010043959.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Eucalyptus 
grandis]
 gb|KCW85967.1| hypothetical protein EUGRSUZ_B02671 [Eucalyptus grandis]
Length=477

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 193/238 (81%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE+     +MLVKV+A + I  +D L LNYGCL+NDLFLLDYGFV+PSN 
Sbjct  242  HSFDPNARIVQEQGEEQPEMLVKVVAEKEIGANDPLLLNYGCLSNDLFLLDYGFVIPSNR  301

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALLDAAS+AAGV SPNFSSP+PWQ+EILSQLNL G+  DLKVT+GGP+LV
Sbjct  302  YDTIELKYDGALLDAASLAAGVSSPNFSSPAPWQQEILSQLNLYGDTADLKVTLGGPDLV  361

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L ++ ESV+ H + TLKS+S E   P G A EVAA RT+ ALCVIAL H
Sbjct  362  EGRLLAALRVLLESENESVQKHDLSTLKSISAE--APCGIATEVAAFRTIIALCVIALEH  419

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+DVMRDL+RR+K LLSKE+ +A+ 
Sbjct  420  FPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIVDVMRDLSRRIKSLLSKETVSAKG  477



>gb|KDO60744.1| hypothetical protein CISIN_1g0129692mg, partial [Citrus sinensis]
Length=214

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 178/215 (83%), Gaps = 2/215 (1%)
 Frame = -2

Query  844  KVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGV  665
            +V+A   I+++D+L LNYGCL+ND FLLDYGFV+PSNPYD IEL+Y+ AL+DAASMAAGV
Sbjct  1    QVVAETEIKQNDSLLLNYGCLSNDFFLLDYGFVMPSNPYDTIELKYEGALMDAASMAAGV  60

Query  664  ESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNH  485
             SPNFSSP+ WQ+ ILSQLNL GE   +KV++GGP+LVEGRL+AALR  L++D E+V+ H
Sbjct  61   SSPNFSSPAAWQQRILSQLNLVGETAIVKVSLGGPDLVEGRLLAALRVLLASDSETVQKH  120

Query  484  SMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDL  305
             ++TL+SLS E   PLG  NEVA  RT+ ALC IAL HFPTKIMEDE+L KQ VSA+T L
Sbjct  121  DLNTLQSLSAE--APLGITNEVAVFRTIIALCAIALEHFPTKIMEDESLRKQGVSASTVL  178

Query  304  AIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQ  200
            AI+FRIQKK++IID+MR+L++RVKLL SKE+   Q
Sbjct  179  AIQFRIQKKTLIIDIMRNLSKRVKLLSSKETTATQ  213



>ref|XP_010046478.1| PREDICTED: uncharacterized protein LOC104435421 [Eucalyptus grandis]
Length=400

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 190/238 (80%), Gaps = 2/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE+     +MLVKV+A + I  +D L LNYGCL+NDLFLLDYGFV+PSN 
Sbjct  165  HSFDPNARIVQEQGEEQPEMLVKVVAEKEIGANDPLLLNYGCLSNDLFLLDYGFVIPSNR  224

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALLDAAS+AAGV S NFSSP+PWQ+EILSQLNL G+ PDLKVT+GGP+LV
Sbjct  225  YDTIELKYDGALLDAASLAAGVSSSNFSSPAPWQQEILSQLNLYGDTPDLKVTLGGPDLV  284

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AALR  L ++ ESV+ H + TLKS+S E   P G A EVAA  T+ ALCVIA  H
Sbjct  285  EGRLLAALRVLLESESESVQKHDLSTLKSISAE--APCGIATEVAAFHTIIALCVIASEH  342

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIMEDE++LK+ V  TT LAI FRIQKKS+I+DV RDL+RR+K LLSKE+ +A+ 
Sbjct  343  FPTKIMEDESMLKKGVPDTTKLAITFRIQKKSLIVDVTRDLSRRIKSLLSKETVSAKG  400



>ref|XP_004150615.1| PREDICTED: uncharacterized protein LOC101210959 [Cucumis sativus]
 gb|KGN51466.1| hypothetical protein Csa_5G561260 [Cucumis sativus]
Length=483

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 184/231 (80%), Gaps = 3/231 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA I+QE++A   K+ VKV+A   I+ +  L LNYGCL+NDLFLLDYGFVVPSN 
Sbjct  251  HSFNSNARIIQEQDAS-MKLKVKVVAETEIEENAPLTLNYGCLDNDLFLLDYGFVVPSNQ  309

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQR IL++LNL GE   LKV+IGG E+V
Sbjct  310  YDYIELKYDEALLEAASIVAGISSENFSSPAPWQRLILTKLNLHGEAALLKVSIGGSEIV  369

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LS D E V+ H +  LKSLS E   PLG ANEVAALRTV ALCVIALGH
Sbjct  370  DGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--APLGIANEVAALRTVIALCVIALGH  427

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSK  218
            FPTKIM+DE LLK+  S T+ LAI+FR+QKKSVIIDVM +LTRRVKLL SK
Sbjct  428  FPTKIMDDETLLKKCESETSKLAIQFRLQKKSVIIDVMSNLTRRVKLLSSK  478



>ref|XP_008467099.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Cucumis melo]
Length=423

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 183/231 (79%), Gaps = 3/231 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA I+QE++A   K+ VKV+A   I+ +  L LNYGCL+NDLFLLDYGFV+PSN 
Sbjct  191  HSFNSNARIIQEQDAS-MKLKVKVVAETEIEGNAPLTLNYGCLDNDLFLLDYGFVLPSNQ  249

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQ+ IL++LNL GE   LKV+IGG E+V
Sbjct  250  YDYIELKYDEALLEAASIVAGISSENFSSPAPWQKFILTKLNLHGEAALLKVSIGGSEVV  309

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LS D E V+ H +  LKSLS E   PLG ANEVAALRTV ALCVIALGH
Sbjct  310  DGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--APLGIANEVAALRTVIALCVIALGH  367

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSK  218
            FPTKIMEDE LLK+  S T+ LAI+FR+QKKSVIID M +LTRRVKLL SK
Sbjct  368  FPTKIMEDETLLKKCESETSKLAIQFRLQKKSVIIDAMSNLTRRVKLLSSK  418



>ref|XP_008467097.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Cucumis melo]
Length=483

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 183/231 (79%), Gaps = 3/231 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA I+QE++A   K+ VKV+A   I+ +  L LNYGCL+NDLFLLDYGFV+PSN 
Sbjct  251  HSFNSNARIIQEQDAS-MKLKVKVVAETEIEGNAPLTLNYGCLDNDLFLLDYGFVLPSNQ  309

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQ+ IL++LNL GE   LKV+IGG E+V
Sbjct  310  YDYIELKYDEALLEAASIVAGISSENFSSPAPWQKFILTKLNLHGEAALLKVSIGGSEVV  369

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LS D E V+ H +  LKSLS E   PLG ANEVAALRTV ALCVIALGH
Sbjct  370  DGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--APLGIANEVAALRTVIALCVIALGH  427

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSK  218
            FPTKIMEDE LLK+  S T+ LAI+FR+QKKSVIID M +LTRRVKLL SK
Sbjct  428  FPTKIMEDETLLKKCESETSKLAIQFRLQKKSVIIDAMSNLTRRVKLLSSK  478



>ref|XP_008467098.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Cucumis melo]
Length=481

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 181/231 (78%), Gaps = 5/231 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA I+QE+   D  M +KV+A   I+ +  L LNYGCL+NDLFLLDYGFV+PSN 
Sbjct  251  HSFNSNARIIQEQ---DASMKLKVVAETEIEGNAPLTLNYGCLDNDLFLLDYGFVLPSNQ  307

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+YD ALL+AAS+ AG+ S NFSSP+PWQ+ IL++LNL GE   LKV+IGG E+V
Sbjct  308  YDYIELKYDEALLEAASIVAGISSENFSSPAPWQKFILTKLNLHGEAALLKVSIGGSEVV  367

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LS D E V+ H +  LKSLS E   PLG ANEVAALRTV ALCVIALGH
Sbjct  368  DGRLLAALRVLLSVDEEMVQKHDLSVLKSLSAE--APLGIANEVAALRTVIALCVIALGH  425

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSK  218
            FPTKIMEDE LLK+  S T+ LAI+FR+QKKSVIID M +LTRRVKLL SK
Sbjct  426  FPTKIMEDETLLKKCESETSKLAIQFRLQKKSVIIDAMSNLTRRVKLLSSK  476



>ref|XP_010906939.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Elaeis guineensis]
Length=492

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 188/236 (80%), Gaps = 3/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA+IVQE++     M +KV+A   I++   + LNYGCL+NDLFLLDYGFV+PSNP
Sbjct  260  HSFQPNAQIVQEQDINSPNMSIKVVAETPIEQDTPVMLNYGCLSNDLFLLDYGFVIPSNP  319

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            +D +EL+YD  LLDAASMAAGV SP+FSSP+ WQ+EILSQLNL G     KV++GGP+LV
Sbjct  320  FDYVELKYDGTLLDAASMAAGVSSPSFSSPNYWQKEILSQLNLQGVQALPKVSLGGPQLV  379

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LSND E+V+ H ++ L SLS E   PLG   EVAALRTV AL VIAL H
Sbjct  380  DGRLLAALRVLLSNDKETVQGHDLNALMSLSEE--APLGVPIEVAALRTVIALSVIALEH  437

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDE++LK+ +S++ +LAI+FR+QKK +IIDVMR LT+RVK +LS+E +TA
Sbjct  438  FPTKIMEDESILKKKLSSSKELAIQFRMQKKLMIIDVMRKLTKRVK-MLSEEKSTA  492



>ref|XP_010681928.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Beta vulgaris 
subsp. vulgaris]
Length=491

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 182/233 (78%), Gaps = 2/233 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA+I+Q + A   KMLVKV+A +HI+R   +ELNYG ++NDLFLLDYGFV+ +NP
Sbjct  257  HSFCPNAKIIQSQGAEKAKMLVKVVAEKHIKRDAPVELNYGNMSNDLFLLDYGFVITANP  316

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD IEL+Y  ALLDAAS+  GV SP F+SP+ WQ EILS L LD E   +KVT+GGP+LV
Sbjct  317  YDSIELQYQAALLDAASVIVGVSSPYFTSPASWQLEILSALKLDSEGSSIKVTLGGPDLV  376

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +G L+AA R   ++D +SV  H + TL+ LS E   PLG +NE+AAL+T+  LC++ L +
Sbjct  377  DGLLLAASRVLHASDAKSVSKHELSTLQLLSAE--APLGISNELAALKTMIGLCLVILQN  434

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKES  212
            FPT+IMEDEALLK+ VS+ ++LAI+FR++KKS+I++VMR+L+ RVKLL ++ES
Sbjct  435  FPTQIMEDEALLKEGVSSFSELAIKFRLEKKSLIVNVMRELSERVKLLQARES  487



>ref|XP_008809406.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Phoenix 
dactylifera]
Length=491

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/236 (64%), Positives = 185/236 (78%), Gaps = 3/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE++     M +KV+A   I++   + LNYGCL+NDLFLLDYGFV+PSNP
Sbjct  259  HSFQPNARIVQEQDLDSPNMSLKVVAETPIEQDTPVMLNYGCLSNDLFLLDYGFVIPSNP  318

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            +D +EL+YD  LLDAASMAAGV +P+F SP  WQ EILSQLNL G+   LKV++GGPELV
Sbjct  319  FDYVELKYDGTLLDAASMAAGVSTPSFLSPKHWQEEILSQLNLQGDQALLKVSLGGPELV  378

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LSND E+ + H ++TL SLS E   PLG   EVAALRTV AL VIAL H
Sbjct  379  DGRLLAALRVLLSNDEETAQRHDLNTLMSLSEE--APLGVPIEVAALRTVIALSVIALEH  436

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            FPTKIMEDE++LK NVS++ +LAI+FR+QKK +I DVMR LT+RVK +LS+E +TA
Sbjct  437  FPTKIMEDESILKGNVSSSKELAIQFRMQKKLMIKDVMRKLTQRVK-MLSEEKSTA  491



>ref|XP_006647850.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Oryza 
brachyantha]
Length=486

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 172/228 (75%), Gaps = 2/228 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE       M VKV+A   I ++ A+ LNYGC +ND FLLDYGFV+ SNP
Sbjct  254  HSFNPNARIVQEGNVDSTDMSVKVVAETKINQTAAVTLNYGCYHNDFFLLDYGFVITSNP  313

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD  LLDAASMAAGV SPNFS+P+ WQR+ILSQLNL GE   LKV+IGGP++V
Sbjct  314  YDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQRDILSQLNLYGEGAILKVSIGGPDIV  373

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  ++ D E+V  H +  L  +S++ + PLG A E + LRT+ ALC  AL H
Sbjct  374  DGRLLAALRVIIAADPEAVSGHDLKIL--MSLKEKAPLGPAVEASVLRTLLALCTFALQH  431

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
            F TKIMEDEA+LK     TT+LA++FR+QKK +++DV+++L+RR+K+L
Sbjct  432  FHTKIMEDEAILKGEPPLTTELAVQFRLQKKLLLLDVIQNLSRRIKML  479



>gb|EEC73951.1| hypothetical protein OsI_08832 [Oryza sativa Indica Group]
Length=486

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 173/228 (76%), Gaps = 2/228 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE       M VKV+A   I ++ A+ LNYGC  ND FLLDYGFV+ SN 
Sbjct  254  HSFNPNARIVQEGNVDSPDMSVKVVAETKIDQNAAVTLNYGCYPNDFFLLDYGFVITSNS  313

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD  LLDAASMAAGV SPNFS+P+ WQ++ILSQLNL GE   LKV+IGGPE+V
Sbjct  314  YDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQQDILSQLNLYGEGAILKVSIGGPEIV  373

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  ++ D ++V  H + TL  +S++ + PLG A E +ALRTV ALC  AL H
Sbjct  374  DGRLLAALRVIIAADPDAVSGHDLKTL--MSLKEKAPLGPAVEASALRTVLALCTFALQH  431

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
            F TKIMEDEA+LK+    TT+LA++FR+QKK +++DV+++L+RR+K+L
Sbjct  432  FHTKIMEDEAILKREPPLTTELAVQFRLQKKLLLLDVIQNLSRRIKML  479



>ref|NP_001048036.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAD16153.1| SET domain-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF09950.1| Os02g0733800 [Oryza sativa Japonica Group]
 dbj|BAH00588.1| unnamed protein product [Oryza sativa Japonica Group]
Length=486

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 172/228 (75%), Gaps = 2/228 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE       M VKV+A   I ++ A+ LNYGC  ND FLLDYGFV+ SN 
Sbjct  254  HSFNPNARIVQEGNVDSPDMSVKVVAETKIDQNAAVTLNYGCYPNDFFLLDYGFVITSNS  313

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD  LLDAASMAAGV SPNFS+P+ WQ++ILSQLNL GE   LKV+IGGPE+V
Sbjct  314  YDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQQDILSQLNLYGEGAILKVSIGGPEIV  373

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  ++ D ++V  H + TL  +S++ + PLG A E +ALRTV ALC  AL H
Sbjct  374  DGRLLAALRVIIAADPDAVSGHDLKTL--MSLKEKAPLGPAVEASALRTVLALCTFALQH  431

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
            F TKIMEDEA+LK     TT+LA++FR+QKK +++DV+++L+RR+K+L
Sbjct  432  FHTKIMEDEAILKGEPPLTTELAVQFRLQKKLLLLDVIQNLSRRIKML  479



