BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12549

Length=896
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769216.1|  PREDICTED: receptor-like protein kinase HAIKU2     192   2e-70   Nicotiana sylvestris
ref|XP_006356791.1|  PREDICTED: receptor-like protein kinase HAIK...    190   2e-69   Solanum tuberosum [potatoes]
ref|XP_004238042.1|  PREDICTED: receptor-like protein kinase HAIKU2     188   3e-69   Solanum lycopersicum
ref|XP_009591322.1|  PREDICTED: receptor-like protein kinase HAIKU2     190   9e-69   Nicotiana tomentosiformis
emb|CDP00968.1|  unnamed protein product                                185   5e-68   Coffea canephora [robusta coffee]
ref|XP_006417507.1|  hypothetical protein EUTSA_v10006696mg             179   5e-66   Eutrema salsugineum [saltwater cress]
ref|XP_006433710.1|  hypothetical protein CICLE_v10000155mg             178   9e-65   Citrus clementina [clementine]
ref|XP_006472374.1|  PREDICTED: receptor-like protein kinase HAIK...    177   2e-64   Citrus sinensis [apfelsine]
gb|KDO81346.1|  hypothetical protein CISIN_1g047677mg                   179   2e-64   Citrus sinensis [apfelsine]
ref|XP_010490508.1|  PREDICTED: receptor-like protein kinase HAIKU2     179   3e-64   Camelina sativa [gold-of-pleasure]
gb|KFK43299.1|  hypothetical protein AALP_AA1G106000                    177   3e-64   Arabis alpina [alpine rockcress]
ref|XP_010458318.1|  PREDICTED: receptor-like protein kinase HAIKU2     179   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010475857.1|  PREDICTED: receptor-like protein kinase HAIKU2     178   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002889779.1|  hypothetical protein ARALYDRAFT_888250             178   6e-64   Arabidopsis lyrata subsp. lyrata
gb|EYU36421.1|  hypothetical protein MIMGU_mgv1a000813mg                179   9e-64   Erythranthe guttata [common monkey flower]
ref|XP_006306692.1|  hypothetical protein CARUB_v10008210mg             176   1e-63   Capsella rubella
gb|AAL12626.1|  leucine-rich repeat receptor-like kinase F21M12.36      177   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172468.3|  leucine-rich receptor-like protein kinase             177   1e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDY62731.1|  BnaC05g49230D                                          174   3e-63   Brassica napus [oilseed rape]
ref|NP_850942.1|  leucine-rich receptor-like protein kinase             176   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268649.1|  PREDICTED: receptor-like protein kinase HAIKU2     171   4e-63   Nelumbo nucifera [Indian lotus]
ref|XP_010553669.1|  PREDICTED: receptor-like protein kinase HAIKU2     178   4e-63   Tarenaya hassleriana [spider flower]
gb|KJB64050.1|  hypothetical protein B456_010G030600                    173   8e-63   Gossypium raimondii
dbj|BAD94141.1|  leucine-rich repeat receptor-like kinase At1g09970     174   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148316.1|  PREDICTED: receptor-like protein kinase HAIKU2     173   1e-62   Brassica rapa
gb|KHG10020.1|  Receptor-like protein kinase HAIKU2                     174   1e-62   Gossypium arboreum [tree cotton]
emb|CDY57935.1|  BnaA06g38030D                                          173   3e-62   Brassica napus [oilseed rape]
ref|XP_011074301.1|  PREDICTED: receptor-like protein kinase HAIKU2     169   5e-62   Sesamum indicum [beniseed]
emb|CDY22611.1|  BnaC08g42450D                                          172   9e-62   Brassica napus [oilseed rape]
gb|KEH36109.1|  LRR receptor-like kinase                                167   2e-61   Medicago truncatula
emb|CDY53829.1|  BnaA09g57210D                                          171   2e-61   Brassica napus [oilseed rape]
ref|XP_009118284.1|  PREDICTED: receptor-like protein kinase HAIKU2     170   3e-61   Brassica rapa
ref|XP_004501071.1|  PREDICTED: receptor-like protein kinase HAIK...    164   5e-61   Cicer arietinum [garbanzo]
gb|KJB16079.1|  hypothetical protein B456_002G211900                    166   1e-60   Gossypium raimondii
gb|KJB16078.1|  hypothetical protein B456_002G211900                    165   1e-60   Gossypium raimondii
emb|CDY20667.1|  BnaC08g13910D                                          169   2e-60   Brassica napus [oilseed rape]
ref|XP_009144482.1|  PREDICTED: receptor-like protein kinase HAIKU2     171   7e-60   Brassica rapa
emb|CDY31055.1|  BnaA08g26050D                                          171   7e-60   Brassica napus [oilseed rape]
ref|XP_009779240.1|  PREDICTED: receptor-like protein kinase HAIKU2     167   2e-59   Nicotiana sylvestris
ref|XP_010544042.1|  PREDICTED: receptor-like protein kinase HAIKU2     161   3e-59   Tarenaya hassleriana [spider flower]
ref|XP_010061583.1|  PREDICTED: receptor-like protein kinase HAIKU2     161   6e-59   Eucalyptus grandis [rose gum]
emb|CAN65551.1|  hypothetical protein VITISV_033329                     166   9e-59   Vitis vinifera
ref|XP_009616818.1|  PREDICTED: receptor-like protein kinase HAIKU2     163   1e-58   Nicotiana tomentosiformis
ref|XP_002271143.2|  PREDICTED: receptor-like protein kinase HAIKU2     166   1e-58   Vitis vinifera
ref|XP_010271554.1|  PREDICTED: receptor-like protein kinase HAIKU2     168   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_003593346.1|  Receptor-like protein kinase HAIKU2                169   5e-58   Medicago truncatula
ref|XP_007041450.1|  Leucine-rich receptor-like protein kinase fa...    162   1e-57   
ref|XP_002313944.2|  hypothetical protein POPTR_0009s08540g             159   5e-57   
ref|XP_004230660.1|  PREDICTED: receptor-like protein kinase HAIKU2     160   2e-56   Solanum lycopersicum
ref|XP_011002775.1|  PREDICTED: receptor-like protein kinase HAIKU2     159   2e-56   Populus euphratica
ref|XP_012074538.1|  PREDICTED: receptor-like protein kinase HAIKU2     159   8e-56   Jatropha curcas
gb|KCW63493.1|  hypothetical protein EUGRSUZ_G01123                     162   1e-55   Eucalyptus grandis [rose gum]
ref|XP_008236214.1|  PREDICTED: receptor-like protein kinase HAIKU2     161   1e-55   Prunus mume [ume]
ref|XP_010065822.1|  PREDICTED: receptor-like protein kinase HAIKU2     162   2e-55   Eucalyptus grandis [rose gum]
ref|XP_006367082.1|  PREDICTED: receptor-like protein kinase HAIK...    159   2e-55   Solanum tuberosum [potatoes]
gb|EPS73238.1|  hypothetical protein M569_01518                         154   2e-55   Genlisea aurea
emb|CDO97335.1|  unnamed protein product                                155   7e-55   Coffea canephora [robusta coffee]
ref|XP_004485648.1|  PREDICTED: receptor-like protein kinase HAIK...    164   1e-54   Cicer arietinum [garbanzo]
ref|XP_007148314.1|  hypothetical protein PHAVU_006G198200g             157   1e-54   Phaseolus vulgaris [French bean]
gb|KDO67927.1|  hypothetical protein CISIN_1g002250mg                   153   1e-54   Citrus sinensis [apfelsine]
ref|XP_006486805.1|  PREDICTED: receptor-like protein kinase HAIK...    153   2e-54   Citrus sinensis [apfelsine]
ref|XP_006422685.1|  hypothetical protein CICLE_v10027748mg             153   2e-54   Citrus clementina [clementine]
ref|XP_007199705.1|  hypothetical protein PRUPE_ppa000895mg             156   6e-54   Prunus persica
ref|XP_009420699.1|  PREDICTED: receptor-like protein kinase HAIKU2     154   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787835.1|  PREDICTED: uncharacterized protein LOC103705762    151   9e-54   
gb|KJB77870.1|  hypothetical protein B456_012G162000                    146   1e-53   Gossypium raimondii
ref|XP_009407104.1|  PREDICTED: uncharacterized protein LOC103989885    156   4e-53   
ref|XP_009346454.1|  PREDICTED: receptor-like protein kinase HAIKU2     156   1e-52   
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2     141   2e-52   Elaeis guineensis
ref|XP_008382378.1|  PREDICTED: receptor-like protein kinase HAIKU2     154   3e-52   Malus domestica [apple tree]
ref|XP_009378558.1|  PREDICTED: receptor-like protein kinase HAIKU2     152   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_008372891.1|  PREDICTED: receptor-like protein kinase HAIKU2     151   4e-52   
ref|XP_011658857.1|  PREDICTED: receptor-like protein kinase HAIKU2     145   6e-52   Cucumis sativus [cucumbers]
ref|XP_008455077.1|  PREDICTED: receptor-like protein kinase HAIKU2     144   7e-52   Cucumis melo [Oriental melon]
ref|XP_003541774.1|  PREDICTED: receptor-like protein kinase HAIK...    149   1e-51   Glycine max [soybeans]
ref|XP_012068112.1|  PREDICTED: receptor-like protein kinase HAIKU2     191   4e-51   Jatropha curcas
ref|XP_002522038.1|  Receptor protein kinase CLAVATA1 precursor, ...    152   4e-51   Ricinus communis
ref|XP_009416779.1|  PREDICTED: receptor-like protein kinase HAIKU2     147   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510007.1|  Receptor protein kinase CLAVATA1 precursor, ...    191   7e-51   Ricinus communis
ref|XP_006852741.1|  PREDICTED: receptor-like protein kinase HAIKU2     148   8e-50   
gb|KHG18049.1|  Receptor-like protein kinase HAIKU2                     137   3e-49   Gossypium arboreum [tree cotton]
ref|XP_006386429.1|  leucine-rich repeat transmembrane protein ki...    186   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011016947.1|  PREDICTED: receptor-like protein kinase HAIKU2     184   2e-48   Populus euphratica
gb|KHG17335.1|  Receptor-like protein kinase HAIKU2                     183   3e-48   Gossypium arboreum [tree cotton]
ref|XP_010668040.1|  PREDICTED: receptor-like protein kinase HAIKU2     125   3e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010667749.1|  PREDICTED: receptor-like protein kinase HAIKU2     182   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010060141.1|  PREDICTED: receptor-like protein kinase HAIKU2     183   5e-48   Eucalyptus grandis [rose gum]
gb|KCW66704.1|  hypothetical protein EUGRSUZ_F00467                     182   5e-48   Eucalyptus grandis [rose gum]
ref|XP_007018364.1|  Leucine-rich receptor-like protein kinase fa...    182   6e-48   
ref|XP_008466102.1|  PREDICTED: receptor-like protein kinase HAIKU2     181   1e-47   Cucumis melo [Oriental melon]
gb|KJB58765.1|  hypothetical protein B456_009G225300                    181   1e-47   Gossypium raimondii
ref|XP_002283600.3|  PREDICTED: uncharacterized protein LOC100257433    183   2e-47   
ref|NP_188604.1|  leucine rich repeat kinase HAIKU 2                    135   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631895.1|  PREDICTED: receptor-like protein kinase HSL1       143   6e-47   Nicotiana tomentosiformis
ref|XP_002889783.1|  hypothetical protein ARALYDRAFT_888256             177   8e-47   
ref|XP_009764826.1|  PREDICTED: receptor-like protein kinase HSL1       142   2e-46   Nicotiana sylvestris
ref|XP_006356797.1|  PREDICTED: receptor-like protein kinase HSL1...    141   3e-46   Solanum tuberosum [potatoes]
gb|ACI42311.1|  putative leucine rich repeat transmembrane protei...    138   4e-46   Corchorus olitorius [Nalta jute]
ref|XP_008219158.1|  PREDICTED: receptor-like protein kinase HSL1       138   4e-46   Prunus mume [ume]
ref|XP_004238044.1|  PREDICTED: receptor-like protein kinase HSL1       140   5e-46   Solanum lycopersicum
ref|XP_008339015.1|  PREDICTED: receptor-like protein kinase HAIKU2     177   6e-46   
emb|CDP00973.1|  unnamed protein product                                138   6e-46   Coffea canephora [robusta coffee]
gb|KJB29385.1|  hypothetical protein B456_005G097600                    176   7e-46   Gossypium raimondii
ref|XP_007227013.1|  hypothetical protein PRUPE_ppa001184mg             137   8e-46   
ref|XP_009786287.1|  PREDICTED: receptor-like protein kinase HSL1       139   1e-45   Nicotiana sylvestris
ref|XP_007018366.1|  Leucine-rich repeat transmembrane protein ki...    137   1e-45   
ref|XP_002883200.1|  hypothetical protein ARALYDRAFT_479487             133   2e-45   
gb|AEP84281.1|  leucine rich repeat-containing protein                  136   2e-45   Corchorus capsularis [jute]
ref|XP_006442751.1|  hypothetical protein CICLE_v10018723mg             136   2e-45   Citrus clementina [clementine]
ref|XP_008378672.1|  PREDICTED: receptor-like protein kinase HAIKU2     175   2e-45   
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg             137   2e-45   Citrus clementina [clementine]
ref|XP_010104545.1|  Receptor-like protein kinase HAIKU2                175   2e-45   Morus notabilis
ref|XP_009357239.1|  PREDICTED: receptor-like protein kinase HAIKU2     175   2e-45   Pyrus x bretschneideri [bai li]
gb|KJB59873.1|  hypothetical protein B456_009G278200                    139   3e-45   Gossypium raimondii
ref|XP_009599063.1|  PREDICTED: receptor-like protein kinase HSL1       139   4e-45   Nicotiana tomentosiformis
gb|KJB29386.1|  hypothetical protein B456_005G097700                    136   5e-45   Gossypium raimondii
gb|KHG23504.1|  Receptor-like protein kinase HAIKU2                     174   5e-45   Gossypium arboreum [tree cotton]
ref|XP_006487758.1|  PREDICTED: receptor-like protein kinase HSL1...    134   6e-45   Citrus sinensis [apfelsine]
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...    135   6e-45   Citrus sinensis [apfelsine]
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                   135   7e-45   Citrus sinensis [apfelsine]
ref|XP_004299842.1|  PREDICTED: receptor-like protein kinase HSL1       135   7e-45   Fragaria vesca subsp. vesca
gb|KDO42901.1|  hypothetical protein CISIN_1g003199mg                   134   9e-45   Citrus sinensis [apfelsine]
ref|XP_007020166.1|  Leucine-rich receptor-like protein kinase fa...    140   9e-45   
gb|EYU36418.1|  hypothetical protein MIMGU_mgv1a000952mg                133   9e-45   Erythranthe guttata [common monkey flower]
ref|XP_006300009.1|  hypothetical protein CARUB_v10016232mg             130   1e-44   Capsella rubella
ref|XP_011074306.1|  PREDICTED: receptor-like protein kinase HSL1       134   1e-44   Sesamum indicum [beniseed]
ref|XP_010247922.1|  PREDICTED: receptor-like protein kinase HSL1       140   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010061584.1|  PREDICTED: receptor-like protein kinase HSL1       132   2e-44   Eucalyptus grandis [rose gum]
ref|XP_012068114.1|  PREDICTED: receptor-like protein kinase 5          132   2e-44   Jatropha curcas
ref|XP_007227019.1|  hypothetical protein PRUPE_ppa001010mg             172   3e-44   
ref|XP_004136412.1|  PREDICTED: receptor-like protein kinase HAIKU2     172   3e-44   Cucumis sativus [cucumbers]
ref|XP_006406469.1|  hypothetical protein EUTSA_v10022054mg             127   3e-44   Eutrema salsugineum [saltwater cress]
gb|KJB58763.1|  hypothetical protein B456_009G225100                    135   4e-44   Gossypium raimondii
gb|KHN08204.1|  Receptor-like protein kinase HAIKU2-like protein        170   4e-44   Glycine soja [wild soybean]
gb|KDP41543.1|  hypothetical protein JCGZ_15950                         131   5e-44   Jatropha curcas
ref|XP_008219159.1|  PREDICTED: receptor-like protein kinase HAIKU2     171   5e-44   Prunus mume [ume]
gb|KHG16379.1|  Receptor-like protein kinase HSL1                       135   5e-44   Gossypium arboreum [tree cotton]
ref|XP_002510008.1|  receptor protein kinase, putative                  132   6e-44   Ricinus communis
gb|KFK39298.1|  hypothetical protein AALP_AA3G226400                    131   7e-44   Arabis alpina [alpine rockcress]
ref|XP_003634589.1|  PREDICTED: receptor-like protein kinase HAIKU2     129   8e-44   Vitis vinifera
ref|XP_010667798.1|  PREDICTED: receptor-like protein kinase HSL1       135   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001067347.2|  Os12g0632800                                       117   1e-43   
gb|EAY84008.1|  hypothetical protein OsI_39239                          117   1e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_008466101.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    134   1e-43   
ref|XP_010062414.1|  PREDICTED: receptor-like protein kinase HAIKU2     133   1e-43   Eucalyptus grandis [rose gum]
ref|XP_004136411.1|  PREDICTED: receptor-like protein kinase HSL1       134   1e-43   Cucumis sativus [cucumbers]
ref|XP_009357235.1|  PREDICTED: receptor-like protein kinase HSL1       131   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...    129   2e-43   
ref|XP_009335487.1|  PREDICTED: receptor-like protein kinase HAIKU2     169   2e-43   
ref|XP_010943241.1|  PREDICTED: receptor-like protein kinase HSL1...    129   2e-43   
ref|XP_002442601.1|  hypothetical protein SORBIDRAFT_08g022780          123   2e-43   Sorghum bicolor [broomcorn]
ref|XP_003522732.1|  PREDICTED: receptor-like protein kinase HAIK...    169   2e-43   Glycine max [soybeans]
ref|XP_009335485.1|  PREDICTED: receptor-like protein kinase HSL1       134   3e-43   Pyrus x bretschneideri [bai li]
gb|KJB60054.1|  hypothetical protein B456_009G287800                    135   4e-43   Gossypium raimondii
ref|XP_010489950.1|  PREDICTED: receptor-like protein kinase HAIKU2     125   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010468302.1|  PREDICTED: receptor-like protein kinase HAIKU2     127   6e-43   Camelina sativa [gold-of-pleasure]
emb|CDY42201.1|  BnaA01g25940D                                          123   6e-43   Brassica napus [oilseed rape]
ref|XP_012079733.1|  PREDICTED: receptor-like protein kinase HSL1       130   6e-43   Jatropha curcas
ref|XP_010420074.1|  PREDICTED: receptor-like protein kinase HAIKU2     122   8e-43   Camelina sativa [gold-of-pleasure]
ref|XP_004148401.1|  PREDICTED: receptor-like protein kinase HSL1       132   8e-43   Cucumis sativus [cucumbers]
ref|XP_009111593.1|  PREDICTED: receptor-like protein kinase HAIKU2     122   8e-43   Brassica rapa
emb|CDX95422.1|  BnaC01g33140D                                          122   1e-42   
ref|XP_010943249.1|  PREDICTED: receptor-like protein kinase HSL1...    127   1e-42   Elaeis guineensis
gb|EAZ21323.1|  hypothetical protein OsJ_36977                          114   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011096686.1|  PREDICTED: receptor-like protein kinase HAIKU2     135   1e-42   Sesamum indicum [beniseed]
ref|XP_003526517.1|  PREDICTED: receptor-like protein kinase HSL1...    127   1e-42   Glycine max [soybeans]
ref|XP_008444976.1|  PREDICTED: receptor-like protein kinase HSL1       133   1e-42   Cucumis melo [Oriental melon]
ref|XP_006852742.1|  PREDICTED: receptor-like protein kinase HAIKU2     129   2e-42   
ref|XP_008787759.1|  PREDICTED: receptor-like protein kinase HSL1       125   2e-42   
ref|XP_003526519.1|  PREDICTED: receptor-like protein kinase HAIK...    167   2e-42   Glycine max [soybeans]
ref|XP_008352752.1|  PREDICTED: receptor-like protein kinase HSL1       128   2e-42   
ref|XP_007137285.1|  hypothetical protein PHAVU_009G114400g             125   2e-42   Phaseolus vulgaris [French bean]
gb|KHN37211.1|  Receptor-like protein kinase HSL1-like protein          125   3e-42   Glycine soja [wild soybean]
ref|XP_002526416.1|  serine-threonine protein kinase, plant-type,...    127   3e-42   
ref|XP_007225361.1|  hypothetical protein PRUPE_ppa000880mg             129   3e-42   
ref|XP_010103492.1|  Receptor-like protein kinase HSL1                  133   4e-42   Morus notabilis
ref|XP_004963298.1|  PREDICTED: receptor-like protein kinase HAIK...    115   5e-42   
ref|XP_007137286.1|  hypothetical protein PHAVU_009G114500g             166   5e-42   Phaseolus vulgaris [French bean]
gb|EPS67674.1|  hypothetical protein M569_07098                         126   6e-42   Genlisea aurea
ref|XP_008218929.1|  PREDICTED: receptor-like protein kinase HAIKU2     130   6e-42   Prunus mume [ume]
ref|XP_004501072.1|  PREDICTED: receptor-like protein kinase HSL1...    124   6e-42   Cicer arietinum [garbanzo]
ref|XP_009362411.1|  PREDICTED: receptor-like protein kinase HSL1       135   7e-42   Pyrus x bretschneideri [bai li]
gb|KHG27129.1|  Receptor-like protein kinase HAIKU2                     130   8e-42   Gossypium arboreum [tree cotton]
ref|XP_010268650.1|  PREDICTED: receptor-like protein kinase HSL1       129   9e-42   Nelumbo nucifera [Indian lotus]
ref|XP_004299841.2|  PREDICTED: receptor-like protein kinase HAIKU2     165   1e-41   Fragaria vesca subsp. vesca
ref|XP_003523762.1|  PREDICTED: receptor-like protein kinase HSL1...    126   1e-41   Glycine max [soybeans]
ref|XP_004309904.1|  PREDICTED: receptor-like protein kinase HSL1       130   1e-41   Fragaria vesca subsp. vesca
gb|KFK40815.1|  hypothetical protein AALP_AA2G044900                    124   2e-41   Arabis alpina [alpine rockcress]
ref|XP_008361619.1|  PREDICTED: receptor-like protein kinase HAIKU2     134   2e-41   
ref|XP_008339164.1|  PREDICTED: receptor-like protein kinase HAIKU2     134   2e-41   
ref|XP_007131311.1|  hypothetical protein PHAVU_011G003200g             132   2e-41   Phaseolus vulgaris [French bean]
gb|KHN08203.1|  Receptor-like protein kinase HSL1-like protein          125   2e-41   Glycine soja [wild soybean]
ref|XP_008378674.1|  PREDICTED: receptor-like protein kinase HSL1       128   2e-41   
ref|XP_008456679.1|  PREDICTED: receptor-like protein kinase HAIKU2     127   3e-41   Cucumis melo [Oriental melon]
ref|XP_004140933.1|  PREDICTED: receptor-like protein kinase HAIKU2     127   3e-41   Cucumis sativus [cucumbers]
gb|KEH36108.1|  LRR receptor-like kinase family protein                 120   4e-41   Medicago truncatula
ref|XP_002301126.1|  hypothetical protein POPTR_0002s11230g             120   4e-41   
ref|XP_006402253.1|  hypothetical protein EUTSA_v10012576mg             124   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_002865749.1|  hypothetical protein ARALYDRAFT_495025             124   1e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...    133   1e-40   Glycine max [soybeans]
ref|XP_006350342.1|  PREDICTED: receptor-like protein kinase HAIK...    130   1e-40   Solanum tuberosum [potatoes]
ref|XP_009123552.1|  PREDICTED: receptor-like protein kinase HSL1       123   1e-40   Brassica rapa
ref|XP_006858563.2|  PREDICTED: receptor-like protein kinase HAIKU2     134   1e-40   
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like             133   1e-40   Glycine max [soybeans]
gb|KJB64049.1|  hypothetical protein B456_010G030500                    129   1e-40   Gossypium raimondii
emb|CDX71602.1|  BnaC09g26430D                                          123   2e-40   
ref|XP_008674123.1|  PREDICTED: receptor-like protein kinase HAIKU2     116   2e-40   Zea mays [maize]
ref|XP_008357591.1|  PREDICTED: receptor-like protein kinase HAIKU2     130   2e-40   
ref|XP_008378748.1|  PREDICTED: receptor-like protein kinase HAIKU2     130   2e-40   
emb|CDY37769.1|  BnaA10g05520D                                          124   2e-40   Brassica napus [oilseed rape]
ref|NP_199777.1|  receptor like kinase                                  124   2e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42540.1|  putative receptor protein kinase                       124   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009780300.1|  PREDICTED: receptor-like protein kinase HAIKU2     129   2e-40   Nicotiana sylvestris
ref|NP_001048946.2|  Os03g0145000                                       127   2e-40   
ref|XP_009628481.1|  PREDICTED: receptor-like protein kinase HAIKU2     129   2e-40   Nicotiana tomentosiformis
tpg|DAA54762.1|  TPA: putative leucine-rich repeat receptor-like ...    115   3e-40   
gb|ERN20030.1|  hypothetical protein AMTR_s00071p00174710               132   3e-40   Amborella trichopoda
ref|XP_010440851.1|  PREDICTED: receptor-like protein kinase HSL1       123   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010442431.1|  PREDICTED: receptor-like protein kinase HSL1       122   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010482244.1|  PREDICTED: receptor-like protein kinase HSL1...    122   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010482245.1|  PREDICTED: receptor-like protein kinase HSL1...    122   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_011017021.1|  PREDICTED: receptor-like protein kinase HSL1       117   4e-40   Populus euphratica
ref|XP_009416959.1|  PREDICTED: receptor-like protein kinase HSL1       127   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY88517.1|  hypothetical protein OsI_09989                          127   5e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_004250411.1|  PREDICTED: receptor-like protein kinase HAIKU2     128   5e-40   Solanum lycopersicum