>gb|ACF87938.1| unknown [Zea mays]
Length=352

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 177/233 (76%), Gaps = 2/233 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQER      M VKV+A + I++++A+ LNYGC  ND FLLDYGFV+  NP
Sbjct  120  HSFNPNARIVQERSVNSLDMSVKVLAEKKIKQNEAITLNYGCYPNDFFLLDYGFVITQNP  179

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD ALLDAASMAAGV SPNFS+P+ WQ++ILSQLNL GE   LKV++GGP++V
Sbjct  180  YDQVELSYDGALLDAASMAAGVSSPNFSAPAKWQQDILSQLNLHGEGAVLKVSLGGPDVV  239

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L++D E+V  H ++TL SL V  Q PLG   E +ALRTV ALC IAL H
Sbjct  240  DGRLLAALRVLLADDPEAVHKHDLNTLMSLDV--QVPLGPTVEASALRTVLALCAIALQH  297

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKES  212
            F TKIM+D+A+L       T LA++FR+QKK  I+DVM++++RR+K+L  ++S
Sbjct  298  FHTKIMDDQAILGGGPPLITQLAVQFRLQKKFTIVDVMQNISRRIKMLSPQKS  350



>ref|NP_001151430.1| SET domain containing protein [Zea mays]
 gb|ACG42857.1| SET domain containing protein [Zea mays]
 gb|AFW63825.1| SET domain containing protein [Zea mays]
Length=491

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 177/233 (76%), Gaps = 2/233 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQER      M VKV+A + I++++A+ LNYGC  ND FLLDYGFV+  NP
Sbjct  259  HSFNPNARIVQERSVNSLDMSVKVLAEKKIKQNEAITLNYGCYPNDFFLLDYGFVITQNP  318

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD ALLDAASMAAGV SPNFS+P+ WQ++ILSQLNL GE   LKV++GGP++V
Sbjct  319  YDQVELSYDGALLDAASMAAGVSSPNFSAPAKWQQDILSQLNLHGEGAVLKVSLGGPDVV  378

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L++D E+V  H ++TL SL V  Q PLG   E +ALRTV ALC IAL H
Sbjct  379  DGRLLAALRVLLADDPEAVHKHDLNTLMSLDV--QVPLGPTVEASALRTVLALCAIALQH  436

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKES  212
            F TKIM+D+A+L       T LA++FR+QKK  I+DVM++++RR+K+L  ++S
Sbjct  437  FHTKIMDDQAILGGGPPLITQLAVQFRLQKKFTIVDVMQNISRRIKMLSPQKS  489



>emb|CDY66565.1| BnaAnng22450D [Brassica napus]
Length=366

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 169/237 (71%), Gaps = 4/237 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAG-DGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSN  734
            HSF PN +I+Q+++ G D   LVKV+A   ++ +D L LNYGCL+ND FLLDYGFVV SN
Sbjct  132  HSFSPNVKIIQDQDDGSDSNTLVKVVAETQVKENDQLLLNYGCLSNDSFLLDYGFVVESN  191

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPEL  554
            PYD IEL YD  LLDAAS+A G  S  FSSP+PWQ ++LSQLNL G+ P+LKVT+GG E 
Sbjct  192  PYDTIELNYDEGLLDAASLAVGFASGKFSSPAPWQHQLLSQLNLAGKMPNLKVTLGGQET  251

Query  553  VEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALG  374
            V+GRL+AA+R  LS ++  V  H ++ LKSLS     PLG ANE+A  +TV   CV+A  
Sbjct  252  VDGRLLAAIRILLSGELVEVEKHDLEALKSLS--SVAPLGIANEIATFQTVMVFCVLA-N  308

Query  373  HFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
               +++ + EA+LKQ VS T +L I++RIQKKSV   V+ DL RRVKLL ++E+  A
Sbjct  309  VVLSRLEDHEAILKQGVSDTAELIIKYRIQKKSVFSGVIEDLRRRVKLLSAQETPNA  365



>ref|XP_004953834.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Setaria 
italica]
Length=485

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 177/236 (75%), Gaps = 3/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE       M VKV+A   I+++ A+ LNYGC  ND FLLDYGFV+  NP
Sbjct  253  HSFDPNARIVQEGNVNSSDMSVKVVAETKIEKNAAITLNYGCHPNDFFLLDYGFVIAPNP  312

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD AL DAASMAAGV SPNFS+P+ WQ++ILSQLNL GE   LKV++GGP++V
Sbjct  313  YDLVELSYDGALFDAASMAAGVSSPNFSAPAKWQQDILSQLNLHGEGAILKVSLGGPDIV  372

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L+ D E+V  H + T+  +S++ Q PLG   E +ALRTV ALC IAL H
Sbjct  373  DGRLLAALRVLLAADPEAVHKHDLKTM--MSLDAQAPLGPTVEASALRTVLALCAIALQH  430

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            F TKIMEDEA+LK     TT+LA++FR+QKK +I+DVM++++R++K +LS + +TA
Sbjct  431  FHTKIMEDEAILKGEPPLTTELAVQFRLQKKFLIVDVMQNISRKIK-MLSPQKSTA  485



>ref|XP_002454330.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
 gb|EES07306.1| hypothetical protein SORBIDRAFT_04g028760 [Sorghum bicolor]
Length=490

 Score =   257 bits (656),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 180/236 (76%), Gaps = 3/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE       M VKV+A + I+++ ++ LNYGC  ND FLLDYGFV+  NP
Sbjct  258  HSFNPNARIVQEGSVNSLDMSVKVVAEKKIEQNASITLNYGCHPNDFFLLDYGFVITPNP  317

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD  LLDAASMAAGV SPNFS+P+ WQ++ILSQLNL GE   LKV++GGP++V
Sbjct  318  YDQVELSYDGTLLDAASMAAGVSSPNFSAPAKWQQDILSQLNLHGEGAILKVSLGGPDIV  377

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L++D E++  H + TL SL V  Q PLG A E +ALRTV ALC IAL H
Sbjct  378  DGRLLAALRVLLADDPEALHKHDLKTLMSLDV--QAPLGPAIEASALRTVLALCAIALQH  435

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            F TKIM+DEA+L+     TT+LA++FR+QKK +I+DVM++++RR+K +LS + +TA
Sbjct  436  FHTKIMDDEAILRGGPPLTTELAVQFRLQKKFMIVDVMQNVSRRIK-MLSPQKSTA  490



>ref|XP_003570495.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brachypodium 
distachyon]
Length=485

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 177/236 (75%), Gaps = 3/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQ+ +     M VKV+A   I ++  + LNYGC  ND +LLDYGFVV SNP
Sbjct  253  HSFSPNARIVQDGDVDSPDMSVKVVADTQIDQNATVTLNYGCYPNDFYLLDYGFVVTSNP  312

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD ALLDAASMAAGV SPNFS+P+ WQ++ LS+LNL GE   LKV++GGP++V
Sbjct  313  YDQVELSYDGALLDAASMAAGVSSPNFSTPAKWQQDFLSKLNLHGEGAILKVSLGGPDIV  372

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L+   E+V+ H + TL SL+   + PLG A E +ALRTV ALC IAL H
Sbjct  373  DGRLLAALRVLLAAGPETVQEHDLKTLTSLN--KKAPLGPAVESSALRTVLALCAIALQH  430

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            F TKIMEDEA+LK     TT+LA++FR+QKK +++DVM++L+RR+K LLS E +TA
Sbjct  431  FHTKIMEDEAVLKGEPPLTTELAVQFRLQKKLMLVDVMQNLSRRIK-LLSPEKSTA  485



>dbj|BAK03360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 175/236 (74%), Gaps = 3/236 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQ+ +     M VKVIA   I ++ A+ LNYGC  ND +LLDYGFVV SNP
Sbjct  253  HSFSPNARIVQDGDVESPDMSVKVIAETQIDQNAAVTLNYGCYPNDFYLLDYGFVVTSNP  312

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL YD  LLDAASMAAGV +PNFS+P+ WQ+EILSQLNL GE   LKV++GGP++V
Sbjct  313  YDQVELSYDGNLLDAASMAAGVSNPNFSTPAKWQQEILSQLNLHGEGAILKVSLGGPDIV  372

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L+ D E+V  H + TL SLS   + PLG   E +A RTV ALC IAL H
Sbjct  373  DGRLLAALRVLLAADPEAVGKHDLKTLMSLSA--KAPLGPTVEASAFRTVLALCAIALQH  430

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
            F TKIM+D+A+LK     TT+LA++FR+QKK +++D+M++L+RR+K  LS E +TA
Sbjct  431  FHTKIMDDQAILKGEPPLTTELAVQFRLQKKLMLVDIMQNLSRRIK-TLSPEKSTA  485



>ref|XP_006828432.2| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X1 
[Amborella trichopoda]
Length=483

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 173/237 (73%), Gaps = 4/237 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSFHPNA I+QE+ + +   L+KV+A   +++   + LNYGCL+NDLFLLDYGFV+P NP
Sbjct  246  HSFHPNARIIQEKGSNEHDFLIKVVAETQMEQDAPVLLNYGCLSNDLFLLDYGFVLPKNP  305

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL+YD  LLDAAS+AAG+ S N SSPSPWQ++IL++L L+G   D KV +GGPE+V
Sbjct  306  YDFVELKYDGGLLDAASLAAGIFSANISSPSPWQQQILTELKLEGTGADHKVRLGGPEVV  365

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L+++ E V+  +   L+S S +  PPLG + E++ALRTV  LC I+L H
Sbjct  366  DGRLLAALRVLLADNAEDVKQINQTALQSFSSD--PPLGVSIEISALRTVLGLCAISLQH  423

Query  370  FPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESAT  206
            FPT I EDE  LK  + +    + A+RFR++KK++IID MRD+TRR+  L  ++  T
Sbjct  424  FPTMIAEDEKALKNGEKIFPAMESALRFRMRKKTLIIDTMRDITRRLNSLSEQKVCT  480



>ref|XP_011628004.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X2 
[Amborella trichopoda]
 gb|ERM95848.1| hypothetical protein AMTR_s00060p00101960 [Amborella trichopoda]
Length=480

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 170/230 (74%), Gaps = 4/230 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSFHPNA I+QE+ + +   L+KV+A   +++   + LNYGCL+NDLFLLDYGFV+P NP
Sbjct  246  HSFHPNARIIQEKGSNEHDFLIKVVAETQMEQDAPVLLNYGCLSNDLFLLDYGFVLPKNP  305

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL+YD  LLDAAS+AAG+ S N SSPSPWQ++IL++L L+G   D KV +GGPE+V
Sbjct  306  YDFVELKYDGGLLDAASLAAGIFSANISSPSPWQQQILTELKLEGTGADHKVRLGGPEVV  365

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L+++ E V+  +   L+S S +  PPLG + E++ALRTV  LC I+L H
Sbjct  366  DGRLLAALRVLLADNAEDVKQINQTALQSFSSD--PPLGVSIEISALRTVLGLCAISLQH  423

Query  370  FPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
            FPT I EDE  LK  + +    + A+RFR++KK++IID MRD+TRR+  L
Sbjct  424  FPTMIAEDEKALKNGEKIFPAMESALRFRMRKKTLIIDTMRDITRRLNSL  473



>ref|XP_011628008.1| PREDICTED: histone-lysine N-methyltransferase setd3 isoform X3 
[Amborella trichopoda]
Length=477

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/230 (54%), Positives = 170/230 (74%), Gaps = 4/230 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSFHPNA I+QE+ + +   L+KV+A   +++   + LNYGCL+NDLFLLDYGFV+P NP
Sbjct  246  HSFHPNARIIQEKGSNEHDFLIKVVAETQMEQDAPVLLNYGCLSNDLFLLDYGFVLPKNP  305

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            YD +EL+YD  LLDAAS+AAG+ S N SSPSPWQ++IL++L L+G   D KV +GGPE+V
Sbjct  306  YDFVELKYDGGLLDAASLAAGIFSANISSPSPWQQQILTELKLEGTGADHKVRLGGPEVV  365

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  L+++ E V+  +   L+S S +  PPLG + E++ALRTV  LC I+L H
Sbjct  366  DGRLLAALRVLLADNAEDVKQINQTALQSFSSD--PPLGVSIEISALRTVLGLCAISLQH  423

Query  370  FPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
            FPT I EDE  LK  + +    + A+RFR++KK++IID MRD+TRR+  L
Sbjct  424  FPTMIAEDEKALKNGEKIFPAMESALRFRMRKKTLIIDTMRDITRRLNSL  473



>gb|ADE75732.1| unknown [Picea sitchensis]
Length=320

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 162/226 (72%), Gaps = 3/226 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            H+F+PNA +VQE + G  K  VKV++ E IQ    + L+YG L NDLFL+DYGFVV  N 
Sbjct  82   HNFNPNARVVQETDYGSDKAFVKVVSEEQIQEHAPILLDYGPLTNDLFLIDYGFVVSKNQ  141

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            +D +EL+YD ALLDAA+  AGV S  F+SP+ WQ+EIL QL + G+    KVT+GG +LV
Sbjct  142  HDYVELKYDRALLDAAAAIAGVRSDAFASPARWQQEILCQLKVQGDQAVEKVTLGGVDLV  201

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +G L+AALR   + D+ES+  H +  L+SL++E   PLG ANE   LRT+ ALC I+LGH
Sbjct  202  DGHLLAALRVLFAEDLESIEKHDLINLQSLAME--APLGAANESNVLRTIIALCAISLGH  259

Query  370  FPTKIMEDEALL-KQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRV  236
            FPTKIMEDE LL K+  S    LA+ +RI+KK ++IDVMRDLTRR+
Sbjct  260  FPTKIMEDEMLLRKEGNSEAMKLAVEYRIKKKEMLIDVMRDLTRRL  305



>ref|XP_009113823.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=468

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 164/237 (69%), Gaps = 10/237 (4%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAG-DGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSN  734
            HSF PN +I+Q+++ G D   LVKV+A   ++ +D L LNYGCL      LDYGFVV SN
Sbjct  240  HSFSPNVKIIQDQDDGSDSNTLVKVVAETQVKENDQLLLNYGCL------LDYGFVVESN  293

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPEL  554
            PYD IEL YD  LLDAAS+A G  S  FSSP+PWQ ++LSQLNL G+ P+LKVT+GG E 
Sbjct  294  PYDTIELNYDEGLLDAASLAVGFASGKFSSPAPWQHQLLSQLNLAGKMPNLKVTLGGQET  353

Query  553  VEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALG  374
            V+GRL+AA+R  LS ++  V  H ++ LKSLS     PLG ANE+A  +TV   CV+A  
Sbjct  354  VDGRLLAAIRILLSGELVEVEKHDLEALKSLS--SVAPLGIANEIATFQTVMVFCVLA-N  410

Query  373  HFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATA  203
               +++ + EA+LKQ VS T +L I++RIQKKSV   V+ DL RRVKLL ++E+  A
Sbjct  411  VVLSQLEDHEAILKQGVSDTAELIIKYRIQKKSVFSGVIEDLRRRVKLLSAQETPNA  467



>gb|EMT12546.1| hypothetical protein F775_52053 [Aegilops tauschii]
Length=500

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 175/257 (68%), Gaps = 24/257 (9%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVK---------------------VIAAEHIQRSDALELN  794
            HSF PNA IVQE +     M VK                     V+A   I ++ A+ LN
Sbjct  247  HSFSPNARIVQEGDVESPDMSVKASSNEINRTPVTTVPWIIVEVVVAETQIDQNAAVTLN  306