ref|XP_002465865.1|  hypothetical protein SORBIDRAFT_01g047250          127   5e-40   Sorghum bicolor [broomcorn]
ref|XP_011031514.1|  PREDICTED: receptor-like protein kinase HAIKU2     124   6e-40   Populus euphratica
gb|EYU22821.1|  hypothetical protein MIMGU_mgv1a000956mg                131   6e-40   Erythranthe guttata [common monkey flower]
gb|EPS61889.1|  hypothetical protein M569_12898                         122   6e-40   Genlisea aurea
ref|XP_006353616.1|  PREDICTED: receptor-like protein kinase HAIK...    125   7e-40   
ref|XP_002325963.1|  leucine-rich repeat transmembrane protein ki...    123   7e-40   
ref|XP_006279955.1|  hypothetical protein CARUB_v10025822mg             121   8e-40   Capsella rubella
ref|XP_006279956.1|  hypothetical protein CARUB_v10025822mg             121   9e-40   
ref|XP_004985730.1|  PREDICTED: leucine-rich repeat receptor-like...    126   9e-40   Setaria italica
ref|XP_006664773.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    115   9e-40   
ref|XP_010271555.1|  PREDICTED: receptor-like protein kinase HSL1       121   1e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009379270.1|  PREDICTED: receptor-like protein kinase HAIKU2     128   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_010556500.1|  PREDICTED: receptor-like protein kinase HSL1       119   2e-39   Tarenaya hassleriana [spider flower]
ref|XP_010322765.1|  PREDICTED: receptor-like protein kinase HAIKU2     124   3e-39   Solanum lycopersicum
ref|XP_010684496.1|  PREDICTED: receptor-like protein kinase HSL1       127   3e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG27799.1|  Receptor-like protein kinase HSL1                       123   3e-39   Gossypium arboreum [tree cotton]
ref|XP_004292067.1|  PREDICTED: receptor-like protein kinase HAIKU2     157   4e-39   Fragaria vesca subsp. vesca
ref|XP_006651034.1|  PREDICTED: leucine-rich repeat receptor-like...    124   4e-39   Oryza brachyantha
emb|CDP03798.1|  unnamed protein product                                124   7e-39   Coffea canephora [robusta coffee]
ref|NP_001067348.1|  Os12g0632900                                       115   8e-39   
ref|XP_010918931.1|  PREDICTED: leucine-rich repeat receptor-like...    123   9e-39   Elaeis guineensis
gb|KJB59645.1|  hypothetical protein B456_009G265300                    121   9e-39   Gossypium raimondii
ref|XP_002966807.1|  hypothetical protein SELMODRAFT_168561             130   1e-38   
emb|CDP16506.1|  unnamed protein product                                127   1e-38   Coffea canephora [robusta coffee]
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                     123   1e-38   Eucalyptus grandis [rose gum]
ref|XP_008450168.1|  PREDICTED: LRR receptor-like serine/threonin...    114   2e-38   Cucumis melo [Oriental melon]
ref|XP_003562099.1|  PREDICTED: leucine-rich repeat receptor-like...    126   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_010046357.1|  PREDICTED: leucine-rich repeat receptor-like...    122   2e-38   Eucalyptus grandis [rose gum]
gb|AEX11047.1|  hypothetical protein 0_1169_01                          143   3e-38   Pinus taeda
ref|XP_011036356.1|  PREDICTED: leucine-rich repeat receptor-like...    118   3e-38   Populus euphratica
ref|XP_010107637.1|  Receptor-like protein kinase HAIKU2                154   3e-38   Morus notabilis
dbj|BAJ89535.1|  predicted protein                                      125   4e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325782.2|  clavata1 receptor kinase family protein            118   5e-38   
ref|XP_010674258.1|  PREDICTED: leucine-rich repeat receptor-like...    118   5e-38   
ref|XP_004134272.1|  PREDICTED: LRR receptor-like serine/threonin...    113   5e-38   Cucumis sativus [cucumbers]
ref|XP_010930577.1|  PREDICTED: receptor-like protein kinase HSL1       123   7e-38   Elaeis guineensis
ref|XP_006664774.1|  PREDICTED: receptor-like protein kinase HSL1...    113   8e-38   
ref|XP_006587703.1|  PREDICTED: leucine-rich repeat receptor-like...    120   1e-37   Glycine max [soybeans]
ref|XP_011083069.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    117   1e-37   
ref|XP_004247132.1|  PREDICTED: leucine-rich repeat receptor-like...    120   1e-37   Solanum lycopersicum
ref|XP_004963299.1|  PREDICTED: receptor-like protein kinase HAIK...    112   2e-37   Setaria italica
ref|XP_010035036.1|  PREDICTED: leucine-rich repeat receptor-like...    120   2e-37   Eucalyptus grandis [rose gum]
ref|XP_010062386.1|  PREDICTED: leucine-rich repeat receptor-like...    122   2e-37   Eucalyptus grandis [rose gum]
ref|XP_006355906.1|  PREDICTED: leucine-rich repeat receptor-like...    120   2e-37   Solanum tuberosum [potatoes]
ref|XP_006837283.1|  PREDICTED: leucine-rich repeat receptor-like...    127   2e-37   Amborella trichopoda
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    119   3e-37   Malus domestica [apple tree]
ref|XP_010258856.1|  PREDICTED: leucine-rich repeat receptor-like...    118   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010258857.1|  PREDICTED: leucine-rich repeat receptor-like...    118   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004506369.1|  PREDICTED: receptor-like protein kinase HAIK...    122   4e-37   Cicer arietinum [garbanzo]
ref|XP_008786487.1|  PREDICTED: receptor-like protein kinase HSL1       120   4e-37   
ref|XP_002522003.1|  protein with unknown function                      117   5e-37   
ref|XP_010264363.1|  PREDICTED: leucine-rich repeat receptor-like...    117   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    118   7e-37   Pyrus x bretschneideri [bai li]
gb|EYU46395.1|  hypothetical protein MIMGU_mgv1a000683mg                118   8e-37   Erythranthe guttata [common monkey flower]
ref|XP_004237515.1|  PREDICTED: leucine-rich repeat receptor-like...    112   9e-37   
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             119   9e-37   
ref|XP_001774832.1|  CLL3 clavata1-like receptor S/T protein kina...    109   1e-36   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-36   
gb|EPS70436.1|  hypothetical protein M569_04317                         117   1e-36   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    118   1e-36   
ref|XP_008795324.1|  PREDICTED: receptor-like protein kinase HSL1       118   1e-36   
ref|XP_011038464.1|  PREDICTED: leucine-rich repeat receptor-like...    115   2e-36   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-36   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    118   2e-36   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    117   2e-36   
ref|XP_006480075.1|  PREDICTED: leucine-rich repeat receptor-like...    114   2e-36   
gb|KDO60347.1|  hypothetical protein CISIN_1g001752mg                   114   2e-36   
ref|NP_001288525.1|  uncharacterized protein LOC103652818 precursor     117   2e-36   
ref|XP_006340511.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-36   
ref|XP_002973575.1|  hypothetical protein SELMODRAFT_30446              118   2e-36   
ref|XP_002975602.1|  hypothetical protein SELMODRAFT_30447              118   2e-36   
gb|KJB07870.1|  hypothetical protein B456_001G049500                    117   2e-36   
ref|XP_009343787.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-36   
ref|XP_006490143.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-36   
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-36   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             117   2e-36   
ref|XP_006306655.1|  hypothetical protein CARUB_v10008171mg             113   2e-36   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    118   3e-36   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    118   3e-36   
ref|XP_002889704.1|  CLAVATA1 receptor kinase                           114   3e-36   
emb|CDP05348.1|  unnamed protein product                                116   3e-36   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    116   3e-36   
ref|XP_006484616.1|  PREDICTED: leucine-rich repeat receptor-like...    115   3e-36   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             117   3e-36   
gb|KDO49231.1|  hypothetical protein CISIN_1g037197mg                   115   3e-36   
ref|XP_009783572.1|  PREDICTED: leucine-rich repeat receptor-like...    110   3e-36   
ref|XP_010912643.1|  PREDICTED: receptor-like protein kinase HSL1       120   3e-36   
gb|KFK43177.1|  hypothetical protein AALP_AA1G089800                    114   3e-36   
ref|XP_009788025.1|  PREDICTED: leucine-rich repeat receptor-like...    115   3e-36   
ref|XP_008651021.1|  PREDICTED: leucine-rich repeat receptor-like...    115   4e-36   
ref|XP_006648220.1|  PREDICTED: leucine-rich repeat receptor-like...    115   4e-36   
ref|XP_006417669.1|  hypothetical protein EUTSA_v10006658mg             114   4e-36   
ref|XP_008662594.1|  PREDICTED: receptor-like protein kinase HSL1       111   4e-36   
ref|XP_007038347.1|  Leucine-rich repeat protein kinase family pr...    116   4e-36   
ref|XP_002301848.1|  leucine-rich repeat transmembrane protein ki...    116   4e-36   
ref|XP_008218358.1|  PREDICTED: leucine-rich repeat receptor-like...    115   5e-36   
ref|XP_007208420.1|  hypothetical protein PRUPE_ppa000734mg             115   5e-36   
ref|XP_006421630.1|  hypothetical protein CICLE_v10004254mg             116   5e-36   
ref|XP_010458102.1|  PREDICTED: leucine-rich repeat receptor-like...    113   5e-36   
ref|XP_009623756.1|  PREDICTED: leucine-rich repeat receptor-like...    110   5e-36   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    117   5e-36   
ref|XP_004307799.1|  PREDICTED: leucine-rich repeat receptor-like...    116   5e-36   
ref|XP_010489073.1|  PREDICTED: leucine-rich repeat receptor-like...    113   5e-36   
ref|XP_012090461.1|  PREDICTED: leucine-rich repeat receptor-like...    116   5e-36   
ref|XP_010489056.1|  PREDICTED: leucine-rich repeat receptor-like...    113   6e-36   
ref|NP_172335.1|  CLV1-like leucine rich repeat transmembrane rec...    113   6e-36   
ref|XP_010475663.1|  PREDICTED: leucine-rich repeat receptor-like...    113   6e-36   
ref|XP_009393471.1|  PREDICTED: receptor-like protein kinase HAIKU2     113   7e-36   
ref|XP_002442602.1|  hypothetical protein SORBIDRAFT_08g022790          109   7e-36   
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...    116   7e-36   
ref|XP_007162602.1|  hypothetical protein PHAVU_001G165100g             114   8e-36   
ref|XP_006443728.1|  hypothetical protein CICLE_v10023610mg             112   8e-36   
gb|KHF97318.1|  Leucine-rich repeat receptor-like protein kinase TDR    115   8e-36   
ref|XP_011018348.1|  PREDICTED: leucine-rich repeat receptor-like...    114   8e-36   
gb|EMT01037.1|  Receptor-like protein kinase HSL1                       113   9e-36   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    112   9e-36   
ref|XP_009375883.1|  PREDICTED: LRR receptor-like serine/threonin...    107   1e-35   
gb|KEH39191.1|  LRR receptor-like kinase family protein                 117   1e-35   
ref|XP_004302107.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-35   
ref|XP_010553768.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-35   
ref|XP_009768910.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-35   
gb|KFK27903.1|  hypothetical protein AALP_AA8G445100                    113   1e-35   
ref|XP_009611681.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-35   
ref|XP_004146946.1|  PREDICTED: leucine-rich repeat receptor-like...    114   1e-35   
ref|XP_007131359.1|  hypothetical protein PHAVU_011G007200g             114   1e-35   
ref|XP_011077132.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-35   
ref|NP_001067561.1|  Os11g0232100                                       116   2e-35   
gb|EAY80442.1|  hypothetical protein OsI_35624                          116   2e-35   
ref|XP_003579100.1|  PREDICTED: receptor-like protein kinase HAIKU2     105   2e-35   
ref|XP_006837993.2|  PREDICTED: leucine-rich repeat receptor-like...    111   2e-35   
gb|EYU17948.1|  hypothetical protein MIMGU_mgv1a022168mg                113   2e-35   
gb|ERN00562.1|  hypothetical protein AMTR_s00102p00110610               111   2e-35   
emb|CDP04271.1|  unnamed protein product                                110   2e-35   