Query  793  YGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILS  614
            YGC  ND +LLDYGFVV SNPYD +EL YD  LLDAASMAAGV +PNFS+P+ WQ++ILS
Sbjct  307  YGCYPNDFYLLDYGFVVTSNPYDQVELSYDGNLLDAASMAAGVSNPNFSTPAKWQQDILS  366

Query  613  QLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLG  434
            QLNL GE   LKV++GGP++V+G L+AALR  L+ D ++V  H ++TL SL    + PLG
Sbjct  367  QLNLHGEGAVLKVSLGGPDVVDGHLLAALRVLLAADPDTVGKHDLETLMSLGT--KAPLG  424

Query  433  TANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMR  254
               E +ALRTV ALC IAL HF TKIM+D+A+LK     TT+LA++FR+QKK +++D+M+
Sbjct  425  PTVEASALRTVLALCAIALQHFHTKIMDDQAVLKGEPPLTTELAVQFRLQKKLMLVDIMQ  484

Query  253  DLTRRVKLLLSKESATA  203
            +L+RR+K  LS E +TA
Sbjct  485  NLSRRIK-SLSPEKSTA  500



>ref|XP_009420293.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Musa acuminata 
subsp. malaccensis]
Length=490

 Score =   231 bits (588),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 182/238 (76%), Gaps = 3/238 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA IVQE+      M +KV+A   I++   + LNYG L+ND FLLDYGFV+PSNP
Sbjct  256  HSFAPNARIVQEQNMNKQNMSIKVVADTQIKQDTHVLLNYGSLSNDFFLLDYGFVIPSNP  315

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
            +D +EL+YD ALLDAAS+AAGV S +F SPS WQ++ILS+LNL G+   LKVT+GGP LV
Sbjct  316  HDHVELKYDEALLDAASLAAGVSSSSFLSPSDWQQDILSRLNLRGDEALLKVTLGGPGLV  375

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  LS++ E+V+ H +DTL SLS E   PLG + EVAALRTV +LCV+AL  
Sbjct  376  DGRLLAALRVLLSSNKETVQRHDLDTLMSLSEE--APLGMSTEVAALRTVISLCVVALES  433

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKESATAQS  197
            FPTKIM+DE++ K  +S +T+LA+RFR+QKK  IIDVMR LT++VK  +SK   TAQ+
Sbjct  434  FPTKIMQDESIFKTAISYSTELAVRFRMQKKLTIIDVMRKLTQKVK-KISKMELTAQN  490



>gb|EPS70598.1| hypothetical protein M569_04159, partial [Genlisea aurea]
Length=458

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 159/232 (69%), Gaps = 16/232 (7%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNAEIVQE E   G MLVKVIA   I+R D LELNYG LNNDLFLLDYGF+VPSNP
Sbjct  237  HSFTPNAEIVQETE---GSMLVKVIAESEIKRGDPLELNYGRLNNDLFLLDYGFIVPSNP  293

Query  730  YDCIELRYDPALLDAASMAAGVESP--NFSSPSPWQREILSQLNLDGENPDLKVTIGGPE  557
            YDC+E++YD  LL AA+  A  +    +FS  S W+ + LS LNL GE  DLKV IGG E
Sbjct  294  YDCVEVKYDIDLLQAAATYATTDDRGIHFSHAS-WKNKYLSLLNLAGEKSDLKVRIGGSE  352

Query  556  LVEGRLMAALRAFLSNDM---ESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            +VE RL+AALR  LS+D    ++  + ++D LKSL+        +  +  A R + ALCV
Sbjct  353  VVEDRLLAALRILLSHDYDDHDTAESFNLDALKSLTY------ASPVDADAFRVLIALCV  406

Query  385  IALGHFPTKIMEDE-ALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVK  233
            IAL  FPTKI EDE  LL+  +S TT+LA+R+R+QKK +I+  +RDL  R+K
Sbjct  407  IALHGFPTKITEDEKTLLEGKLSQTTELAVRYRLQKKGIIVSAIRDLNTRLK  458



>ref|XP_002964620.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
 gb|EFJ34953.1| hypothetical protein SELMODRAFT_81798 [Selaginella moellendorffii]
Length=464

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 144/231 (62%), Gaps = 9/231 (4%)
 Frame = -2

Query  910  HSFHPNAEIVQE--REAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPS  737
            HSF PNA I ++  R+A D   L KV+   ++++  A+ LNYG L+NDL LLDYGFV+P 
Sbjct  226  HSFQPNAHIEEDLSRDAQDVSFL-KVVTKRNLEKGSAITLNYGPLSNDLLLLDYGFVIPD  284

Query  736  NPYDCIELRYDPALLDAASMAAGVE---SPNFSSPSPWQREILSQLNLDGENPDLKVTIG  566
            NP+D IELRYD +L++ A M AG+    SP FSSP+ WQ + L QL L       KVT+G
Sbjct  285  NPHDRIELRYDGSLMENARMIAGLSRTGSPPFSSPASWQVDRLKQLGLADSGESQKVTLG  344

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            GPE V+GRL+AALR   +   E +    + +L++  VE    + + NE   LRT+  L  
Sbjct  345  GPEEVDGRLLAALRILHAESQEPLERRELVSLQAWGVESM--VSSDNEERVLRTLCGLAA  402

Query  385  IALGHFPTKIMEDEALLK-QNVSATTDLAIRFRIQKKSVIIDVMRDLTRRV  236
            I    F T I EDEA L  ++++ T+ +A++FR+ KK +++ V+  L +R+
Sbjct  403  IVFNQFKTTIEEDEAKLSDKSLAETSRIAVQFRLTKKRLVVRVLESLKKRL  453



>ref|XP_008221467.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
 ref|XP_008245923.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Prunus mume]
Length=356

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PNA I+Q+++  D KMLVKV+A   I+++D L LNYGCLNNDLFLLDYGFV+PSNP
Sbjct  246  HSFKPNAIILQDQDDRDVKMLVKVVAETGIKQNDCLVLNYGCLNNDLFLLDYGFVIPSNP  305

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLK  578
            YDCIEL+YD ALLDAASMAAGV SPNFS PSPWQ+EIL QL LDGE P LK
Sbjct  306  YDCIELKYDGALLDAASMAAGVSSPNFSVPSPWQKEILCQLKLDGEAPLLK  356



>ref|XP_002989522.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
 gb|EFJ09398.1| hypothetical protein SELMODRAFT_129980 [Selaginella moellendorffii]
Length=464

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 144/231 (62%), Gaps = 9/231 (4%)
 Frame = -2

Query  910  HSFHPNAEIVQE--REAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPS  737
            HSF PNA I ++  R+A D   L KV+   ++++  A+ LNYG L+NDL LLDYGFV+P 
Sbjct  226  HSFQPNAHIEEDLSRDAQDVSFL-KVVTKRNLEKGSAITLNYGPLSNDLLLLDYGFVIPD  284

Query  736  NPYDCIELRYDPALLDAASMAAGVE---SPNFSSPSPWQREILSQLNLDGENPDLKVTIG  566
            NP+D IELRYD +L++ A M AG+    SP FSSP+ WQ + L QL L       KVT+G
Sbjct  285  NPHDRIELRYDGSLMENARMIAGLSRTGSPPFSSPASWQVDRLKQLGLADSGESQKVTLG  344

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            GPE V+GRL+AALR   +   E +    + +L++  VE    + + NE   LRT+  L  
Sbjct  345  GPEEVDGRLLAALRILHAESQEPLERRELVSLQAWGVESM--VSSDNEERVLRTLCGLGA  402

Query  385  IALGHFPTKIMEDEALLK-QNVSATTDLAIRFRIQKKSVIIDVMRDLTRRV  236
            I    F T I EDEA L  ++++ T+ +A++FR+ KK +++ V+  L +R+
Sbjct  403  IVFNQFKTTIEEDEAKLSDKSLAETSRIAVQFRLTKKRLVVRVLESLKKRL  453



>gb|EMS47111.1| hypothetical protein TRIUR3_10865 [Triticum urartu]
Length=264

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 109/260 (42%), Positives = 148/260 (57%), Gaps = 54/260 (21%)
 Frame = -2

Query  907  SFHPNAEIVQEREAGDGKMLVK------------------------VIAAEHIQRSDALE  800
            SF PNA IVQE +     M VK                        V+A   I ++ A+ 
Sbjct  29   SFSPNARIVQEGDVESPDMSVKAIVKHVLVIFLLYDAAMHLLVEDAVVAETQIDQNAAVT  88

Query  799  LNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREI  620
            LNYGC  ND +LLDYGFVV SNPYD +EL YD  L +                       
Sbjct  89   LNYGCYPNDFYLLDYGFVVTSNPYDQVELSYDVFLYE-----------------------  125

Query  619  LSQLNLDGENPDL----KVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVE  452
             S+ ++   +PDL    +V++GGP++V+GRL+AALR  L+ D E+V  H + TL SL  E
Sbjct  126  -SEPDIFCYDPDLVTAFQVSLGGPDIVDGRLLAALRVLLAADPETVGKHDLKTLMSLGTE  184

Query  451  PQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSV  272
               PLG   E +ALRTV ALC IAL HF TKIM+D+A+LK     TT LA++FR+QKK +
Sbjct  185  A--PLGPTVEASALRTVLALCAIALQHFHTKIMDDQAVLKGEPPLTTQLAVQFRLQKKLM  242

Query  271  IIDVMRDLTRRVKLLLSKES  212
            ++D+M++L+RR+K L  ++S
Sbjct  243  LVDIMQNLSRRIKTLAPEKS  262



>ref|XP_001759585.1| predicted protein [Physcomitrella patens]
 gb|EDQ75497.1| predicted protein [Physcomitrella patens]
Length=340

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 140/225 (62%), Gaps = 3/225 (1%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF P   ++Q         +++V+A + +++ + + LNYG L+ND+ LLDYGFV+P NP
Sbjct  115  HSFTPTGRLLQHSSESQSLPVLEVVAEKDLEKGENVVLNYGPLSNDILLLDYGFVMPKNP  174

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
             D +ELRYD  LL  A + A V   +F  P+  Q  +L++LNL G +    VT+GG ELV
Sbjct  175  NDRVELRYDDQLLHMACLVAKVNIDSFKDPTTSQLALLTRLNLHGPSSSQMVTLGGTELV  234

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            EGRL+AA+R   + D   + +  ++ L++ +    PPLG  NE   +RT+  L ++AL  
Sbjct  235  EGRLLAAVRVMHAQDPMELLDVDLEALQTWNQS--PPLGVLNERKTIRTLIGLGMLALAS  292

Query  370  FPTKIMEDEA-LLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRR  239
            FPT+I ED++ L+K ++S    LAI+FR+ KK +++D ++ L  R
Sbjct  293  FPTEIEEDQSELVKGDISENHRLAIQFRMLKKRLLLDTIKGLKAR  337



>dbj|BAD26590.1| SET-domain transcriptional regulator [Citrullus lanatus]
Length=143

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = -2

Query  619  LSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPP  440
            +++LNL GE   LKV+IGG E V GRL+A LR  LS D E+V+ H +  LKSLS E   P
Sbjct  7    ITKLNLXGEAALLKVSIGGXEXVAGRLLAXLRVLLSVDEETVQKHDLSVLKSLSAEA--P  64

Query  439  LGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDV  260
             G ANEVAALRTV ALCVIALGHFPTKIMEDE LLK+  + T+ LAI+FR+QKKSVIIDV
Sbjct  65   RGVANEVAALRTVIALCVIALGHFPTKIMEDETLLKKCENETSKLAIQFRLQKKSVIIDV  124

Query  259  MRDLTRRVKLLLSK  218
            M  LTRRVKLL SK
Sbjct  125  MSXLTRRVKLLSSK  138



>ref|XP_006448171.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
 gb|ESR61411.1| hypothetical protein CICLE_v10015103mg [Citrus clementina]
Length=373

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA+I+QE +  D ++L+KV+A   I+++D+L LNYGCL+NDLFLLDYGFV+PSNP
Sbjct  241  HSFNPNAQIIQEED--DSQLLIKVVAETEIKQNDSLLLNYGCLSNDLFLLDYGFVMPSNP  298

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTI  569
            YD IEL+Y+ AL+DAASMAAGV SPNFSSP+ WQ++ILSQLNL GE   +K+ +
Sbjct  299  YDTIELKYEGALMDAASMAAGVSSPNFSSPAAWQQQILSQLNLVGETAIVKLKL  352



>gb|EEE57758.1| hypothetical protein OsJ_08284 [Oryza sativa Japonica Group]
Length=437

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 129/228 (57%), Gaps = 51/228 (22%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+PNA IVQE       M VK  AA   Q  + L L +                    
Sbjct  254  HSFNPNARIVQEGNVDSPDMSVKANAASWQQ--EFLRLTFQL------------------  293

Query  730  YDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELV  551
                                         PS WQ++ILSQLNL GE   LKV+IGGPE+V
Sbjct  294  ----------------------------QPS-WQQDILSQLNLYGEGAILKVSIGGPEIV  324

Query  550  EGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGH  371
            +GRL+AALR  ++ D ++V  H + TL  +S++ + PLG A E +ALRTV ALC  AL H
Sbjct  325  DGRLLAALRVIIAADPDAVSGHDLKTL--MSLKEKAPLGPAVEASALRTVLALCTFALQH  382

Query  370  FPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
            F TKIMEDEA+LK     TT+LA++FR+QKK +++DV+++L+RR+K+L
Sbjct  383  FHTKIMEDEAILKGEPPLTTELAVQFRLQKKLLLLDVIQNLSRRIKML  430



>gb|ACN35906.1| unknown [Zea mays]
Length=164

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -2

Query  637  PWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLS  458
            P   +ILSQLNL GE   LKV++GGP++V+GRL+AALR  L++D E+V  H ++TL SL 
Sbjct  23   PSGNKILSQLNLHGEGAVLKVSLGGPDVVDGRLLAALRVLLADDPEAVHKHDLNTLMSLD  82

Query  457  VEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKK  278
            V  Q PLG   E +ALRTV ALC IAL HF TKIM+D+A+L       T LA++FR+QKK
Sbjct  83   V--QVPLGPTVEASALRTVLALCAIALQHFHTKIMDDQAILGGGPPLITQLAVQFRLQKK  140

Query  277  SVIIDVMRDLTRRVKLLLSKESA  209
              I+DVM++++RR+K+L  ++S 
Sbjct  141  FTIVDVMQNISRRIKMLSPQKST  163



>ref|XP_001703025.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96670.1| predicted protein [Chlamydomonas reinhardtii]
Length=471

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 127/240 (53%), Gaps = 33/240 (14%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            H+F PNAE++   E G G   V + A   I   + L L+YG L+ND   +DYGF+V  NP
Sbjct  191  HTFSPNAEVL-PLEGGGGA--VGLFARRAITEGEPLLLSYGQLSNDFLFMDYGFIVEDNP  247

Query  730  YDCIELRYDPALLDAASMAAGVE----SPNFSSPSPWQREILSQLNLDG--ENPDLKVTI  569
            YD ++LR+D  LL A ++ A V     +P   +P  WQ ++L++L L G   N +L +  
Sbjct  248  YDSVQLRFDVNLLQAGALVANVSDALGAPLDLAPRTWQLQLLAELGLVGPAANTELNIGG  307