ref|XP_008674126.1|  PREDICTED: receptor-like protein kinase HSL1       110   2e-35   
ref|XP_010102197.1|  Leucine-rich repeat receptor-like protein ki...    113   2e-35   
ref|XP_006358242.1|  PREDICTED: leucine-rich repeat receptor-like...    111   2e-35   
ref|NP_200956.1|  leucine-rich repeat receptor-like protein kinas...    112   2e-35   
ref|XP_008453906.1|  PREDICTED: leucine-rich repeat receptor-like...    114   2e-35   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    118   2e-35   
ref|XP_002449308.1|  hypothetical protein SORBIDRAFT_05g007490          116   3e-35   
ref|XP_009136481.1|  PREDICTED: leucine-rich repeat receptor-like...    112   3e-35   
ref|XP_009345889.1|  PREDICTED: LRR receptor-like serine/threonin...    106   3e-35   
ref|XP_008364044.1|  PREDICTED: leucine-rich repeat receptor-like...    113   3e-35   
emb|CDY23065.1|  BnaC07g31220D                                          112   3e-35   
ref|XP_002866438.1|  hypothetical protein ARALYDRAFT_496307             111   3e-35   
ref|XP_004240244.1|  PREDICTED: leucine-rich repeat receptor-like...    113   3e-35   
ref|XP_007199391.1|  hypothetical protein PRUPE_ppa025898mg             144   3e-35   
dbj|BAJ97282.1|  predicted protein                                      114   4e-35   
dbj|BAJ87631.1|  predicted protein                                      114   4e-35   
ref|XP_007143951.1|  hypothetical protein PHAVU_007G116300g             111   4e-35   
gb|EAZ17908.1|  hypothetical protein OsJ_33455                          114   4e-35   
ref|XP_004235172.1|  PREDICTED: leucine-rich repeat receptor-like...    110   4e-35   
ref|XP_006355615.1|  PREDICTED: leucine-rich repeat receptor-like...    112   4e-35   
ref|XP_007030337.1|  Leucine-rich receptor-like protein kinase fa...    112   5e-35   
ref|XP_010457382.1|  PREDICTED: leucine-rich repeat receptor-like...    113   6e-35   
ref|XP_002510009.1|  receptor protein kinase, putative                  105   6e-35   
gb|KEH29421.1|  LRR receptor-like kinase family protein                 112   6e-35   
ref|XP_004514509.1|  PREDICTED: leucine-rich repeat receptor-like...    112   7e-35   
ref|XP_009613205.1|  PREDICTED: leucine-rich repeat receptor-like...    110   8e-35   
ref|XP_010091806.1|  Leucine-rich repeat receptor-like protein ki...    112   9e-35   
ref|XP_006394500.1|  hypothetical protein EUTSA_v10003570mg             110   9e-35   
ref|XP_004152065.1|  PREDICTED: leucine-rich repeat receptor-like...    111   1e-34   
dbj|BAJ97909.1|  predicted protein                                      112   1e-34   
gb|AEP14546.1|  clavata 1-like protein                                  113   1e-34   
ref|XP_007156676.1|  hypothetical protein PHAVU_002G007800g             103   2e-34   
ref|XP_011076386.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-34   
ref|XP_012089379.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-34   
ref|XP_008447373.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-34   
emb|CBI38662.3|  unnamed protein product                                108   2e-34   
ref|XP_003577685.2|  PREDICTED: receptor-like protein kinase HSL1       113   2e-34   
ref|XP_010483818.1|  PREDICTED: leucine-rich repeat receptor-like...    111   2e-34   
ref|XP_002309766.2|  hypothetical protein POPTR_0007s01340g             106   2e-34   
ref|XP_006279936.1|  hypothetical protein CARUB_v10025794mg             111   2e-34   
gb|EYU39523.1|  hypothetical protein MIMGU_mgv1a000654mg                107   3e-34   
ref|XP_010443968.1|  PREDICTED: leucine-rich repeat receptor-like...    111   3e-34   
ref|XP_002887421.1|  hypothetical protein ARALYDRAFT_476351             109   3e-34   
ref|XP_010934709.1|  PREDICTED: leucine-rich repeat receptor-like...    107   3e-34   
ref|XP_002971926.1|  hypothetical protein SELMODRAFT_96692              109   3e-34   
ref|XP_004495591.1|  PREDICTED: leucine-rich repeat receptor-like...    109   3e-34   
ref|XP_002993050.1|  hypothetical protein SELMODRAFT_136413             108   3e-34   
ref|XP_006390688.1|  hypothetical protein EUTSA_v10018075mg             106   4e-34   
gb|EMT18303.1|  Receptor-like protein kinase HSL1                       110   4e-34   
gb|KDP41545.1|  hypothetical protein JCGZ_15952                         100   4e-34   
ref|XP_006573682.1|  PREDICTED: LRR receptor-like serine/threonin...    108   4e-34   
ref|XP_003535373.1|  PREDICTED: leucine-rich repeat receptor-like...    109   4e-34   
ref|XP_006300302.1|  hypothetical protein CARUB_v10019725mg             107   4e-34   
emb|CDY02141.1|  BnaA03g40260D                                          107   5e-34   
ref|XP_010550315.1|  PREDICTED: leucine-rich repeat receptor-like...    105   6e-34   
gb|KJB18105.1|  hypothetical protein B456_003G034200                    100   7e-34   
ref|XP_006588706.1|  PREDICTED: leucine-rich repeat receptor-like...    107   7e-34   
gb|KHN05886.1|  Leucine-rich repeat receptor-like protein kinase ...    107   7e-34   
gb|AEP14545.1|  clavata 1-like protein                                  112   9e-34   
ref|XP_008802938.1|  PREDICTED: receptor-like protein kinase HAIKU2     107   1e-33   
dbj|BAF00973.1|  putative leucine-rich receptor-like protein kinase     107   1e-33   
gb|ADJ17363.1|  receptor kinase                                       99.4    1e-33   
ref|NP_177363.1|  leucine-rich receptor-like protein kinase             107   1e-33   
emb|CDX97498.1|  BnaC08g13630D                                          105   1e-33   
ref|XP_009110884.1|  PREDICTED: leucine-rich repeat receptor-like...    105   1e-33   
emb|CDY31136.1|  BnaA08g26860D                                          105   1e-33   
ref|XP_010471238.1|  PREDICTED: receptor-like protein kinase HSL1       107   1e-33   
emb|CDX72876.1|  BnaC06g33240D                                          107   1e-33   
ref|XP_010414844.1|  PREDICTED: receptor-like protein kinase HSL1...    107   1e-33   
ref|XP_010414842.1|  PREDICTED: receptor-like protein kinase HSL1...    107   1e-33   
gb|KHG04051.1|  LRR receptor-like serine/threonine-protein kinase...  98.6    1e-33   
ref|XP_008803980.1|  PREDICTED: leucine-rich repeat receptor-like...    108   1e-33   
ref|XP_010547240.1|  PREDICTED: receptor-like protein kinase 5        99.0    1e-33   
gb|KJB44792.1|  hypothetical protein B456_007G273700                    108   1e-33   
ref|XP_002531997.1|  Receptor protein kinase CLAVATA1 precursor, ...    102   1e-33   
ref|XP_010023353.1|  PREDICTED: LRR receptor-like serine/threonin...    101   1e-33   
emb|CDX96381.1|  BnaA07g29920D                                          105   2e-33   
ref|XP_010268651.1|  PREDICTED: LRR receptor-like serine/threonin...    108   2e-33   
ref|XP_009104866.1|  PREDICTED: receptor-like protein kinase HSL1       105   2e-33   
ref|XP_003555575.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-33   
gb|KHN14714.1|  Leucine-rich repeat receptor-like protein kinase ...    110   2e-33   
ref|XP_010534090.1|  PREDICTED: receptor-like protein kinase HSL1     99.0    2e-33   
ref|XP_009105878.1|  PREDICTED: receptor-like protein kinase HSL1       106   3e-33   
ref|XP_003579098.1|  PREDICTED: receptor-like protein kinase HSL1       109   3e-33   
gb|EMS64651.1|  Receptor-like protein kinase HSL1                       108   3e-33   
ref|XP_010693707.1|  PREDICTED: leucine-rich repeat receptor-like...    107   3e-33   
ref|XP_010428087.1|  PREDICTED: receptor-like protein kinase HSL1       107   4e-33   
gb|AEW08010.1|  hypothetical protein 0_16903_01                         129   4e-33   
gb|KJB11032.1|  hypothetical protein B456_001G237400                    106   4e-33   
ref|XP_004288298.1|  PREDICTED: LRR receptor-like serine/threonin...    105   4e-33   
ref|XP_010546156.1|  PREDICTED: leucine-rich repeat receptor-like...    108   4e-33   
ref|XP_006852745.1|  PREDICTED: receptor-like protein kinase HSL1       110   5e-33   
gb|KHN42599.1|  LRR receptor-like serine/threonine-protein kinase...    105   5e-33   
ref|XP_009354606.1|  PREDICTED: LRR receptor-like serine/threonin...    107   5e-33   
gb|KHN13033.1|  LRR receptor-like serine/threonine-protein kinase...    102   5e-33   
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390             104   5e-33   
ref|XP_002969446.1|  hypothetical protein SELMODRAFT_146189             110   6e-33   
ref|XP_010023354.1|  PREDICTED: LRR receptor-like serine/threonin...  99.0    6e-33   
ref|XP_007132769.1|  hypothetical protein PHAVU_011G123500g             104   6e-33   
emb|CDX68276.1|  BnaA07g23160D                                          103   6e-33   
ref|XP_009354587.1|  PREDICTED: LRR receptor-like serine/threonin...    107   6e-33   
ref|XP_010057361.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    101   7e-33   
emb|CDY50444.1|  BnaC06g24200D                                          104   7e-33   
ref|XP_002961218.1|  hypothetical protein SELMODRAFT_140032             110   8e-33   
ref|XP_004511799.1|  PREDICTED: LRR receptor-like serine/threonin...    112   9e-33   
ref|XP_002263151.3|  PREDICTED: LRR receptor-like serine/threonin...    102   1e-32   
ref|XP_008655811.1|  PREDICTED: receptor-like protein kinase HSL1       109   1e-32   
ref|XP_011073656.1|  PREDICTED: LRR receptor-like serine/threonin...  99.4    1e-32   
ref|XP_008789980.1|  PREDICTED: receptor-like protein kinase HSL1       110   1e-32   
ref|XP_003590988.1|  Receptor-like protein kinase                       104   2e-32   
ref|XP_008779605.1|  PREDICTED: leucine-rich repeat receptor-like...    103   2e-32   
gb|EYU44538.1|  hypothetical protein MIMGU_mgv1a002096mg                102   2e-32   
ref|XP_010941424.1|  PREDICTED: leucine-rich repeat receptor-like...    102   2e-32   
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    2e-32   
ref|XP_009395349.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-32   
ref|XP_004970775.1|  PREDICTED: receptor-like protein kinase HSL1...    105   2e-32   
ref|XP_004970774.1|  PREDICTED: receptor-like protein kinase HSL1...    105   2e-32   
gb|KHN14828.1|  Leucine-rich repeat receptor-like protein kinase ...    105   2e-32   
ref|XP_006466392.1|  PREDICTED: LRR receptor-like serine/threonin...    104   3e-32   
gb|EYU41358.1|  hypothetical protein MIMGU_mgv1a000915mg                100   3e-32   
gb|AES94467.2|  LRR receptor-like kinase family protein                 102   3e-32   
ref|XP_001754607.1|  CLL2 clavata1-like receptor S/T protein kina...    105   3e-32   
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...  98.6    3e-32   
ref|XP_010023352.1|  PREDICTED: LRR receptor-like serine/threonin...    101   3e-32   
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450        99.0    3e-32   
gb|EAY76695.1|  hypothetical protein OsI_04648                          105   4e-32   
ref|NP_001044979.1|  Os01g0878300                                       105   4e-32   
ref|XP_010911833.1|  PREDICTED: receptor-like protein kinase HSL1       104   4e-32   
ref|XP_006466393.1|  PREDICTED: LRR receptor-like serine/threonin...    103   4e-32   
ref|XP_006426174.1|  hypothetical protein CICLE_v10026946mg             103   4e-32   
ref|XP_002456732.1|  hypothetical protein SORBIDRAFT_03g041570          103   4e-32   
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...  96.7    4e-32   
dbj|BAJ99137.1|  predicted protein                                    97.1    4e-32   
gb|KDO78779.1|  hypothetical protein CISIN_1g039922mg                   103   4e-32   
ref|XP_002462225.1|  hypothetical protein SORBIDRAFT_02g022100          107   4e-32   
ref|XP_007047653.1|  Receptor kinase isoform 1                        96.3    5e-32   
ref|XP_008389021.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    104   5e-32   
ref|XP_002961203.1|  hypothetical protein SELMODRAFT_164315             130   5e-32   
emb|CDP02659.1|  unnamed protein product                                100   5e-32   
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)        97.4    6e-32   
gb|EAZ02682.1|  hypothetical protein OsI_24796                        97.4    6e-32   
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...  96.3    6e-32   