Query  568  GGP--ELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTA  395
            GGP  EL++GRL+AA R  ++     V    ++ L ++      PLG  NE+AALRTV  
Sbjct  308  GGPGAELLDGRLLAAARIMVARADGEVSGRGVERLCAVDR----PLGRDNELAALRTVGG  363

Query  394  LCVIALGHFPTKIMEDEALLKQN------------------VSATTDLAIRFRIQKKSVI  269
            +   AL +F T + +D+ LL                      S    LA+RFR++KK ++
Sbjct  364  VLAFALSNFATTLDQDKTLLAGQPVAVPQAGGVGERELPPLASEDEALAVRFRLEKKKIL  423



>ref|XP_002955706.1| hypothetical protein VOLCADRAFT_106928 [Volvox carteri f. nagariensis]
 gb|EFJ43131.1| hypothetical protein VOLCADRAFT_106928 [Volvox carteri f. nagariensis]
Length=542

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/237 (33%), Positives = 122/237 (51%), Gaps = 32/237 (14%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            H+F PNAE++     GD    + + A   +   + L L+YG LNND   +DYGF+VP NP
Sbjct  268  HTFTPNAEVL-PLPGGD----MGLFAKSKVATGEPLLLSYGKLNNDFLFMDYGFIVPDNP  322

Query  730  YDCIELRYDPALLDAASMAAGVES----PNFSSPSPWQREILSQLNLDGENPDLKVTIGG  563
            YD ++LR+D  L+ A  + A V      P     +PW++E+L++L L G    L++ +GG
Sbjct  323  YDTVQLRFDIGLMQAGCLVANVTDAEGPPRDLVITPWRQELLTELGLAGAAATLELNLGG  382

Query  562  PELVEGRLMAALRAFLSNDMESVRNH-SMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            P+L++ RL+AA R  ++     V      + L ++      PL   NE AALR V  +  
Sbjct  383  PDLLDPRLLAAARVMVARQAGEVAGRGGAERLCAIDC----PLSRENETAALRVVGGVIA  438

Query  385  IALGHFPTKIMEDEALLKQNVSATTD------------------LAIRFRIQKKSVI  269
            +AL  F   + +D ALL   V  +T+                  LA+RF ++KK ++
Sbjct  439  VALSTFRRTLDQDLALLAGQVPPSTEADGNQRQDLAPLETADEMLAVRFCVEKKRIL  495



>ref|XP_001421544.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99837.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=488

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 126/236 (53%), Gaps = 8/236 (3%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+P+   V+  E GD    V++IA   +   + +EL+YG L+ND  LLDYGF+V  NP
Sbjct  257  HSFNPSVS-VRAIEEGDNAGGVELIARRALTSGEPIELSYGNLSNDELLLDYGFIVKDNP  315

Query  730  YDCIELRYDPALLDAASMAAGVESP---NFSSPSPWQREILSQLNLDGENPDLKVTI-GG  563
            +DC++LR+D  L++ A    G+ +      +  +PWQ   L ++ L G++P++++++ G 
Sbjct  316  FDCVKLRWDLKLIELAREIGGLAAAPIDTVAKVAPWQATALERIGLVGDDPNVELSVFGA  375

Query  562  PELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVI  383
             ++++ + +A LR   S         +      +  +    +    E+ ALRT  +L  +
Sbjct  376  GQVMDKKALAGLRVLYSKSSAEASRAADAPFGEIDAD---VVSKDTEIKALRTCMSLLAL  432

Query  382  ALGHFPTKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLLSKE  215
            ALG+F T + +DE L     S    LAI FR++KK V+   M  L   ++ L   E
Sbjct  433  ALGNFSTTLEKDEELHDAATSPQVRLAIAFRMEKKKVLAKSMARLNESIERLQRDE  488



>ref|XP_005644202.1| SET domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19658.1| SET domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 135/253 (53%), Gaps = 31/253 (12%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF PN E+    + G G   V+++A+  I+  + L L+YG L+N   LLDYGF+VP NP
Sbjct  239  HSFAPNCEV----KPGPGGS-VEMVASRDIRAEEDLLLSYGKLDNTFLLLDYGFMVPGNP  293

Query  730  YDCIELRYDPALLDAAS-MAAGVESPNFSSP----SPWQREILSQLNLDGENPDLKVTIG  566
            +D + +RYDP + +A   +A G  +P  ++P    + +Q+++L+++NL G   DL++  G
Sbjct  294  HDTVLIRYDPIMFEAGHLLAQGQGAPPDNAPDLGSATFQQQLLTEMNLLGPKADLELAFG  353

Query  565  GP-ELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
               +    RL+A  R F +     VR  S D L +       PL   NEV ALR V  + 
Sbjct  354  RSLQRCSPRLLAVARLFTAASAAEVRGRSADDLGAWDQ----PLSLINEVKALRMVAGVA  409

Query  388  VIALGHFPTKIMEDEALLKQN--VSATTDL--------------AIRFRIQKKSVIIDVM  257
             + L  FPT + +D   L+    V+A   L              A++ R +KK+V+ +V+
Sbjct  410  AMLLTRFPTTLEQDRRALEGGPAVAAEGGLPEGGPHQLAPDVRAAVQLRAEKKAVLSEVL  469

Query  256  RDLTRRVKLLLSK  218
            +D+  R++ L S+
Sbjct  470  QDIGHRIRGLASQ  482



>ref|XP_004513627.1| PREDICTED: uncharacterized protein LOC101503917 [Cicer arietinum]
Length=228

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 65/88 (74%), Gaps = 2/88 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF+ NA IVQE+E    KM VKV+A   I   D L L YGCL+NDLFLL YGF++ SNP
Sbjct  142  HSFNLNARIVQEQETSSTKMRVKVVAV--INEDDPLLLCYGCLSNDLFLLGYGFMIHSNP  199

Query  730  YDCIELRYDPALLDAASMAAGVESPNFS  647
            YDCIE +YD ALLDAAS+AA V SP F+
Sbjct  200  YDCIEFKYDGALLDAASIAARVSSPKFN  227



>ref|XP_002506068.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO67326.1| set domain protein [Micromonas sp. RCC299]
Length=513

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 87/250 (35%), Positives = 138/250 (55%), Gaps = 24/250 (10%)
 Frame = -2

Query  910  HSFHPNAEIVQEREA-GDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPS-  737
            HSF  +AE+   R A G+G   ++++A+  ++  D + LNYG L+ND FLLDYGFV    
Sbjct  267  HSFEASAEV---RAAMGEGPGAIEMVASRPLRAGDEVTLNYGNLSNDHFLLDYGFVPQGI  323

Query  736  NPYDCIELRYDPALLDAASMAAGVESPNFSSPS-PWQREILSQLNLDGENPDLKVTIGGP  560
            N +D   LR+D + L+AA   AG+    F++ + PWQ  +LS+L LD ++P++ VT    
Sbjct  324  NKHDTASLRWDVSYLEAAREVAGLAQVPFAAGTEPWQSAMLSELGLD-DDPEVLVTRDER  382

Query  559  ELVEGRLMAALRAFLSNDMESVRN-HSMDTLKSLSVEP--QPPLGTANEVAALRTVTALC  389
            + V+ RL+A +R   ++  E   +  S + L+ L      +  L    E  ALRT  A  
Sbjct  383  QPVDARLLAGIRVLYASGPEDFSSGGSGEALQPLRHGALLESTLDRTKEAYALRTAQAAL  442

Query  388  VIALGHFPTKIMEDEALLKQ------NVSATTD--------LAIRFRIQKKSVIIDVMRD  251
             +ALG+FPT + EDE  L++       +S   D        LA++FR  KK VI   M+ 
Sbjct  443  ALALGNFPTTLKEDETKLEELTAELAELSGVGDALEKENLALAVKFRKGKKEVISRAMKA  502

Query  250  LTRRVKLLLS  221
            +  R++++L+
Sbjct  503  IDERLRVVLA  512



>ref|XP_003083454.1| N-methyltransferase (ISS) [Ostreococcus tauri]
Length=492

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 119/245 (49%), Gaps = 34/245 (14%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF  +A +   RE  +G   V+++    ++    +EL YG L+ND   LDYGF+V  N 
Sbjct  248  HSFDASARV---RECENG---VELVTTRDLKAGQPIELCYGELSNDELFLDYGFIVEDNA  301

Query  730  YDCIELRYDPALLDAASMAAG-----------VESPNFSSPS--------PWQREILSQL  608
            +D ++LR+D  L++ A    G           V+  + SS S        P+Q++ L ++
Sbjct  302  FDTVKLRWDLKLIELAREIGGLATAPIGAAAAVDDEHGSSTSIDDVVLLAPFQKQALERI  361

Query  607  NLD---GENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPL  437
             L    G N +L +   G ++++ + +A LR   S         +      +       +
Sbjct  362  GLSADGGGNVELNIRASG-DVMDKKALAGLRVLYSKTAAEASRAADAPYGEIGAR---VV  417

Query  436  GTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSAT--TDLAIRFRIQKKSVIID  263
             T  E+ ALRT  AL  +ALG+FPT + ED   L+    A+    LA+R+R++KK ++I 
Sbjct  418  STDVEIKALRTSMALAALALGNFPTTLAEDRESLRDGSVASPQARLAVRYRVEKKKILIA  477

Query  262  VMRDL  248
             M  L
Sbjct  478  CMARL  482



>emb|CEG00242.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=527

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 119/245 (49%), Gaps = 34/245 (14%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF  +A +   RE  +G   V+++    ++    +EL YG L+ND   LDYGF+V  N 
Sbjct  283  HSFDASARV---RECENG---VELVTTRDLKAGQPIELCYGELSNDELFLDYGFIVEDNA  336

Query  730  YDCIELRYDPALLDAASMAAG-----------VESPNFSSPS--------PWQREILSQL  608
            +D ++LR+D  L++ A    G           V+  + SS S        P+Q++ L ++
Sbjct  337  FDTVKLRWDLKLIELAREIGGLATAPIGAAAAVDDEHGSSTSIDDVVLLAPFQKQALERI  396

Query  607  NLD---GENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPL  437
             L    G N +L +   G ++++ + +A LR   S         +      +       +
Sbjct  397  GLSADGGGNVELNIRASG-DVMDKKALAGLRVLYSKTAAEASRAADAPYGEIGAR---VV  452

Query  436  GTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSAT--TDLAIRFRIQKKSVIID  263
             T  E+ ALRT  AL  +ALG+FPT + ED   L+    A+    LA+R+R++KK ++I 
Sbjct  453  STDVEIKALRTSMALAALALGNFPTTLAEDRESLRDGSVASPQARLAVRYRVEKKKILIA  512

Query  262  VMRDL  248
             M  L
Sbjct  513  CMARL  517



>ref|XP_005843772.1| hypothetical protein CHLNCDRAFT_139898 [Chlorella variabilis]
 gb|EFN51670.1| hypothetical protein CHLNCDRAFT_139898 [Chlorella variabilis]
Length=543

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 130/286 (45%), Gaps = 74/286 (26%)
 Frame = -2

Query  910  HSFHP-NAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSN  734
            HSF   NA+I      G G  +  ++A   +Q  + + ++YG L+ND  L+DYGF+VP N
Sbjct  228  HSFQAANAKIAP----GPGGSMC-MVATRALQAGEPVLISYGALSNDFLLMDYGFIVPGN  282

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFS--------SPSP-WQREILSQLNLDGENPDL  581
            P+D ++LR+D  L++AA   AGV     +         P P WQ++ L+ L L G   + 
Sbjct  283  PHDTVQLRFDRGLIEAAKAVAGVGCTGGALDDGGAELPPLPAWQQQALASLQLAGPGANT  342

Query  580  KVTIG-------------------------GPELVEGRLMAALRAFLSNDMESVRNHSMD  476
            +VTI                          GP  V+ RL+A +R   +    ++      
Sbjct  343  EVTIRRQAARGGGNGSGSGSRNGGGEAAAEGP--VDPRLLAGVRVLCAPSAAALGG----  396

Query  475  TLKSLSVEPQPPLGTAN-------EVAALRTVTALCVIALGHF----------------P  365
              K+ SVE    LG  +       E+AALR +T LC IAL  F                P
Sbjct  397  --KAASVE---RLGRWDAPLAPAAELAALRALTGLCAIALSQFRGSLEEDAALLAAAAAP  451

Query  364  TKIMEDEALLKQNVSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
                E     ++ +     LA+RFR++KK ++++ +  ++ R++ L
Sbjct  452  AGGQEAAQQAQRQLGEDEQLAVRFRMEKKQLLLEALGTVSHRIQQL  497



>ref|XP_011399030.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
 gb|KFM26134.1| Histone-lysine N-methyltransferase setd3 [Auxenochlorella protothecoides]
Length=370

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 94/210 (45%), Gaps = 65/210 (31%)
 Frame = -2

Query  841  VIAAEHIQRSDALELNYGCLNNDLFLLDYG----FVVPSNPYDCIELRYDPALLDAASMA  674
            ++AA  ++  + + LNYG L+ND   LDYG    F+VP NP+D ++L             
Sbjct  219  LVAARQLRAGEEVSLNYGPLSNDDLFLDYGTVDGFIVPGNPHDDVQL-------------  265

Query  673  AGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESV  494
                                Q +L                    L+ A RA L  ++E +
Sbjct  266  --------------------QFDLS-------------------LIEAARA-LPAELEGL  285

Query  493  RNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMED-EALLKQNVSA  317
                  TL++L  +   PL   +E  ALRT+T LC I+L HFPT   ED E L K  +S 
Sbjct  286  ------TLRALG-DWASPLSLVSEAKALRTLTGLCAISLSHFPTTAEEDAEVLRKGGMSG  338

Query  316  TTDLAIRFRIQKKSVIIDVMRDLTRRVKLL  227
               LA++FR++KK ++   ++    R++ L
Sbjct  339  PMALAVQFRLEKKRILDAGIKACAARIREL  368



>ref|XP_003611129.1| hypothetical protein MTR_5g010630 [Medicago truncatula]
Length=106

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYG  752
            +SF+PNA IVQE+E+   KM VKV+A + I+  D L L YGCL+NDLFLLDYG
Sbjct  55   NSFNPNARIVQEQESST-KMWVKVVAEKAIKEDDPLLLWYGCLSNDLFLLDYG  106



>emb|CBJ25550.1| set domain protein [Ectocarpus siliculosus]
Length=694

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 82/182 (45%), Gaps = 15/182 (8%)
 Frame = -2

Query  847  VKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAG  668
            V +IA   +   D+LE+     +N+  L +YGFV  +   +    R++  +L AA + AG
Sbjct  339  VWLIATRPVAAGDSLEVKED-YSNERRLCNYGFVDINRRRERNHFRFEKKILRAARIHAG  397

Query  667  VESPNFSSP------SPWQREILSQLNLDGENPDLKVTIGGPEL-----VEGRLMAALRA  521
            +    F S        PWQ+  L +L LDG   DL V +GG        V+GRL+AALR 
Sbjct  398  ILDEQFGSKFEQDGLEPWQQRALIELKLDGPEQDLTVYLGGDSTSGRLPVDGRLLAALRV  457

Query  520  FLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEA  341
              +    S R     T+  LS      L    E   L TV  L  +    +P+   +DE 
Sbjct  458  MFTR---SRREMEGKTVSELSRYKTGKLSDYVERRVLATVLGLVSVYGQRWPSTQEQDEE  514

Query  340  LL  335
            +L
Sbjct  515  IL  516



>ref|XP_010051807.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Eucalyptus grandis]
 gb|KCW75640.1| hypothetical protein EUGRSUZ_D00007 [Eucalyptus grandis]
Length=490

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 103/238 (43%), Gaps = 49/238 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V + A + I++ D + +NY G   N++F+  YGF  P N
Sbjct  292  HSFEPNCFL--HWRFKDRMLEVMINAGQRIRKGDEMTINYLGSQKNNMFMQRYGFSSPVN  349

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDG-------ENPDLKV  575
            P+D IE           S  A +   +F          LS  ++ G       ++PD   
Sbjct  350  PWDAIEF----------SGNARIHLDSF----------LSVFDIAGLPDEYYHKSPDHLA  389

Query  574  TIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTA  395
             + G   V+G ++AA RA                L + S    P + +    AA + +  
Sbjct  390  NVRG-TFVDGAVLAAARA----------------LPTWSDRDLPAVPSVERKAA-KELQE  431

Query  394  LCVIALGHFPTKIMEDEALLKQN-VSATTDLAIRFRIQKKSVIIDVMRDLTRRVKLLL  224
             C   L  FPT + +D+ +L     S T++ AI++R+ +K  I  V+R L    +LLL
Sbjct  432  ECQRMLAQFPTTLEQDQEILDSTPQSRTSEAAIKYRLHRKLYIQKVIRALDMYQELLL  489



>emb|CDP04370.1| unnamed protein product [Coffea canephora]
Length=497

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 97/225 (43%), Gaps = 40/225 (18%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I+R D + +NY     N+LF+  YGF  P N
Sbjct  300  HSFQPNCFF--HWRFKDRMLEVMINAGQRIRRGDEMTVNYMSGWKNNLFMQRYGFSSPVN  357

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGE-NPDLKVTIGGPE  557
            P+D I+           S  A +   +F S       + +   L GE   + +++  G  
Sbjct  358  PWDVIQF----------SGGARIHLDSFLS-------VFNISGLPGEYYHNSRLSTNGDN  400

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA R             +M T     V P P +    E  A + +   C + L
Sbjct  401  FVDGAVLAAAR-------------TMPTWSDGDVPPIPSI----ERKAAKELQEECQLML  443

Query  376  GHFPTKIMEDEALLKQNVSA--TTDLAIRFRIQKKSVIIDVMRDL  248
              +PT   ED+ +L     A  T + AI++R+ +K +I  V++ L
Sbjct  444  AEYPTTAKEDQQILDSMPEARRTLEAAIKYRLHRKLLIEKVIQAL  488



>emb|CBJ32910.1| conserved unknown protein [Ectocarpus siliculosus]
Length=247

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 85/189 (45%), Gaps = 25/189 (13%)
 Frame = -2

Query  799  LNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREI  620
            ++YG  +ND  L  YGFV   NP D   +     L+D  S   G +S          RE 
Sbjct  54   ISYGPRSNDHLLRRYGFVEQDNPNDVYRI---TGLIDKLSDVLGKDSVRV------LRES  104

Query  619  LSQLNLDGENPDLK----VTIGGPELV----EGRLMAALR-AFLSNDMESVRNHSMDTLK  467
              +L   G+N + +    VT+G   L+    EGR+M   R A + +D       +  +LK
Sbjct  105  GGKLGTTGDNAEGRPVESVTVGRSGLLGEKEEGRVMPVFRLAVVKDDQLPEGKAAGISLK  164

Query  466  SLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK---QNVSATTDLAIR  296
              S E  P    ANE AA   +  LC+     F T + EDEA L     ++ A   +A  
Sbjct  165  DFSNEISP----ANEAAARDALRKLCIKEREGFATTLAEDEAYLSSLGNSLGAQKRVAFS  220

Query  295  FRIQKKSVI  269
            FR++KK V+
Sbjct  221  FRMEKKRVL  229



>ref|XP_008812568.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Phoenix dactylifera]
Length=485

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 95/230 (41%), Gaps = 49/230 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V + A + +++ D + +NY     ND+F+  YGF  P+N
Sbjct  287  HSFQPNCFL--HWRFRDRMLEVMINAGQRVKKGDEMTINYMSGQKNDVFMERYGFSSPTN  344

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDG-----ENPDLKVT  572
            P+D I                     NFSS S    +  LS  N+ G      +  L  +
Sbjct  345  PWDVI---------------------NFSSSSKIHLDSFLSVFNISGLPEEFYHNGLLSS  383

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
                  V G ++AA R                TL + S    PP+ +    AA R +   
Sbjct  384  GEDNNFVNGAVIAAAR----------------TLPTWSDGDMPPIPSLERKAA-RELREE  426

Query  391  CVIALGHFPTKIMEDEALLKQN--VSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   ED+ +L  N   S T + AI++R+ +K  +  V+R L
Sbjct  427  CHHMLAEFPTTSQEDQQILDSNPEASRTREAAIKYRLHRKLFLEKVIRAL  476



>gb|KIY92646.1| lysine N-methylase, partial [Monoraphidium neglectum]
Length=338

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 75/163 (46%), Gaps = 37/163 (23%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNP  731
            HSF  NAEI  + E+GD    V +IA + +   + L L YG  +N   LL YGF+VP NP
Sbjct  182  HSFESNAEIRAD-ESGD----VSMIANKRVAAGEPLLLRYGTHSNADLLLSYGFIVPDNP  236

Query  730  YDCIELRYDP-ALLDAASMAAGVESPNFSSPS----PWQREILSQLNL------------  602
            +D     +D   +L A     G  S   + PS     WQR +L+ + L            
Sbjct  237  FDSFSFPFDADFVLGAVQQFVGTTSVT-ARPSDGLKTWQRSVLADMGLIDPQRQQQQQQQ  295

Query  601  -----------DG--ENPDLKVTIGGPELVEGRLMAALRAFLS  512
                       DG   +P + V++GG   V+G L+AA R  LS
Sbjct  296  QQQQQQQQQGADGAPASPPV-VSVGGDPPVQGALLAACRVMLS  337



>gb|AES94087.2| histone-lysine N-methyltransferase [Medicago truncatula]
Length=104

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 3/53 (6%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYG  752
            +SF+PNA IVQE+E+   KM V  +A + I+  D L L YGCL+NDLFLLDYG
Sbjct  55   NSFNPNARIVQEQESST-KMWV--VAEKAIKEDDPLLLWYGCLSNDLFLLDYG  104



>ref|XP_010914287.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Elaeis guineensis]
Length=487

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 96/230 (42%), Gaps = 49/230 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V + A +H+++ D + +NY     ND+F+  YGF  P N
Sbjct  289  HSFQPNCFL--HWRFRDRMLEVMINAGQHVKKGDEMTINYVSGQKNDVFMGRYGFSSPMN  346

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDG-----ENPDLKVT  572
            P+D I                     NFS+ S    +  LS  N+ G      +  L  +
Sbjct  347  PWDVI---------------------NFSNNSKIHLDSFLSVFNISGLPEEFYHNGLLSS  385

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
                  V+G ++AA R                TL + S    PP+ +    AA R +   
Sbjct  386  GEDHNFVDGAVIAAAR----------------TLPTWSDGDMPPIPSLERKAA-RELQEE  428

Query  391  CVIALGHFPTKIMEDEALLKQN--VSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   ED+ +L  N   S T + A+++R+ +K  +  V++ L
Sbjct  429  CHQMLAEFPTTSQEDQQILDSNPEASRTREAAVKYRLHRKLFLEKVIQAL  478



>ref|XP_004232623.1| PREDICTED: uncharacterized protein LOC101252349 isoform X2 [Solanum 
lycopersicum]
Length=509

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 61/229 (27%), Positives = 94/229 (41%), Gaps = 48/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     NDLF+  YGF  P N
Sbjct  312  HSFQPNCFF--HWRFKDRMLEVMINAGQKIRKGDEMTVNYMAGQKNDLFMQRYGFSSPVN  369

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDG----ENPDLKVTI  569
            P+D I    D  + LD                       LS  N+ G       + K++ 
Sbjct  370  PWDVIHFTGDAKIHLDT---------------------FLSVFNISGLPGEYYHNSKLSN  408

Query  568  GGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  A++ +   C
Sbjct  409  DGDRFVDGAIIAAAR----------------TLPTWSDGDLPPIPSL-ERKAVKELQEEC  451

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   ED+ +L        T + AI++R+ +K +I  V++ L
Sbjct  452  HQMLAEFPTTSDEDQKILDSMPECRRTFEAAIKYRLHRKLLIEKVIQAL  500



>ref|XP_010316519.1| PREDICTED: uncharacterized protein LOC101252349 isoform X1 [Solanum 
lycopersicum]
Length=510

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 94/230 (41%), Gaps = 49/230 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     NDLF+  YGF  P N
Sbjct  312  HSFQPNCFF--HWRFKDRMLEVMINAGQKIRKGDEMTVNYMAGQKNDLFMQRYGFSSPVN  369

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL-----KVT  572
            P+D I    D  + LD                       LS  N+ G   +      K++
Sbjct  370  PWDVIHFTGDAKIHLDT---------------------FLSVFNISGLPGEYYHNTGKLS  408

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
              G   V+G ++AA R                TL + S    PP+ +  E  A++ +   
Sbjct  409  NDGDRFVDGAIIAAAR----------------TLPTWSDGDLPPIPSL-ERKAVKELQEE  451

Query  391  CVIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   ED+ +L        T + AI++R+ +K +I  V++ L
Sbjct  452  CHQMLAEFPTTSDEDQKILDSMPECRRTFEAAIKYRLHRKLLIEKVIQAL  501



>ref|XP_010260759.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=483

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 61/229 (27%), Positives = 97/229 (42%), Gaps = 48/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V + A + I++ D + +NY     N++F+  YGF    N
Sbjct  286  HSFQPNCFL--HWRFKDRMLEVMINAGQRIRKGDEMTINYMHGKRNNMFMQRYGFSSSVN  343

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDGENPDL----KVTI  569
            P+D I+                     FS  S  Q +  LS  N+ G   +     K++ 
Sbjct  344  PWDVIQ---------------------FSGNSQIQLDSFLSVFNISGLPEEYYHNSKLSN  382

Query  568  GGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
            GG   V+G ++AA R                TL + S    PP+  + E  A++ +   C
Sbjct  383  GGDGFVDGAVIAAAR----------------TLPTWSDGDMPPI-PSQERKAVKELQEEC  425

Query  388  VIALGHFPTKIMEDEALLKQNVSA--TTDLAIRFRIQKKSVIIDVMRDL  248
             + L  FPT   ED+ +L     A  T + AI++R+ +K  I  V + L
Sbjct  426  QLMLAEFPTTSYEDQEILDSMPQARRTLEAAIKYRLHRKLFIEKVSQAL  474



>ref|XP_010260758.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=484

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 61/230 (27%), Positives = 97/230 (42%), Gaps = 49/230 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V + A + I++ D + +NY     N++F+  YGF    N
Sbjct  286  HSFQPNCFL--HWRFKDRMLEVMINAGQRIRKGDEMTINYMHGKRNNMFMQRYGFSSSVN  343

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDGENPDL-----KVT  572
            P+D I+                     FS  S  Q +  LS  N+ G   +      K++
Sbjct  344  PWDVIQ---------------------FSGNSQIQLDSFLSVFNISGLPEEYYHNTGKLS  382

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
             GG   V+G ++AA R                TL + S    PP+  + E  A++ +   
Sbjct  383  NGGDGFVDGAVIAAAR----------------TLPTWSDGDMPPI-PSQERKAVKELQEE  425

Query  391  CVIALGHFPTKIMEDEALLKQNVSA--TTDLAIRFRIQKKSVIIDVMRDL  248
            C + L  FPT   ED+ +L     A  T + AI++R+ +K  I  V + L
Sbjct  426  CQLMLAEFPTTSYEDQEILDSMPQARRTLEAAIKYRLHRKLFIEKVSQAL  475



>ref|XP_008383258.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=489

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  291  HSFEPNCFF--HWRFKDRMLEVMINAGKQIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  348

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  349  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  388

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  389  DGDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  431

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  432  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  480



>ref|XP_008383257.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=490

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  292  HSFEPNCFF--HWRFKDRMLEVMINAGKQIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  349

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  350  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  389

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  390  DGDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  432

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  433  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  481



>ref|XP_008383261.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X4 [Malus domestica]
Length=488

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  290  HSFEPNCFF--HWRFKDRMLEVMINAGKQIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  347

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  348  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  387

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  388  DGDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  430

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  431  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  479



>ref|XP_008383259.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X3 [Malus domestica]
Length=489

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 96/228 (42%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  292  HSFEPNCFF--HWRFKDRMLEVMINAGKQIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  349

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I            S  A +   +F          LS  N+ G + +     +++  
Sbjct  350  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNSRLSND  389

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C 
Sbjct  390  GDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEECR  432

Query  385  IALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
              L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  433  QILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  480



>ref|XP_009368551.1| PREDICTED: uncharacterized protein LOC103958057 isoform X1 [Pyrus 
x bretschneideri]
Length=490

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  292  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  349

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  350  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  389

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  390  DGDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  432

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  433  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  481



>ref|XP_009368554.1| PREDICTED: uncharacterized protein LOC103958057 isoform X4 [Pyrus 
x bretschneideri]
Length=488

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  290  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  347

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  348  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  387

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  388  DGDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  430

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  431  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  479



>ref|XP_009368553.1| PREDICTED: uncharacterized protein LOC103958057 isoform X3 [Pyrus 
x bretschneideri]
Length=489

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  291  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  348

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  349  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  388

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  389  DGDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  431

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  432  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  480



>ref|XP_009340259.1| PREDICTED: uncharacterized protein LOC103932400 isoform X1 [Pyrus 
x bretschneideri]
Length=490

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  292  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  349

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  350  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  389

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  390  DGDTFVDGAVIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  432

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  433  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  481



>ref|XP_009368552.1| PREDICTED: uncharacterized protein LOC103958057 isoform X2 [Pyrus 
x bretschneideri]
Length=489

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 96/228 (42%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  292  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  349

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I            S  A +   +F          LS  N+ G + +     +++  
Sbjct  350  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNSRLSND  389

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C 
Sbjct  390  GDTFVDGAIIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEECR  432

Query  385  IALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
              L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  433  QILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  480



>ref|XP_009340263.1| PREDICTED: uncharacterized protein LOC103932400 isoform X4 [Pyrus 
x bretschneideri]
Length=488

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  290  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  347

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  348  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  387

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  388  DGDTFVDGAVIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  430

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  431  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  479



>ref|XP_009340261.1| PREDICTED: uncharacterized protein LOC103932400 isoform X3 [Pyrus 
x bretschneideri]
Length=489

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  291  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  348

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G + +     G    
Sbjct  349  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNTGRLSN  388

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C
Sbjct  389  DGDTFVDGAVIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEEC  431

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  432  RQILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  480



>ref|XP_009340260.1| PREDICTED: uncharacterized protein LOC103932400 isoform X2 [Pyrus 
x bretschneideri]
Length=489

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 96/228 (42%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+ +  YGF  P N
Sbjct  292  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDMLMQRYGFSSPVN  349

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I            S  A +   +F          LS  N+ G + +     +++  
Sbjct  350  PWDVIPF----------SGNARIHLDSF----------LSVFNISGLHGEYYHNSRLSND  389