>ref|XP_009769216.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=982

 Score =   192 bits (489),  Expect(2) = 2e-70, Method: Composition-based stats.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMEL+SGK+PIE EYGEN++IV+WVS+KLKSKES+LS
Sbjct  850  IAPEYGYTHKVNEKSDVYSFGVVLMELISGKRPIEPEYGENSNIVTWVSSKLKSKESVLS  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +VDS+I E FKEDAIKVLRIAI+CT  LP+ RPTMR VV+MLEDAEPCKLV IIVSKD
Sbjct  910  IVDSSIPEAFKEDAIKVLRIAIVCTDRLPSLRPTMRNVVKMLEDAEPCKLVGIIVSKD  967


 Score =   101 bits (252),  Expect(2) = 2e-70, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CD+P+IHRDVKSSNILLDE FKPRIADFGLAKI Q +S+ KD+THVI GTHGYIAP
Sbjct  798  CDKPVIHRDVKSSNILLDELFKPRIADFGLAKIAQADSN-KDSTHVIAGTHGYIAP  852



>ref|XP_006356791.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=984

 Score =   190 bits (483),  Expect(2) = 2e-69, Method: Composition-based stats.
 Identities = 94/131 (72%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMEL+SGK+PIE+EYGEN +IV+WVS+KLKSKES+LS
Sbjct  852  IAPEYGYTHKVNEKSDVYSFGVVLMELISGKRPIESEYGENGNIVTWVSSKLKSKESVLS  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD--  274
            +VDS+I E FKEDAIKVLRIAI+CT+ LP  RPTMR VV+MLE AEPC+LV IIVSKD  
Sbjct  912  IVDSSILEAFKEDAIKVLRIAIVCTSRLPTLRPTMRNVVKMLEKAEPCRLVGIIVSKDDG  971

Query  273  AAKLDNPSDNT  241
            + K +   D+T
Sbjct  972  SIKTEQLKDHT  982


 Score =   101 bits (251),  Expect(2) = 2e-69, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CD+P+IHRDVKSSNILLDEF KPRIADFGLA+I Q +S+ KDTTHVI GTHGYIAP
Sbjct  800  CDKPVIHRDVKSSNILLDEFCKPRIADFGLARIAQADST-KDTTHVIAGTHGYIAP  854