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C 
Sbjct  390  GDTFVDGAVIAAAR----------------TLPTWSDGDVPPIPSM-ERKSVKELQEECR  432

Query  385  IALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
              L  FPT   +D+ +L    N S T + AI++R+ +K  +  VM+ L
Sbjct  433  QILAAFPTNSKQDQKILDSMPNASRTLEAAIKYRLHRKLFVEKVMQAL  480



>gb|AFW81290.1| hypothetical protein ZEAMMB73_810642 [Zea mays]
Length=401

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/222 (24%), Positives = 96/222 (43%), Gaps = 46/222 (21%)
 Frame = -2

Query  898  PNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNPYDCI  719
            PNA         D  + V + A + I++ D + ++Y    N  F+  YGF  P+NP++ I
Sbjct  206  PNANCFLHWRFKDRMLEVMIKAGQAIKKGDEMTIDYMSGVNSKFMERYGFSSPTNPWELI  265

Query  718  ELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDGENPDLK-----VTIGGPE  557
                                 NFSSP+    +  LS  N+ G + +L       ++   +
Sbjct  266  ---------------------NFSSPATIHMDSFLSVFNIAGLHDELYHNSALTSVVETD  304

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA RA                L + S    P + +    +A + +   C   L
Sbjct  305  FVDGAVVAAARA----------------LPTWSDGDVPAIPSVERKSA-QALQEECRQML  347

Query  376  GHFPTKIMEDEALLKQN--VSATTDLAIRFRIQKKSVIIDVM  257
              FPT I +D+ +L  +  +S T ++AI++R+ +K ++  +M
Sbjct  348  DSFPTTIEQDQQILDSDAHISKTREIAIKYRLHRKMLLQKIM  389



>ref|XP_003062743.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53562.1| predicted protein [Micromonas pusilla CCMP1545]
Length=628

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 120/331 (36%), Gaps = 122/331 (37%)
 Frame = -2

Query  835  AAEHIQRSDALELNYGCLNNDLFLLDYGFV-----------------------VPSNPYD  725
            +A  ++  DA+ L YG LNND FLLDYGFV                       +  NP+D
Sbjct  288  SAWPLRAGDAVTLCYGALNNDAFLLDYGFVPRGGVLGEGEDGTSTVANFRDDAIDLNPHD  347

Query  724  CIELRYDPALLDAASMAAGVESPNFSSPS----------------------PWQREILSQ  611
               LR+D  LL+AA   AG+ +  F   +                      PWQR  L++
Sbjct  348  SAGLRWDLGLLEAAREVAGLSATPFGVSTGATVRGRGGGATADDGAGDPFAPWQRRALAE  407

Query  610  LNLD-----GEN------PDLKVTI-GGPEL-VEGRLMAALRAFLSNDMESVRNHSMD--  476
            L L+     GE+      PD ++ +   P   ++ R++A +R   ++  E +        
Sbjct  408  LRLERGPVGGEDGTSTVAPDQEILVRADPRSPIDHRMLAGVRVLYASKPEDLLGRGGGRG  467

Query  475  -----------------------------TLKSLSVEPQPPLGTANEVAALRTV------  401
                                         T + L    + PL    E  ALR V      
Sbjct  468  GQGEEDGTSTVATNTNTSTNANAQRATPLTQEELGDLWRSPLDRTREAYALRRVLLHTGP  527

Query  400  --TALC----VIALGHFPTKIMEDEALLK-------QNVSATTD--------------LA  302
              TA C     +ALG+F T + ED   L        Q+  A                  A
Sbjct  528  HTTATCQAALALALGNFQTTLREDAVELAKLRGERDQSAGAAPGQLGQLGSGERNDAICA  587

Query  301  IRFRIQKKSVIIDVMRDLTRRVKLLLSKESA  209
            I FR+ KK VI   M  +  R++ +L+  +A
Sbjct  588  IEFRMGKKEVIKRGMEAIDARLRAVLAAPAA  618



>gb|ACL53482.1| unknown [Zea mays]
Length=413

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/222 (24%), Positives = 96/222 (43%), Gaps = 46/222 (21%)
 Frame = -2

Query  898  PNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNPYDCI  719
            PNA         D  + V + A + I++ D + ++Y    N  F+  YGF  P+NP++ I
Sbjct  218  PNANCFLHWRFKDRMLEVMIKAGQAIKKGDEMTIDYMSGVNSKFMERYGFSSPTNPWELI  277

Query  718  ELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDGENPDLK-----VTIGGPE  557
                                 NFSSP+    +  LS  N+ G + +L       ++   +
Sbjct  278  ---------------------NFSSPATIHMDSFLSVFNIAGLHDELYHNSALTSVVETD  316

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA RA                L + S    P + +    +A + +   C   L
Sbjct  317  FVDGAVVAAARA----------------LPTWSDGDVPAIPSVERKSA-QALQEECRQML  359

Query  376  GHFPTKIMEDEALLKQN--VSATTDLAIRFRIQKKSVIIDVM  257
              FPT I +D+ +L  +  +S T ++AI++R+ +K ++  +M
Sbjct  360  DSFPTTIEQDQQILDSDAHISKTREIAIKYRLHRKMLLQKIM  401



>ref|XP_011460532.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460534.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Fragaria 
vesca subsp. vesca]
Length=486

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 96/230 (42%), Gaps = 49/230 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V + A + I++ D + +NY     N + +  YGF    N
Sbjct  288  HSFQPNCFL--HWRFKDRMLEVMINAGQRIKKGDEMTINYMSGQQNHMLMQRYGFSSSVN  345

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDG------ENPDLKVT  572
            P+D I+           S  A +   +F          LS  N+ G       N D +++
Sbjct  346  PWDVIQF----------SGNAQIHLDSF----------LSVFNISGLPQEYYHNTD-RLS  384

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
             GG   V+G ++AA R                TL + S    PP+ +  E  A++ +   
Sbjct  385  SGGDSFVDGAVIAAAR----------------TLPTWSDGDVPPIPSM-ERRAIKELQEE  427

Query  391  CVIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   ED+ +L    + + T +  I++R+ +K  I  VM+ L
Sbjct  428  CRQMLAAFPTNSTEDQNILDSIPDATRTLEAVIKYRLHRKLYIKKVMQAL  477



>ref|NP_001146209.1| hypothetical protein [Zea mays]
 gb|ACL53468.1| unknown [Zea mays]
 gb|ACL54564.1| unknown [Zea mays]
 gb|AFW81288.1| hypothetical protein ZEAMMB73_810642 [Zea mays]
Length=494

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/222 (24%), Positives = 96/222 (43%), Gaps = 46/222 (21%)
 Frame = -2

Query  898  PNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNPYDCI  719
            PNA         D  + V + A + I++ D + ++Y    N  F+  YGF  P+NP++ I
Sbjct  299  PNANCFLHWRFKDRMLEVMIKAGQAIKKGDEMTIDYMSGVNSKFMERYGFSSPTNPWELI  358

Query  718  ELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDGENPDLK-----VTIGGPE  557
                                 NFSSP+    +  LS  N+ G + +L       ++   +
Sbjct  359  ---------------------NFSSPATIHMDSFLSVFNIAGLHDELYHNSALTSVVETD  397

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA RA                L + S    P + +    +A + +   C   L
Sbjct  398  FVDGAVVAAARA----------------LPTWSDGDVPAIPSVERKSA-QALQEECRQML  440

Query  376  GHFPTKIMEDEALLKQN--VSATTDLAIRFRIQKKSVIIDVM  257
              FPT I +D+ +L  +  +S T ++AI++R+ +K ++  +M
Sbjct  441  DSFPTTIEQDQQILDSDAHISKTREIAIKYRLHRKMLLQKIM  482



>ref|XP_011096855.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Sesamum indicum]
Length=488

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 94/229 (41%), Gaps = 48/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY--GCLNNDLFLLDYGFVVPS  737
            HSF PN          D  + V + A E I++ D + +NY  G +NN  F+  YGF    
Sbjct  291  HSFQPNCFF--HWRFKDRMLEVMINAGERIRKGDEMTVNYMNGRMNN-FFMQRYGFSSQV  347

Query  736  NPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTI  569
            NP+D I+           S  A V   +F          LS  N+ G   D     K++ 
Sbjct  348  NPWDVIQF----------SGGARVHLDSF----------LSVFNISGLPEDYYHNSKLSY  387

Query  568  GGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
                 V+G ++AA R                TL + S    PP+ +    AA + +   C
Sbjct  388  DEDSFVDGAVIAAAR----------------TLPTWSDGDIPPIPSMERKAA-KELQEEC  430

Query  388  VIALGHFPTKIMEDEALLKQNVSATTDL--AIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L+    A   L  AI++R+ +K  I  V++ L
Sbjct  431  QQMLAEFPTTAGQDQQILESRPEARRSLEAAIKYRLHRKLFIEKVIQAL  479



>ref|XP_008654830.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=448

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/222 (24%), Positives = 96/222 (43%), Gaps = 46/222 (21%)
 Frame = -2

Query  898  PNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNPYDCI  719
            PNA         D  + V + A + I++ D + ++Y    N  F+  YGF  P+NP++ I
Sbjct  253  PNANCFLHWRFKDRMLEVMIKAGQAIKKGDEMTIDYMSGVNSKFMERYGFSSPTNPWELI  312

Query  718  ELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDGENPDLK-----VTIGGPE  557
                                 NFSSP+    +  LS  N+ G + +L       ++   +
Sbjct  313  ---------------------NFSSPATIHMDSFLSVFNIAGLHDELYHNSALTSVVETD  351

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA RA                L + S    P + +    +A + +   C   L
Sbjct  352  FVDGAVVAAARA----------------LPTWSDGDVPAIPSVERKSA-QALQEECRQML  394

Query  376  GHFPTKIMEDEALLKQN--VSATTDLAIRFRIQKKSVIIDVM  257
              FPT I +D+ +L  +  +S T ++AI++R+ +K ++  +M
Sbjct  395  DSFPTTIEQDQQILDSDAHISKTREIAIKYRLHRKMLLQKIM  436



>ref|XP_006363171.1| PREDICTED: uncharacterized protein LOC102593548 isoform X2 [Solanum 
tuberosum]
Length=509

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 95/225 (42%), Gaps = 40/225 (18%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + ++Y     NDLF+  YGF  P N
Sbjct  312  HSFQPNCFF--HWRFKDRMLEVMINAGQKIRKGEEMTVDYMAGQKNDLFMQRYGFSSPVN  369

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGE-NPDLKVTIGGPE  557
            P+D I    D          A +    F S       + +   L GE   + K++  G  
Sbjct  370  PWDVIHFTGD----------AKIHLDTFLS-------VFNISGLPGEYYHNSKLSNDGDR  412

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA R                TL + S    PP+ +  E  A++ +   C   L
Sbjct  413  FVDGAIIAAAR----------------TLPTWSDGDLPPIPSL-ERKAVKELQEECHQML  455

Query  376  GHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
              FPT   ED+ +L        T + AI++R+ +K +I  V++ L
Sbjct  456  AEFPTTSDEDQKILDLMPECRRTLEAAIKYRLHRKLLIEKVIQAL  500



>ref|XP_004295521.2| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X3 [Fragaria 
vesca subsp. vesca]
Length=485

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 94/228 (41%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V + A + I++ D + +NY     N + +  YGF    N
Sbjct  288  HSFQPNCFL--HWRFKDRMLEVMINAGQRIKKGDEMTINYMSGQQNHMLMQRYGFSSSVN  345

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I+           S  A +   +F          LS  N+ G   +     +++ G
Sbjct  346  PWDVIQF----------SGNAQIHLDSF----------LSVFNISGLPQEYYHNNRLSSG  385

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +  E  A++ +   C 
Sbjct  386  GDSFVDGAVIAAAR----------------TLPTWSDGDVPPIPSM-ERRAIKELQEECR  428

Query  385  IALGHFPTKIMEDEALLKQNVSATTDL--AIRFRIQKKSVIIDVMRDL  248
              L  FPT   ED+ +L     AT  L   I++R+ +K  I  VM+ L
Sbjct  429  QMLAAFPTNSTEDQNILDSIPDATRTLEAVIKYRLHRKLYIKKVMQAL  476



>ref|XP_007212018.1| hypothetical protein PRUPE_ppa004855mg [Prunus persica]
 gb|EMJ13217.1| hypothetical protein PRUPE_ppa004855mg [Prunus persica]
Length=488

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     NDL +  YGF  P N
Sbjct  291  HSFEPNCFF--HWRFKDRMLEVMINAGKRIKKGDEMTVNYMSGQQNDLLMQRYGFSSPVN  348

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I+           S  A +   +F          LS  N+ G   +     +++  
Sbjct  349  PWDVIQF----------SGNARIHLDSF----------LSVFNISGLPEEYYHNSRLSND  388

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +  E  +++ +   C 
Sbjct  389  GDTFVDGAIIAAAR----------------TLSTWSDGDVPPIPSM-ERRSVKELQEECR  431

Query  385  IALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
              L  +PT   +D+ +L    + S T + AI++R+ +K  +  VM+ L
Sbjct  432  QMLAVYPTNSKQDQKILDSMSDASRTLEAAIKYRLHRKLFVEKVMQAL  479



>ref|XP_006363170.1| PREDICTED: uncharacterized protein LOC102593548 isoform X1 [Solanum 
tuberosum]
Length=510

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 94/230 (41%), Gaps = 49/230 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + ++Y     NDLF+  YGF  P N
Sbjct  312  HSFQPNCFF--HWRFKDRMLEVMINAGQKIRKGEEMTVDYMAGQKNDLFMQRYGFSSPVN  369

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL-----KVT  572
            P+D I    D  + LD                       LS  N+ G   +      K++
Sbjct  370  PWDVIHFTGDAKIHLDT---------------------FLSVFNISGLPGEYYHNTGKLS  408

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
              G   V+G ++AA R                TL + S    PP+ +  E  A++ +   
Sbjct  409  NDGDRFVDGAIIAAAR----------------TLPTWSDGDLPPIPSL-ERKAVKELQEE  451

Query  391  CVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   ED+ +L        T + AI++R+ +K +I  V++ L
Sbjct  452  CHQMLAEFPTTSDEDQKILDLMPECRRTLEAAIKYRLHRKLLIEKVIQAL  501



>ref|XP_002275523.2| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Vitis 
vinifera]
 emb|CBI27237.3| unnamed protein product [Vitis vinifera]
Length=482

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 95/228 (42%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY   L ND+ +  YGF  P N
Sbjct  285  HSFQPNCFF--HWRFKDRMLEVMINAGQRIKKGEEMTVNYMSGLKNDMLMQRYGFSSPVN  342

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I+           S  A +   +F          LS  N+ G   +     +++  
Sbjct  343  PWDVIQF----------SGNAQIHLDSF----------LSVFNISGLPEEYYHNSRLSNN  382

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R             ++ T     V P P +    E  A++ +   C 
Sbjct  383  GDSFVDGAVIAAAR-------------TLPTWSDGDVPPMPSM----ERKAVKQLQEECQ  425

Query  385  IALGHFPTKIMEDEALLKQNVSA--TTDLAIRFRIQKKSVIIDVMRDL  248
              L  FPT   +D+ +L        T + AI++R+ +K +I  V++ L
Sbjct  426  QMLLEFPTTSEQDQKILDSMTEERRTLEAAIKYRLHRKLLIEKVIQAL  473



>ref|XP_002528137.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34228.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 94/228 (41%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY     NDLF+  YGF    N
Sbjct  286  HSFQPNCFF--HWRFKDRMLEVMINAGQQIKKGEQMTVNYMSGQKNDLFMQRYGFSSSVN  343

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I+           S  A +   +F          LS  N+ G   +     ++T  
Sbjct  344  PWDVIQF----------SGNACIHLDSF----------LSAFNISGLPEEYYHNNQLTST  383

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
                V+G ++AA R                TL + +    PPL +    AA + +   C 
Sbjct  384  PDTFVDGAVIAAAR----------------TLPTWTDGDVPPLPSIERKAA-KELQEECQ  426

Query  385  IALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
              L  FPT   ED+ LL    +   T + AI++R+ +K +I  V++ L
Sbjct  427  QMLAEFPTTSEEDQTLLDTVPDSRRTLEAAIKYRLHRKKLIEKVIQAL  474



>ref|XP_008346064.1| PREDICTED: uncharacterized protein LOC103409022 [Malus domestica]
Length=281

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 92/230 (40%), Gaps = 49/230 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND  +  YGF  P N
Sbjct  83   HSFEPNCFF--HWRFKDRMLEVMINAGKXIKKGDEMTVNYMSGQQNDXLMQRYGFSSPVN  140

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG---  566
            P+D I    +  + LD+                      LS  N+ G + +     G   
Sbjct  141  PWDVIPFSGNXRIHLDS---------------------FLSVFNMSGLHEEYYHNTGRLS  179

Query  565  --GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
              G   V+G ++AA R                TL + S    PP+ +  E  A++ +   
Sbjct  180  NDGDTSVDGAIIAAAR----------------TLPTWSEGDVPPIPSM-ERKAIKELQEE  222

Query  391  CVIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C      FPT   +D+ +L    + S T + AI++R+ +K  I  VM+ L
Sbjct  223  CRQIJAAFPTNSKQDQKILDSMPDASRTLEAAIKYRLHRKLFIEKVMQAL  272



>gb|KHN47735.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=483

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 92/228 (40%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY     ND+F+  YGF  P N
Sbjct  286  HSFEPNCFF--HWRFKDRMLEVLINAGQQIRKGDEMTVNYMSAQKNDMFMQRYGFSSPVN  343

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLK----VTIG  566
            P+D I+           S  A +   +F          LS  N+ G   +      ++  
Sbjct  344  PWDKIKF----------SGNARIHLDSF----------LSIFNISGLPEEYYHNNCLSKA  383

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +    AA + +   C 
Sbjct  384  GDSFVDGAVIAAAR----------------TLPTWSDGDVPPIPSMERKAA-KELQDECQ  426

Query  385  IALGHFPTKIMEDEALLKQNVSATTDL--AIRFRIQKKSVIIDVMRDL  248
              L  F T   +D+ LL     AT  L  AI++R+ +K  +  V + L
Sbjct  427  KMLAEFATTSKQDQKLLDSMADATRTLEAAIKYRLHRKLFMEKVFQAL  474



>ref|XP_010649327.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Vitis 
vinifera]
Length=483

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/229 (25%), Positives = 93/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY   L ND+ +  YGF  P N
Sbjct  285  HSFQPNCFF--HWRFKDRMLEVMINAGQRIKKGEEMTVNYMSGLKNDMLMQRYGFSSPVN  342

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I+           S  A +   +F          LS  N+ G   +     G    
Sbjct  343  PWDVIQF----------SGNAQIHLDSF----------LSVFNISGLPEEYYHNTGRLSN  382

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R             ++ T     V P P +    E  A++ +   C
Sbjct  383  NGDSFVDGAVIAAAR-------------TLPTWSDGDVPPMPSM----ERKAVKQLQEEC  425

Query  388  VIALGHFPTKIMEDEALLKQNVSA--TTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D+ +L        T + AI++R+ +K +I  V++ L
Sbjct  426  QQMLLEFPTTSEQDQKILDSMTEERRTLEAAIKYRLHRKLLIEKVIQAL  474



>ref|XP_010537041.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Tarenaya 
hassleriana]
Length=485

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/226 (26%), Positives = 97/226 (43%), Gaps = 41/226 (18%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +     A D  + V   A + I++ + + ++Y    NN++ +  YGF  P N
Sbjct  287  HSFQPNCFL--HWRAKDRMLEVMTNAGQGIKKGEEMTIDYMPGQNNNMLMQRYGFSSPVN  344

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPE  557
            P+D I+   D  + LD+      +      S  P +    SQ + DG++           
Sbjct  345  PWDAIQFSGDSRIHLDSFLSVFNI------SGLPEEYYHASQFSEDGDS-----------  387

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA R                TL + S    P + +A   AA R +   C   L
Sbjct  388  FVDGAVIAAAR----------------TLPTWSDTDVPAIPSAERKAA-RELQDECQKML  430

Query  376  GHFPTKIMEDEALLKQNVS---ATTDLAIRFRIQKKSVIIDVMRDL  248
              FPT   +D+ LL  ++S    T   AI++R+ +K     +++ L
Sbjct  431  AEFPTTSEQDQKLLADSLSEARTTFGTAIKYRMHRKMFARKIIKAL  476



>ref|XP_006448593.1| hypothetical protein CICLE_v10015087mg [Citrus clementina]
 gb|ESR61833.1| hypothetical protein CICLE_v10015087mg [Citrus clementina]
Length=480

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 97/230 (42%), Gaps = 50/230 (22%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY--GCLNNDLFLLDYGFVVPS  737
            HSF PN          D  + V V A +H++R + + +NY  G +N D+ +  YGF  P 
Sbjct  283  HSFQPNCFF--HWRFKDRMLEVMVNAGQHVRRGEEMTVNYMHGQMN-DMLMQRYGFSSPV  339

Query  736  NPYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVT  572
            NP++ I+   D  + LD+                      LS  N+ G   +     K++
Sbjct  340  NPWNVIQFSGDARIHLDS---------------------FLSVFNISGLPEEYYHNSKIS  378

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
                  V+G ++AA R                TL + S +   PL  + E  A++ +   
Sbjct  379  SDKESFVDGAVIAAAR----------------TLPTWS-DGDVPLVPSIERKAVKELQEE  421

Query  391  CVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   +D+ +L   +    T + AI++R+ +K  I  V++ L
Sbjct  422  CRQMLAEFPTTSKQDQKMLDSMKEPRRTLEAAIKYRLHRKLFIDKVIKAL  471



>ref|XP_011022311.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Populus 
euphratica]
Length=498

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 93/229 (41%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY     ND+F+  YGF  P N
Sbjct  300  HSFEPNCFF--HWRFKDRMLAVMINAGQQIRKGEEMTVNYMSGQKNDMFMQRYGFSSPVN  357

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            S  A +   +F          LS  N+ G   +     G    
Sbjct  358  PWDVIRF----------SGNARIHLDSF----------LSVFNISGLPEEYCHNTGLLSK  397

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  A++ +   C
Sbjct  398  EGDAFVDGAVIAAAR----------------TLPTWSDGDLPPVPSI-ERKAVKELQEEC  440

Query  388  VIALGHFPTKIMEDEALLKQNVSATTDL--AIRFRIQKKSVIIDVMRDL  248
               L  FPT   +D  +L     AT  L  AI++R+ +K +I  V++ L
Sbjct  441  QKMLAQFPTTSKKDLKILDSMPEATRTLEAAIKYRLHRKLLIEKVVQAL  489



>ref|XP_010100625.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
 gb|EXB83262.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
Length=496

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 95/228 (42%), Gaps = 46/228 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + +NY   L N++ +  YGF  P N
Sbjct  299  HSFQPNCFF--HWRFKDRMLEVMINAGQRIKKGDEMTVNYMSGLQNNMLMQRYGFSSPVN  356

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVTIG  566
            P+D I          + ++   ++S             LS  N+ G   +     +++  
Sbjct  357  PWDVINF--------SGNVRIHLDS------------FLSVFNISGLPEEYYHNSELSND  396

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R              + T     V P P +    E  A++ +   C 
Sbjct  397  GDTFVDGAVIAAAR-------------RLPTWSDGDVPPIPSV----ERRAVKELQEECK  439

Query  385  IALGHFPTKIMEDEALLKQN--VSATTDLAIRFRIQKKSVIIDVMRDL  248
              L  FPT   +D+  L  +   S T + A+R+R+ +K +I  VM+ L
Sbjct  440  QMLAEFPTTSKQDQNTLDSSPEASRTLEAAMRYRLHRKLLIEKVMQAL  487



>ref|XP_009617274.1| PREDICTED: uncharacterized protein LOC104109628 isoform X1 [Nicotiana 
tomentosiformis]
Length=508

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 92/229 (40%), Gaps = 47/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + ++Y     N+ FL  YGF  P N
Sbjct  310  HSFQPNCFF--HWRFKDRMLEVMINAGQRIRKGDEMTVDYMAGQKNNFFLQRYGFSSPVN  367

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIG----  566
            P+D I            +  A +    F          LS  N+ G   +     G    
Sbjct  368  PWDVIHF----------TGEAKIHLDTF----------LSVFNISGLPGEYYHNTGRLSN  407

Query  565  -GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
             G   V+G ++AA R                TL + S    PP+ +  E  A++ +   C
Sbjct  408  DGDSFVDGAIIAAAR----------------TLPTWSDGDLPPIPSL-ERKAVKELQEEC  450

Query  388  VIALGHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   ED+ +L    +   T + AI++R+ +K +I  V++ L
Sbjct  451  HQMLAEFPTTSDEDQKILDSMPDCRRTLEAAIKYRLHRKLLIEKVIQAL  499



>ref|XP_009617275.1| PREDICTED: uncharacterized protein LOC104109628 isoform X2 [Nicotiana 
tomentosiformis]
Length=507

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 95/225 (42%), Gaps = 40/225 (18%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + ++Y     N+ FL  YGF  P N
Sbjct  310  HSFQPNCFF--HWRFKDRMLEVMINAGQRIRKGDEMTVDYMAGQKNNFFLQRYGFSSPVN  367

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGE-NPDLKVTIGGPE  557
            P+D I            +  A +    F S       + +   L GE   + +++  G  
Sbjct  368  PWDVIHF----------TGEAKIHLDTFLS-------VFNISGLPGEYYHNSRLSNDGDS  410

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA R                TL + S    PP+ +  E  A++ +   C   L
Sbjct  411  FVDGAIIAAAR----------------TLPTWSDGDLPPIPSL-ERKAVKELQEECHQML  453

Query  376  GHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
              FPT   ED+ +L    +   T + AI++R+ +K +I  V++ L
Sbjct  454  AEFPTTSDEDQKILDSMPDCRRTLEAAIKYRLHRKLLIEKVIQAL  498



>gb|KDO77209.1| hypothetical protein CISIN_1g011639mg [Citrus sinensis]
Length=438

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 97/230 (42%), Gaps = 50/230 (22%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY--GCLNNDLFLLDYGFVVPS  737
            HSF PN          D  + V V A +H++R + + +NY  G +N D+ +  YGF  P 
Sbjct  241  HSFQPNCFF--HWRFKDRMLEVMVNAGQHVRRGEEMTVNYMHGQMN-DMLMQRYGFSSPV  297

Query  736  NPYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVT  572
            NP++ I+   D  + LD+                      LS  N+ G   +     K++
Sbjct  298  NPWNVIQFSGDARIHLDS---------------------FLSVFNISGLPEEYYHNSKIS  336

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
                  ++G ++AA R                TL + S +   PL  + E  A++ +   
Sbjct  337  SDEESFIDGAVIAAAR----------------TLPTWS-DGDVPLVPSIERKAVKELQEE  379

Query  391  CVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   +D+ +L   +    T + AI++R+ +K  I  V++ L
Sbjct  380  CRQMLAEFPTTSKQDQKMLDSMKEPRRTLEAAIKYRLHRKLFIDKVIKAL  429



>ref|XP_012065974.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Jatropha 
curcas]
Length=488

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 91/231 (39%), Gaps = 50/231 (22%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY     ND F+  YGF    N
Sbjct  289  HSFEPNCFF--HWRFKDRMLEVMINAGQQIKKGEEMTVNYMNGHKNDKFMQRYGFSSSVN  346

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDG------ENPDLKV  575
            P+D I+   +  + LD+                      LS  N+ G       N   ++
Sbjct  347  PWDVIQFSGNTRIHLDS---------------------FLSVFNISGLPEEYHHNSMGQL  385

Query  574  TIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTA  395
            T      V+G ++AA R                TL + S    PPL  + E  A++ +  
Sbjct  386  TSNADTFVDGAIIAAAR----------------TLPTWSDGDVPPL-PSRERKAVKELQE  428

Query  394  LCVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
             C   L  FPT   ED+ LL   Q      + AI++R+ +K  I  V + L
Sbjct  429  ECQQMLSEFPTTSEEDQKLLDTMQEARRPLEAAIKYRLHRKKFIKKVAQAL  479



>gb|KDO77207.1| hypothetical protein CISIN_1g011639mg [Citrus sinensis]
Length=480

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 97/230 (42%), Gaps = 50/230 (22%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY--GCLNNDLFLLDYGFVVPS  737
            HSF PN          D  + V V A +H++R + + +NY  G +N D+ +  YGF  P 
Sbjct  283  HSFQPNCFF--HWRFKDRMLEVMVNAGQHVRRGEEMTVNYMHGQMN-DMLMQRYGFSSPV  339

Query  736  NPYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVT  572
            NP++ I+   D  + LD+                      LS  N+ G   +     K++
Sbjct  340  NPWNVIQFSGDARIHLDS---------------------FLSVFNISGLPEEYYHNSKIS  378

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
                  ++G ++AA R                TL + S +   PL  + E  A++ +   
Sbjct  379  SDEESFIDGAVIAAAR----------------TLPTWS-DGDVPLVPSIERKAVKELQEE  421

Query  391  CVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   +D+ +L   +    T + AI++R+ +K  I  V++ L
Sbjct  422  CRQMLAEFPTTSKQDQKMLDSMKEPRRTLEAAIKYRLHRKLFIDKVIKAL  471



>ref|XP_012065975.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Jatropha 
curcas]
Length=486

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 92/229 (40%), Gaps = 48/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY     ND F+  YGF    N
Sbjct  289  HSFEPNCFF--HWRFKDRMLEVMINAGQQIKKGEEMTVNYMNGHKNDKFMQRYGFSSSVN  346

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDG----ENPDLKVTI  569
            P+D I+   +  + LD+                      LS  N+ G     + + ++T 
Sbjct  347  PWDVIQFSGNTRIHLDS---------------------FLSVFNISGLPEEYHHNSQLTS  385

Query  568  GGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
                 V+G ++AA R                TL + S    PPL  + E  A++ +   C
Sbjct  386  NADTFVDGAIIAAAR----------------TLPTWSDGDVPPL-PSRERKAVKELQEEC  428

Query  388  VIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   ED+ LL   Q      + AI++R+ +K  I  V + L
Sbjct  429  QQMLSEFPTTSEEDQKLLDTMQEARRPLEAAIKYRLHRKKFIKKVAQAL  477



>ref|XP_012065976.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X3 [Jatropha 
curcas]
Length=486

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 91/231 (39%), Gaps = 50/231 (22%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY     ND F+  YGF    N
Sbjct  287  HSFEPNCFF--HWRFKDRMLEVMINAGQQIKKGEEMTVNYMNGHKNDKFMQRYGFSSSVN  344