>ref|XP_004238042.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=984

 Score =   188 bits (478),  Expect(2) = 3e-69, Method: Composition-based stats.
 Identities = 89/118 (75%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMEL+SGK+PIE+EYGEN +IV+WVS+KLKSKES+LS
Sbjct  852  IAPEYGYTHKVNEKSDVYSFGVVLMELISGKRPIESEYGENGNIVTWVSSKLKSKESVLS  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +VDS+I E FKEDAI+VLRIAI+CT+ LP  RPTMR VV+MLE+AEPC+LV +IVSKD
Sbjct  912  IVDSSIPEAFKEDAIEVLRIAIVCTSRLPTLRPTMRNVVKMLENAEPCRLVGMIVSKD  969


 Score =   102 bits (254),  Expect(2) = 3e-69, Method: Composition-based stats.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CD+P+IHRDVKSSNILLDEF KPRIADFGLAKI Q +S+ KDTTHVI GTHGYIAP
Sbjct  800  CDKPVIHRDVKSSNILLDEFCKPRIADFGLAKIAQADST-KDTTHVIAGTHGYIAP  854



>ref|XP_009591322.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=982

 Score =   190 bits (482),  Expect(2) = 9e-69, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMEL+SGK+PIE EYGEN +IV+WVS+KLKSKES+LS
Sbjct  850  IAPEYGYTHKVNEKSDVYSFGVVLMELISGKRPIEPEYGENRNIVTWVSSKLKSKESVLS  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +VDS+I E FKEDAIKVLRIAI+CT  LP+ RPTMR VV+MLEDAEP KLV IIVSKD
Sbjct  910  IVDSSIPESFKEDAIKVLRIAIVCTDKLPSLRPTMRNVVKMLEDAEPFKLVGIIVSKD  967


 Score = 99.0 bits (245),  Expect(2) = 9e-69, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CD+P+IHRDVKSSNILLDE  KPRIADFGLAKI Q +S+ KD+THV+ GTHGYIAP
Sbjct  798  CDKPVIHRDVKSSNILLDELLKPRIADFGLAKIAQADST-KDSTHVVAGTHGYIAP  852



>emb|CDP00968.1| unnamed protein product [Coffea canephora]
Length=1051

 Score =   185 bits (470),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+G+N DIVSWVS+KLKSKE++LS
Sbjct  920   IAPEYGYTHKVNEKSDVYSFGVVLMELVTGKRPIEPEFGDNKDIVSWVSSKLKSKETVLS  979

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
             +VDSAI + +KE+A+KVL+IAILCTA  P  RPTMR VV MLEDAEPCKLV II+SKD
Sbjct  980   IVDSAILDGYKEEALKVLKIAILCTARQPVQRPTMRTVVHMLEDAEPCKLVGIIISKD  1037


 Score =   101 bits (251),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLDE  KPRIADFGLAKI+Q N++ KD+THVI GTHGYIAP
Sbjct  868  CDRPVIHRDVKSSNILLDEDLKPRIADFGLAKIVQANAT-KDSTHVIAGTHGYIAP  922



>ref|XP_006417507.1| hypothetical protein EUTSA_v10006696mg [Eutrema salsugineum]
 dbj|BAJ34167.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35860.1| hypothetical protein EUTSA_v10006696mg [Eutrema salsugineum]
Length=975

 Score =   179 bits (455),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 80/119 (67%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  849  IAPEYGYSSKVNEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  908

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDA+K+LR+AILCTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  909  IVDKKIGEMYREDAVKILRVAILCTARLPGQRPTMRSVVQMIEDAEPCRLMGIVISKES  967


 Score =   100 bits (248),  Expect(2) = 5e-66, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDEFFKPRIADFGLAKILQ N+   D+THV+ GT+GYIAP
Sbjct  797  ERPVIHRDVKSSNILLDEFFKPRIADFGLAKILQANNGGLDSTHVVAGTYGYIAP  851



>ref|XP_006433710.1| hypothetical protein CICLE_v10000155mg [Citrus clementina]
 gb|ESR46950.1| hypothetical protein CICLE_v10000155mg [Citrus clementina]
Length=982

 Score =   178 bits (452),  Expect(2) = 9e-65, Method: Composition-based stats.
 Identities = 84/120 (70%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GKKPIE EYGEN DIV WV +   SKES+L+
Sbjct  847  IAPEYGYTSKVDEKSDVYSFGVVLMELVTGKKPIEPEYGENKDIVIWVCSHFNSKESVLT  906

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS+I E FKE+A+++LRIA+LCTA  P  RPTMR VVQMLE+AEPC LV I++SKD A
Sbjct  907  LVDSSIPETFKENAVEILRIAVLCTARQPALRPTMRSVVQMLEEAEPCNLVGIVISKDGA  966


 Score = 97.1 bits (240),  Expect(2) = 9e-65, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C RP+IHRDVKSSNILLDEF KPRIADFGLA+I+Q N   KDTTHVI GT GYIAP
Sbjct  795  CARPVIHRDVKSSNILLDEFLKPRIADFGLARIVQSNGG-KDTTHVIAGTTGYIAP  849



>ref|XP_006472374.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=982

 Score =   177 bits (450),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GKKPIE EYGEN DIV WV +   SK+S+L+
Sbjct  847  IAPEYGYTSKVDEKSDVYSFGVVLMELVTGKKPIEPEYGENKDIVRWVCSHFNSKQSVLT  906

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS+I E FKE+A+++LRIA+LCT   P  RPTMR VVQMLE+AEPC LV I++SKD A
Sbjct  907  LVDSSIPETFKENAVEILRIAVLCTTTQPALRPTMRSVVQMLEEAEPCNLVGIVISKDGA  966


 Score = 97.1 bits (240),  Expect(2) = 2e-64, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C RP+IHRDVKSSNILLDEF KPRIADFGLA+I+Q N   KDTTHVI GT GYIAP
Sbjct  795  CARPVIHRDVKSSNILLDEFLKPRIADFGLARIVQSNGG-KDTTHVIAGTTGYIAP  849



>gb|KDO81346.1| hypothetical protein CISIN_1g047677mg, partial [Citrus sinensis]
Length=200

 Score =   179 bits (454),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GKKPIE EYGEN DIV WV +   SK+S+L+
Sbjct  65   IAPEYGYTSKVDEKSDVYSFGVVLMELVTGKKPIEPEYGENKDIVRWVCSHFNSKQSVLT  124

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS+I E FKE+A+++LRIA+LCT   P  RPTMR VVQMLE+AEPC LV I++SKD A
Sbjct  125  LVDSSIPETFKENAVEILRIAVLCTTTQPALRPTMRSVVQMLEEAEPCNLVGIVISKDGA  184


 Score = 95.9 bits (237),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C RP+IHRDVKSSNILLDEF KPRIADFGLA+I+Q N   KDTTHVI GT GYIAP
Sbjct  13   CARPVIHRDVKSSNILLDEFLKPRIADFGLARIVQSNGG-KDTTHVIAGTTGYIAP  67



>ref|XP_010490508.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=974

 Score =   179 bits (454),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 83/119 (70%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAEYGE+ DIV+WVS  LKSKES++ 
Sbjct  848  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEYGESKDIVNWVSNNLKSKESVME  907

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  + E +KEDAIK+LRIAILCTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  908  IVDKKLGEMYKEDAIKLLRIAILCTARLPGQRPTMRSVVQMIEDAEPCRLMGIVISKES  966


 Score = 94.7 bits (234),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++P+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAP
Sbjct  796  EKPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAP  850



>gb|KFK43299.1| hypothetical protein AALP_AA1G106000 [Arabis alpina]
Length=974

 Score =   177 bits (450),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 82/119 (69%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV WVS  LKSKES++ 
Sbjct  847  IAPEYGYSSKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVDWVSNNLKSKESVME  906

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E +K+DAIK+LRIAILCTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  907  IVDKKIGEMYKDDAIKILRIAILCTARLPALRPTMRSVVQMIEDAEPCRLMGIVISKES  965


 Score = 96.3 bits (238),  Expect(2) = 3e-64, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++P+IHRDVKSSNILLDEF KPRIADFGLAKILQ N+   D+THV+ GT+GYIAP
Sbjct  795  EKPVIHRDVKSSNILLDEFLKPRIADFGLAKILQANNGGLDSTHVVAGTYGYIAP  849



>ref|XP_010458318.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=974

 Score =   179 bits (453),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAEYGE+ DIV+WVS  LKSKES++ 
Sbjct  848  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEYGESKDIVNWVSNNLKSKESVME  907

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VD  + E +KEDAIK+LRIAILCTA LP  RPTMR VVQM+EDAEPC+L+ I++SK
Sbjct  908  IVDKKLGEMYKEDAIKLLRIAILCTARLPGQRPTMRSVVQMIEDAEPCRLMGIVISK  964


 Score = 94.7 bits (234),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++P+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAP
Sbjct  796  EKPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAP  850



>ref|XP_010475857.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=975

 Score =   178 bits (452),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAEYGE+ DIV WVS  LKSKES++ 
Sbjct  849  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEYGESKDIVDWVSNNLKSKESVME  908

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  + E +KEDAIK+LRIAILCTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  909  IVDKKLGEMYKEDAIKLLRIAILCTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  967


 Score = 94.7 bits (234),  Expect(2) = 4e-64, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++P+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAP
Sbjct  797  EKPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAP  851



>ref|XP_002889779.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66038.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   178 bits (451),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 82/119 (69%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  850  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LRIAILCTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  910  IVDKKIGEMYREDAIKILRIAILCTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  968


 Score = 94.7 bits (234),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE+ KPRIADFGLAKILQ ++   D+THV+ GT+GYIAP
Sbjct  798  ERPVIHRDVKSSNILLDEYLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAP  852



>gb|EYU36421.1| hypothetical protein MIMGU_mgv1a000813mg [Erythranthe guttata]
Length=977

 Score =   179 bits (453),  Expect(2) = 9e-64, Method: Composition-based stats.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSD+YSFGVVLMELV+GKKPIEAE+GEN DIV WV  KLK+KES++S
Sbjct  845  IAPEYGYTCKVNEKSDLYSFGVVLMELVTGKKPIEAEFGENKDIVDWVCGKLKTKESVIS  904

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VD AI E ++E+AIKVL++AILCTA LP  RPTMR VVQMLE+A+P +LVSI+VSKD  
Sbjct  905  IVDLAIPEFYRENAIKVLKVAILCTARLPTLRPTMRTVVQMLEEAQPYQLVSIVVSKDGG  964


 Score = 93.2 bits (230),  Expect(2) = 9e-64, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLDE  KP IADFGLAKI+Q NS+  ++T +I GTHGYIAP
Sbjct  793  CDRPVIHRDVKSSNILLDEHLKPTIADFGLAKIIQANST-TESTQIIAGTHGYIAP  847



>ref|XP_006306692.1| hypothetical protein CARUB_v10008210mg [Capsella rubella]
 gb|EOA39590.1| hypothetical protein CARUB_v10008210mg [Capsella rubella]
Length=968

 Score =   176 bits (445),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 81/119 (68%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  842  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  901

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LRIAILCTA LP  RPTMR +VQM+EDAEPC+L+ I++SK++
Sbjct  902  IVDKKIGEMYREDAIKMLRIAILCTARLPGLRPTMRSLVQMIEDAEPCRLMGIVISKES  960


 Score = 96.3 bits (238),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAP
Sbjct  790  ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAP  844



>gb|AAL12626.1| leucine-rich repeat receptor-like kinase F21M12.36 [Arabidopsis 
thaliana]
Length=977

 Score =   177 bits (449),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  621  AEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMV  442
            AEYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +V
Sbjct  853  AEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIV  912

Query  441  DSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            D  I E ++EDA+K+LRIAI+CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  913  DKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  969


 Score = 94.4 bits (233),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPG  726
            +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP 
Sbjct  798  ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAPA  853



>ref|NP_172468.3| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE28523.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=977

 Score =   177 bits (449),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  621  AEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMV  442
            AEYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +V
Sbjct  853  AEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIV  912

Query  441  DSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            D  I E ++EDA+K+LRIAI+CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  913  DKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  969


 Score = 94.4 bits (233),  Expect(2) = 1e-63, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPG  726
            +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP 
Sbjct  798  ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAPA  853



>emb|CDY62731.1| BnaC05g49230D [Brassica napus]
Length=951

 Score =   174 bits (440),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  828  IAPEYGYASKVNEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  887

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LR+AILCTA  P  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  888  IVDKKIGEMYREDAIKMLRVAILCTARQPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  946


 Score = 96.7 bits (239),  Expect(2) = 3e-63, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ N+   D+THV+ GT+GYIAP
Sbjct  776  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQTNNGGLDSTHVVAGTYGYIAP  830



>ref|NP_850942.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL32758.1| Unknown protein [Arabidopsis thaliana]
 gb|ACN59227.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE28522.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=976

 Score =   176 bits (445),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 80/119 (67%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  850  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDA+K+LRIAI+CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  910  IVDKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  968


 Score = 94.4 bits (233),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP
Sbjct  798  ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAP  852



>ref|XP_010268649.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nelumbo nucifera]
Length=1004

 Score =   171 bits (432),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 78/123 (63%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EK DVYSFGVVLMELV+GK+PIE EYGEN DIV W+ +K+ S+ES++ 
Sbjct  854  IAPEYAYTCKVNEKGDVYSFGVVLMELVTGKRPIEPEYGENKDIVQWILSKMGSRESVMG  913

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS I +  KEDA+KVLRIA+ CT+ LP  RP+MR VVQMLEDAEPCKL+S+ ++KD  
Sbjct  914  VVDSRIPDGLKEDAVKVLRIAVHCTSRLPALRPSMRTVVQMLEDAEPCKLISVAIAKDDP  973

Query  267  KLD  259
             L+
Sbjct  974  SLN  976


 Score = 99.4 bits (246),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP++HRDVKSSNILLDEF KPRIADFGLAKI+Q N   KD+T VIPGTHGYIAP
Sbjct  803  DRPVLHRDVKSSNILLDEFLKPRIADFGLAKIVQANGG-KDSTQVIPGTHGYIAP  856



>ref|XP_010553669.1| PREDICTED: receptor-like protein kinase HAIKU2 [Tarenaya hassleriana]
Length=977

 Score =   178 bits (451),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT +V EK DVYSFGVVLMELV+GKKPIEAE+GEN DIV WVS  LKSK  +  
Sbjct  851  IAPEYGYTSRVNEKCDVYSFGVVLMELVTGKKPIEAEFGENKDIVKWVSDNLKSKGRVTE  910

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            MVD  I E ++ DA+KVLRI ILCT  +P+SRPTMRRVVQM+E+AEPCKLV I+VSKD
Sbjct  911  MVDKRIPETYRADAVKVLRIGILCTGKIPSSRPTMRRVVQMIEEAEPCKLVGIVVSKD  968


 Score = 92.0 bits (227),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++P+IHRDVKSSNILLDE FKPRIADFGLAKIL+ +++  D+TH+I GT+GYIAP
Sbjct  799  EKPVIHRDVKSSNILLDEKFKPRIADFGLAKILRADNTGLDSTHIIAGTYGYIAP  853



>gb|KJB64050.1| hypothetical protein B456_010G030600 [Gossypium raimondii]
Length=985

 Score =   173 bits (439),  Expect(2) = 8e-63, Method: Composition-based stats.
 Identities = 81/119 (68%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVL+EL++GKKPIE EYGEN DIVSWV + LK KES+LS
Sbjct  859  IAPEYGYTCKVDEKSDVYSFGVVLLELMTGKKPIEPEYGENKDIVSWVGSNLKGKESVLS  918

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I   FKEDA+KVL+IAILCT  LP  RPTMRRVVQML++AEP +L  +++ KD+
Sbjct  919  IVDPKIPHAFKEDAMKVLKIAILCTTTLPALRPTMRRVVQMLKEAEPYRLAGLVIGKDS  977


 Score = 95.5 bits (236),  Expect(2) = 8e-63, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSC-KDTTHVIPGTHGYIAP  729
            C++P++HRDVKSSNILLDE+ KP+I+DFGLAKI+Q NSS   D+THVI GTHGYIAP
Sbjct  805  CEKPVLHRDVKSSNILLDEYLKPKISDFGLAKIVQANSSIGNDSTHVIAGTHGYIAP  861



>dbj|BAD94141.1| leucine-rich repeat receptor-like kinase At1g09970 [Arabidopsis 
thaliana]
Length=322

 Score =   174 bits (442),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  196  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  255

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDA+K+LRIAI+CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  256  IVDKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  314


 Score = 94.4 bits (233),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP
Sbjct  144  ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAP  198



>ref|XP_009148316.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=964

 Score =   173 bits (439),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 80/119 (67%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  841  IAPEYGYASKVNEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  900

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LR+AILCTA  P  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  901  IVDKKIGEMYREDAIKMLRVAILCTARQPGVRPTMRSVVQMIEDAEPCRLMGIVISKES  959


 Score = 95.1 bits (235),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ N+   D++HV+ GT+GYIAP
Sbjct  789  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQTNNGGLDSSHVVAGTYGYIAP  843



>gb|KHG10020.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=783

 Score =   174 bits (441),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVL+ELV+GKKPIE EYGEN DIVSWV + LK KES+LS
Sbjct  657  IAPEYGYTCKVDEKSDVYSFGVVLLELVTGKKPIEQEYGENKDIVSWVGSNLKGKESVLS  716

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I   FKEDA+KVL+IAILCT  LP  RPTMRRVVQML++A P +LV I++ KD+
Sbjct  717  IVDPNIPHAFKEDAMKVLKIAILCTTTLPALRPTMRRVVQMLKEAGPYRLVGIVIGKDS  775


 Score = 94.4 bits (233),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSC-KDTTHVIPGTHGYIAP  729
            C++P++HRDVKSSNILLDE+ KP+I+DFGLAKI+Q  SS   D+THVI GTHGYIAP
Sbjct  603  CEKPVLHRDVKSSNILLDEYLKPKISDFGLAKIVQAKSSIGNDSTHVIAGTHGYIAP  659



>emb|CDY57935.1| BnaA06g38030D, partial [Brassica napus]
Length=623

 Score =   173 bits (438),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  500  IAPEYGYASKVNEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  559

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LR+AILCT   P  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  560  IVDKKIGEMYREDAIKMLRVAILCTGRQPGVRPTMRSVVQMIEDAEPCRLMGIVISKES  618


 Score = 94.4 bits (233),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ N+   D++HV+ GT+GYIAP
Sbjct  448  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQTNNGGLDSSHVVAGTYGYIAP  502



>ref|XP_011074301.1| PREDICTED: receptor-like protein kinase HAIKU2 [Sesamum indicum]
Length=980

 Score =   169 bits (429),  Expect(2) = 5e-62, Method: Composition-based stats.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIV WV  KLK+KES++S
Sbjct  849  IAPEYAYTNKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVDWVCGKLKTKESVVS  908

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDSAI E  +E+AIKVL++AILCTA L   RPTMR VVQMLE+A+P  L+SI+VSKD  
Sbjct  909  LVDSAIPEVHRENAIKVLKVAILCTARLHTLRPTMRTVVQMLEEAQPWHLLSIVVSKDGG  968


 Score = 96.7 bits (239),  Expect(2) = 5e-62, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLDE  KPRIADFGLAKI+Q NS+ K++T +I GTHGYIAP
Sbjct  797  CDRPVIHRDVKSSNILLDEDLKPRIADFGLAKIVQANSN-KESTQIIAGTHGYIAP  851



>emb|CDY22611.1| BnaC08g42450D [Brassica napus]
Length=943

 Score =   172 bits (436),  Expect(2) = 9e-62, Method: Composition-based stats.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  817  IAPEYGYSSKVNEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  876

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LR+AILCTA  P  RPTMR VV M+EDAEPC+L+ I++SK++
Sbjct  877  IVDKKIGEMYREDAIKLLRVAILCTARQPGLRPTMRSVVHMIEDAEPCRLMGIVISKES  935


 Score = 93.2 bits (230),  Expect(2) = 9e-62, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ N+    +THV+ GT+GYIAP
Sbjct  765  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQTNNGDLHSTHVVAGTYGYIAP  819



>gb|KEH36109.1| LRR receptor-like kinase [Medicago truncatula]
Length=986

 Score =   167 bits (424),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 79/120 (66%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT +V EKSDVYSFGVVLMELV+GK+P E E+GEN DIVSWV  K +SKE  +S
Sbjct  858  IAPEYGYTYRVNEKSDVYSFGVVLMELVTGKRPSEPEFGENKDIVSWVHGKTRSKEKFMS  917

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS I E +KE+A KVLR A+LCTA +P  RP+MR VVQ LEDA PCKLV I++SKD +
Sbjct  918  VVDSRIPEMYKEEACKVLRTAVLCTATIPAMRPSMRAVVQKLEDAVPCKLVGIVISKDGS  977


 Score = 97.1 bits (240),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI+  +   KD+TH+I GTHGYIAP
Sbjct  806  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVHAD-VVKDSTHIIAGTHGYIAP  860



>emb|CDY53829.1| BnaA09g57210D [Brassica napus]
Length=897

 Score =   171 bits (434),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVL+ELV+GKKPIEAE+GE+ DIV WVS KLKSKES++ 
Sbjct  771  IAPEYGYSSKVNEKCDVYSFGVVLIELVTGKKPIEAEFGESKDIVHWVSNKLKSKESVME  830