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDG------ENPDLKV  575
            P+D I+   +  + LD+                      LS  N+ G       N   ++
Sbjct  345  PWDVIQFSGNTRIHLDS---------------------FLSVFNISGLPEEYHHNSMGQL  383

Query  574  TIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTA  395
            T      V+G ++AA R                TL + S    PPL  + E  A++ +  
Sbjct  384  TSNADTFVDGAIIAAAR----------------TLPTWSDGDVPPL-PSRERKAVKELQE  426

Query  394  LCVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
             C   L  FPT   ED+ LL   Q      + AI++R+ +K  I  V + L
Sbjct  427  ECQQMLSEFPTTSEEDQKLLDTMQEARRPLEAAIKYRLHRKKFIKKVAQAL  477



>gb|KDO77210.1| hypothetical protein CISIN_1g011639mg [Citrus sinensis]
Length=478

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/230 (25%), Positives = 97/230 (42%), Gaps = 50/230 (22%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY--GCLNNDLFLLDYGFVVPS  737
            HSF PN          D  + V V A +H++R + + +NY  G +N D+ +  YGF  P 
Sbjct  281  HSFQPNCFF--HWRFKDRMLEVMVNAGQHVRRGEEMTVNYMHGQMN-DMLMQRYGFSSPV  337

Query  736  NPYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL----KVT  572
            NP++ I+   D  + LD+                      LS  N+ G   +     K++
Sbjct  338  NPWNVIQFSGDARIHLDS---------------------FLSVFNISGLPEEYYHNSKIS  376

Query  571  IGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTAL  392
                  ++G ++AA R                TL + S +   PL  + E  A++ +   
Sbjct  377  SDEESFIDGAVIAAAR----------------TLPTWS-DGDVPLVPSIERKAVKELQEE  419

Query  391  CVIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
            C   L  FPT   +D+ +L   +    T + AI++R+ +K  I  V++ L
Sbjct  420  CRQMLAEFPTTSKQDQKMLDSMKEPRRTLEAAIKYRLHRKLFIDKVIKAL  469



>gb|KDP43135.1| hypothetical protein JCGZ_26668 [Jatropha curcas]
Length=484

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 92/229 (40%), Gaps = 48/229 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ + + +NY     ND F+  YGF    N
Sbjct  287  HSFEPNCFF--HWRFKDRMLEVMINAGQQIKKGEEMTVNYMNGHKNDKFMQRYGFSSSVN  344

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDG----ENPDLKVTI  569
            P+D I+   +  + LD+                      LS  N+ G     + + ++T 
Sbjct  345  PWDVIQFSGNTRIHLDS---------------------FLSVFNISGLPEEYHHNSQLTS  383

Query  568  GGPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALC  389
                 V+G ++AA R                TL + S    PPL  + E  A++ +   C
Sbjct  384  NADTFVDGAIIAAAR----------------TLPTWSDGDVPPL-PSRERKAVKELQEEC  426

Query  388  VIALGHFPTKIMEDEALLK--QNVSATTDLAIRFRIQKKSVIIDVMRDL  248
               L  FPT   ED+ LL   Q      + AI++R+ +K  I  V + L
Sbjct  427  QQMLSEFPTTSEEDQKLLDTMQEARRPLEAAIKYRLHRKKFIKKVAQAL  475



>ref|XP_010537049.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Tarenaya 
hassleriana]
Length=484

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 58/225 (26%), Positives = 95/225 (42%), Gaps = 40/225 (18%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +     A D  + V   A + I++ + + ++Y    NN++ +  YGF  P N
Sbjct  287  HSFQPNCFL--HWRAKDRMLEVMTNAGQGIKKGEEMTIDYMPGQNNNMLMQRYGFSSPVN  344

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLKVTIGGPE  557
            P+D I+   D  + LD+      +      S  P +    SQ + DG++           
Sbjct  345  PWDAIQFSGDSRIHLDSFLSVFNI------SGLPEEYYHASQFSEDGDS-----------  387

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA R                TL + S    P + +A   AA R +   C   L
Sbjct  388  FVDGAVIAAAR----------------TLPTWSDTDVPAIPSAERKAA-RELQDECQKML  430

Query  376  GHFPTKIMEDEALLKQNVSATTDL--AIRFRIQKKSVIIDVMRDL  248
              FPT   +D+ LL     A T    AI++R+ +K     +++ L
Sbjct  431  AEFPTTSEQDQKLLDSLSEARTTFGTAIKYRMHRKMFARKIIKAL  475



>ref|XP_009772611.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=507

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 56/225 (25%), Positives = 94/225 (42%), Gaps = 40/225 (18%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A + I++ D + ++Y     N+ F+  YGF  P N
Sbjct  310  HSFQPNCFF--HWRFKDRMLEVMINAGQRIRKGDEMTVDYMAGQKNNFFMQRYGFSSPVN  367

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGE-NPDLKVTIGGPE  557
            P+D I    D          A +    F S       + +   L GE   + +++  G  
Sbjct  368  PWDVIHFTGD----------AKIHLDTFLS-------VFNISGLPGEYYHNSRLSNDGDS  410

Query  556  LVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIAL  377
             V+G ++AA R             ++ T     + P P L    E  A++ +   C   L
Sbjct  411  FVDGAIIAAAR-------------TLPTWSDGDLLPIPSL----ERKAVKELQEECHQML  453

Query  376  GHFPTKIMEDEALLKQ--NVSATTDLAIRFRIQKKSVIIDVMRDL  248
              FPT   ED+ +L    +   T + AI++R+ +K +I  V++ L
Sbjct  454  AEFPTTSDEDQKILDSMPDCRRTLEAAIKYRLHRKLLIEKVIQAL  498



>gb|KFK28655.1| hypothetical protein AALP_AA7G027900 [Arabis alpina]
Length=483

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 93/228 (41%), Gaps = 47/228 (21%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN  +       D  + V   A + I++ + + +NY     ND+ +  YGF  P N
Sbjct  287  HSFEPNCFL--HWRPKDRMLEVMSNAGQAIKKGEEMTINYMPGQKNDMLMERYGFSTPVN  344

Query  733  PYDCIELRYDPAL-LDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDL---KVTIG  566
            P+D I+   D  + LD+                      LS  N+ G   D        G
Sbjct  345  PWDAIKFSGDSRIHLDS---------------------FLSIFNIFGLPEDYYHDSELSG  383

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +A E  A++ +   C 
Sbjct  384  GDSFVDGAVLAAAR----------------TLATWSDIDLPPIPSA-ERKAVKELQDECR  426

Query  385  IALGHFPTKIMEDEALLKQNVSATTDL--AIRFRIQKKSVIIDVMRDL  248
              L  +PT   +D+ +L     A T    A+++R+ +K  I  +++ L
Sbjct  427  KMLAEYPTTAEQDQKMLDSISEARTTFATAVKYRMHRKMFIGKIIKAL  474



>ref|XP_004487895.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=482

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 92/225 (41%), Gaps = 46/225 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A +HI++ DA+ ++Y     N + +  YGF  P N
Sbjct  285  HSFEPNCFF--HWRFKDRMLEVLINAGQHIRKGDAMTVDYMSAQKNHMLMQRYGFSSPVN  342

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLK----VTIG  566
            P+D I+           S  A +   +F          LS  N+ G   +      ++  
Sbjct  343  PWDVIKF----------SGNAQIHLDSF----------LSVFNISGLPEEYYRNEVLSNA  382

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +    AA + +   C 
Sbjct  383  GDTFVDGAVIAAAR----------------TLPTWSDGDLPPIPSTERKAA-KALQEECK  425

Query  385  IALGHFPTKIMEDEALLKQNVSATT--DLAIRFRIQKKSVIIDVM  257
              L  F T   +D+  L  +  +T   D AI++R+ +K ++  V+
Sbjct  426  QMLAEFATTSKQDQKFLDSSPESTRTLDAAIKYRLHRKLLLEKVI  470



>ref|XP_004487894.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=492

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 92/225 (41%), Gaps = 46/225 (20%)
 Frame = -2

Query  910  HSFHPNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNY-GCLNNDLFLLDYGFVVPSN  734
            HSF PN          D  + V + A +HI++ DA+ ++Y     N + +  YGF  P N
Sbjct  295  HSFEPNCFF--HWRFKDRMLEVLINAGQHIRKGDAMTVDYMSAQKNHMLMQRYGFSSPVN  352

Query  733  PYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREILSQLNLDGENPDLK----VTIG  566
            P+D I+           S  A +   +F          LS  N+ G   +      ++  
Sbjct  353  PWDVIKF----------SGNAQIHLDSF----------LSVFNISGLPEEYYRNEVLSNA  392

Query  565  GPELVEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCV  386
            G   V+G ++AA R                TL + S    PP+ +    AA + +   C 
Sbjct  393  GDTFVDGAVIAAAR----------------TLPTWSDGDLPPIPSTERKAA-KALQEECK  435

Query  385  IALGHFPTKIMEDEALLKQNVSATT--DLAIRFRIQKKSVIIDVM  257
              L  F T   +D+  L  +  +T   D AI++R+ +K ++  V+
Sbjct  436  QMLAEFATTSKQDQKFLDSSPESTRTLDAAIKYRLHRKLLLEKVI  480



>ref|XP_005716618.1| unnamed protein product [Chondrus crispus]
 emb|CDF36799.1| unnamed protein product [Chondrus crispus]
Length=333

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 60/216 (28%), Positives = 93/216 (43%), Gaps = 41/216 (19%)
 Frame = -2

Query  799  LNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDAASMAAGVESPNFSSPSPWQREI  620
            ++YG L ND   L YGFV   NPYD  E+     L++  +    V   N       +  +
Sbjct  109  VSYGELTNDDLYLLYGFVQAGNPYDVFEVE---DLVEWVAEHHSVREWNLFDA---KLRL  162

Query  619  LSQLNL--DGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSMDTLK----SLS  458
            L ++ L  +G    L V+   P+LV     AALR  L++  E  R  +M   +     LS
Sbjct  163  LERIGLCYEGRKFHLSVSQIDPDLV-----AALRILLADVNEFRRARAMIEFEEPRDELS  217

Query  457  VE------PQ---PPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDL  305
            V       PQ    PL  +NE      + + C   L  FPT I  DE ++  + +++   
Sbjct  218  VGGFKREVPQGWFEPLTASNERTVWHRIASKCSRTLEEFPTSIEFDEEMIILHAASSVPS  277

Query  304  ------AIRFRIQKKSVIIDVMRDLTRRVKLLLSKE  215
                  ++ FR++KK ++         R   LL+KE
Sbjct  278  DPVHANSLLFRVEKKRIL---------RAAALLAKE  304



>ref|XP_008618202.1| hypothetical protein SDRG_13880 [Saprolegnia diclina VS20]
 gb|EQC28332.1| hypothetical protein SDRG_13880 [Saprolegnia diclina VS20]
Length=430

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/215 (27%), Positives = 91/215 (42%), Gaps = 47/215 (22%)
 Frame = -2

Query  805  LELNYGCLNNDLFLLDYGFVVPSNPYDCIELRY-----DP------ALLDAASMAAGVES  659
            L ++YG  +N   L  YGFVVP NP   I+        DP      +LLDA+++ A    
Sbjct  241  LNISYGPYSNAKLLYSYGFVVPGNPNRGIDFWLNIPASDPYYKLKKSLLDASALTA----  296

Query  658  PNFSSPSPWQREILSQLNLDGENPDLKVTIGGPELVEGRLMAALRAFLSNDMESVRNHSM  479
                                 +  D + T+ G  + E RL+A LR  L ++ E V  H  
Sbjct  297  --------------------SQTYDFEGTLLGNGVSE-RLLATLRIILMHETEIV--HRN  333

Query  478  DTLKSLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLK--QNVSATTDL  305
            +  +   +  +      NE+A    +   C   L  F T   +DE LL    N +     
Sbjct  334  NAFQGRMITRR------NELAVYDNLILSCRRKLQTFTTTFKQDEELLAAGTNNNVYLTF  387

Query  304  AIRFRIQKKSVIIDVMRDLTRRVKLLLSK-ESATA  203
            A++ RI+ K  + D +  L++  + LL + ES+TA
Sbjct  388  ALQVRIEDKRTLQDTIVTLSKWKEFLLHQDESSTA  422



>ref|XP_001417016.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95309.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=390

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 75/191 (39%), Gaps = 31/191 (16%)
 Frame = -2

Query  799  LNYGCLNNDLFLLDYGFVVPSNPYDCIELRYDPALLDA----ASMAAGVESPNFSSPSPW  632
            ++YG LNND  +  YGFV   N  D          L A       A G +S   ++    
Sbjct  218  ISYGVLNNDELITRYGFVDSDNVADVYRFEGFLPFLQANHEPMKRALGADSKRLAT----  273

Query  631  QREILSQLNLDGENPDLKVTIGGPELV-----EGRLMAALRAFLSNDMESVRNHSMDTLK  467
                     L   +P+L   +     +     E +L+ ALRA L+   E  + + +D  K
Sbjct  274  ---------LKRTHPELDEALWNANFISDGTAEDKLLWALRAVLATPEEFAKANGVDGFK  324

Query  466  SLSVEPQPPLGTANEVAALRTVTALCVIALGHFPTKIMEDEALLKQNVSATTDLAIRFRI  287
                      G A E  A   + A     L  +PT + ED   LK + S     AI FRI
Sbjct  325  --------LGGGAPEKRAADAIQAAVSARLAEYPTTLEEDAEQLK-SASGNMATAIAFRI  375

Query  286  QKKSVIIDVMR  254
            +KK ++ D  R
Sbjct  376  RKKRILSDASR  386



>ref|XP_002440355.1| hypothetical protein SORBIDRAFT_09g030160 [Sorghum bicolor]
 gb|EES18785.1| hypothetical protein SORBIDRAFT_09g030160 [Sorghum bicolor]
Length=495

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/221 (24%), Positives = 93/221 (42%), Gaps = 45/221 (20%)
 Frame = -2

Query  898  PNAEIVQEREAGDGKMLVKVIAAEHIQRSDALELNYGCLNNDLFLLDYGFVVPSNPYDCI  719
            PNA         D  + + + A   I++ D + ++Y    N  F+  YGF  P+NP++ I
Sbjct  301  PNANCFLHWRFKDRMLEIMIKAGHAIKKGDEMTIDYMSGVNSKFMERYGFSSPTNPWELI  360

Query  718  ELRYDPALLDAASMAAGVESPNFSSPSPWQRE-ILSQLNLDGENPDLKVTIGGP----EL  554
                                 NFSSP+    +  LS  N+ G + +L      P    + 
Sbjct  361  ---------------------NFSSPATIHMDSFLSVFNIAGLHDELYHNSTLPSVETDF  399

Query  553  VEGRLMAALRAFLSNDMESVRNHSMDTLKSLSVEPQPPLGTANEVAALRTVTALCVIALG  374
            V+G ++AA RA                L + S    P + +    +A + +   C   L 
Sbjct  400  VDGAVVAAARA----------------LPTWSDGDVPAIPSVERKSA-QALQEECRQMLD  442

Query  373  HFPTKIMEDEALLKQNV--SATTDLAIRFRIQKKSVIIDVM  257
             F T I +D+ +L  +V  + T ++AI++R+ +K ++  +M
Sbjct  443  SFSTTIEQDQQILDSDVHINKTREIAIKYRLHRKMLLQKIM  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2118266961610