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LR+AILCTA  P  RPTMR VV M+EDAEPC+L+ I++SK++
Sbjct  831  IVDKKIGEMYREDAIKLLRVAILCTARQPGLRPTMRSVVHMIEDAEPCRLMGIVISKES  889


 Score = 93.2 bits (230),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ N+    +THV+ GT+GYIAP
Sbjct  719  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQTNNGDLHSTHVVAGTYGYIAP  773



>ref|XP_009118284.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=973

 Score =   170 bits (431),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVL+ELV+GKKPIEAE+GE+ DIV WVS KLKSKES++ 
Sbjct  847  IAPEYGYSSKVNEKCDVYSFGVVLIELVTGKKPIEAEFGESKDIVHWVSNKLKSKESVME  906

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LR+AILCTA  P  RPTMR VV M+EDAEPC+L+ I++SK++
Sbjct  907  IVDKKIGEMYREDAIKLLRVAILCTARQPGLRPTMRSVVHMIEDAEPCRLMGIVISKES  965


 Score = 93.2 bits (230),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ N+    +THV+ GT+GYIAP
Sbjct  795  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQTNNGDLHSTHVVAGTYGYIAP  849



>ref|XP_004501071.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cicer arietinum]
Length=985

 Score =   164 bits (415),  Expect(2) = 5e-61, Method: Composition-based stats.
 Identities = 79/120 (66%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT +V EKSDVYSFGVVLMELV+GK+P E+E+GEN DIVSWV  K  SKE   S
Sbjct  857  IAPEYGYTYRVNEKSDVYSFGVVLMELVTGKRPSESEFGENKDIVSWVHGKAGSKEKFKS  916

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             VD  I E +KE+A KVLR A+LCTA LP  RP+MR VVQ LEDA PCKLV I++SKD +
Sbjct  917  AVDLRIPEMYKEEACKVLRTAVLCTATLPAMRPSMRAVVQKLEDAAPCKLVRIVISKDGS  976


 Score = 99.0 bits (245),  Expect(2) = 5e-61, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI++ N   KD+TH+I GTHGYIAP
Sbjct  805  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVRAN-VVKDSTHIIAGTHGYIAP  859



>gb|KJB16079.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=968

 Score =   166 bits (419),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+P+E E+GEN DIV W+ TKLK+KE+++ 
Sbjct  848  MAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPVEPEFGENKDIVYWIYTKLKTKETLVE  907

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             VD  I    KEDAIKVLRIA+ CTA +P  RP+MR+VVQMLE+AEPCKL  IIV +   
Sbjct  908  AVDPKISMASKEDAIKVLRIAVHCTAKIPALRPSMRKVVQMLEEAEPCKLTDIIVHEKGE  967

Query  267  K  265
            K
Sbjct  968  K  968


 Score = 96.3 bits (238),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q N S  D THVI GTHGY+AP
Sbjct  796  CDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQ-NGSGGDWTHVIAGTHGYMAP  850



>gb|KJB16078.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=996

 Score =   165 bits (418),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+P+E E+GEN DIV W+ TKLK+KE+++ 
Sbjct  876  MAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPVEPEFGENKDIVYWIYTKLKTKETLVE  935

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             VD  I    KEDAIKVLRIA+ CTA +P  RP+MR+VVQMLE+AEPCKL  IIV +   
Sbjct  936  AVDPKISMASKEDAIKVLRIAVHCTAKIPALRPSMRKVVQMLEEAEPCKLTDIIVHEKGE  995

Query  267  K  265
            K
Sbjct  996  K  996


 Score = 96.3 bits (238),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q N S  D THVI GTHGY+AP
Sbjct  824  CDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQ-NGSGGDWTHVIAGTHGYMAP  878



>emb|CDY20667.1| BnaC08g13910D [Brassica napus]
Length=966

 Score =   169 bits (427),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVL+ELV+G+KPIEAE+GE+ DI++WVS  L SKES++ 
Sbjct  847  MAPEYGYSSKVNEKCDVYSFGVVLIELVTGRKPIEAEFGESKDILNWVSNNLNSKESVME  906

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +VD  I E ++EDA+K+LR+AILCTA  P  RPTMR VVQM+EDAEPC+L+ I++SK+
Sbjct  907  IVDKNIGEMYREDAVKMLRVAILCTARQPGRRPTMRSVVQMIEDAEPCRLMGIVISKE  964


 Score = 92.4 bits (228),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ  +   D+THV+ GT+GY+AP
Sbjct  795  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQDKNGGLDSTHVVAGTYGYMAP  849



>ref|XP_009144482.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=966

 Score =   171 bits (433),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVLMELV+G+KPIEAE+GE+ DIV WVS  L SKES++ 
Sbjct  847  MAPEYGYSSKVNEKCDVYSFGVVLMELVTGRKPIEAEFGESKDIVDWVSNNLNSKESVME  906

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +VD  I E ++EDA+K+LR+AILCTA  P  RPTMR VVQM+EDAEPC+L+ I++SK+
Sbjct  907  VVDKNIGEMYREDAVKMLRVAILCTARQPGRRPTMRSVVQMIEDAEPCRLMGIVISKE  964


 Score = 88.2 bits (217),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ  +   D+T V+ GT+GY+AP
Sbjct  795  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQDKNGGLDSTLVVAGTYGYMAP  849



>emb|CDY31055.1| BnaA08g26050D [Brassica napus]
Length=966

 Score =   171 bits (433),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY+ KV EK DVYSFGVVLMELV+G+KPIEAE+GE+ DIV WVS  L SKES++ 
Sbjct  847  MAPEYGYSSKVNEKCDVYSFGVVLMELVTGRKPIEAEFGESKDIVDWVSNNLNSKESVME  906

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +VD  I E ++EDA+K+LR+AILCTA  P  RPTMR VVQM+EDAEPC+L+ I++SK+
Sbjct  907  VVDKNIGEMYREDAVKMLRVAILCTARQPGRRPTMRSVVQMIEDAEPCRLMGIVISKE  964


 Score = 88.2 bits (217),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDE FKPRIADFGLAKILQ  +   D+T V+ GT+GY+AP
Sbjct  795  ERPVIHRDVKSSNILLDESFKPRIADFGLAKILQDKNGGLDSTLVVAGTYGYMAP  849



>ref|XP_009779240.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=990

 Score =   167 bits (424),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 77/116 (66%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP++AEYGENNDIV WV +K++SK S++ 
Sbjct  853  IAPEYAYTTKVTEKSDVYSFGVVLMELVTGKKPVDAEYGENNDIVQWVCSKIRSKTSMID  912

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            +VDS+I E FK+DA++VLRIA+ CTA  P  RP+MR VV MLE+AEPCKL S++V+
Sbjct  913  LVDSSILEGFKKDAVEVLRIAVHCTARTPALRPSMRMVVHMLEEAEPCKLTSVVVN  968


 Score = 90.1 bits (222),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP++HRDVKSSNILLDE  KP+IADFGLAK+LQ N + KD++ V+ GTHGYIAP
Sbjct  802  DRPVMHRDVKSSNILLDEKMKPKIADFGLAKVLQVNGT-KDSSQVVAGTHGYIAP  855



>ref|XP_010544042.1| PREDICTED: receptor-like protein kinase HAIKU2 [Tarenaya hassleriana]
Length=969

 Score =   161 bits (407),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 77/119 (65%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESIL  451
            +  E GYT KV EKSDVYSFGVVLME+V+GKK IE  E GE  +IV WVS  LK KE ++
Sbjct  849  IAPEQGYTWKVNEKSDVYSFGVVLMEIVTGKKAIEETESGEKKEIVKWVSENLKGKEEVM  908

Query  450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +MVD  I+E  +EDAI++LRI I+CTA +P+SRPTMR+VV+M+EDAEPCKLV I++SKD
Sbjct  909  AMVDKRIEEIHREDAIRILRIGIMCTARVPSSRPTMRKVVEMIEDAEPCKLVGILISKD  967


 Score = 96.3 bits (238),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++P+IHRDVKSSNILLDEFFKPRIADFGLAKILQ  ++  D+TH++ GT+GYIAP
Sbjct  797  EKPVIHRDVKSSNILLDEFFKPRIADFGLAKILQAKNAGLDSTHIVAGTYGYIAP  851



>ref|XP_010061583.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 gb|KCW68568.1| hypothetical protein EUGRSUZ_F02181 [Eucalyptus grandis]
Length=982

 Score =   161 bits (408),  Expect(2) = 6e-59, Method: Composition-based stats.
 Identities = 78/121 (64%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = -3

Query  636  PIKLVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES  457
            P  +  EYGYT ++ EKSDVYSFGVVLMELV+GK+PIE  YGEN DIVSW+S+ LK +ES
Sbjct  851  PGYIAPEYGYTSRISEKSDVYSFGVVLMELVTGKRPIEPGYGENMDIVSWISSNLKCRES  910

Query  456  ILSMVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++ +VDS I Q+  +E AI VLRIA+LCT  LP+ RPTMR VVQMLEDAEPC  V I++ 
Sbjct  911  VMRLVDSRIAQDHTREQAIMVLRIAVLCTERLPSLRPTMRSVVQMLEDAEPCGPVDIVIE  970

Query  279  K  277
            K
Sbjct  971  K  971


 Score = 94.4 bits (233),  Expect(2) = 6e-59, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C+RP+IHRDVKSSNILLDEF KP+IADFGLAKILQ     KD+T VI GT GYIAP
Sbjct  801  CERPMIHRDVKSSNILLDEFMKPQIADFGLAKILQAGRGGKDSTQVIAGTPGYIAP  856



>emb|CAN65551.1| hypothetical protein VITISV_033329 [Vitis vinifera]
Length=1253

 Score =   166 bits (421),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIV WV   +KS+E  + 
Sbjct  848  IAPEYAYTCKVTEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVYWVYNNMKSREDAVG  907

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VDSAI E FKEDA+KVL+I+I CTA +P  RP+MR VVQMLED +PCKL +I+VSK
Sbjct  908  LVDSAISEAFKEDAVKVLQISIHCTAKIPVLRPSMRMVVQMLEDFKPCKLTNIVVSK  964


 Score = 89.0 bits (219),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDR +IHRDVKSSNILLD   KPRIADFGLAK+L + ++  DTTHVI GTHGYIAP
Sbjct  796  CDRTVIHRDVKSSNILLDVDLKPRIADFGLAKML-HGAAGGDTTHVIAGTHGYIAP  850



>ref|XP_009616818.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=986

 Score =   163 bits (412),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESIL  451
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP++AE YGENNDIV WV +K+++K S++
Sbjct  853  IAPEYAYTTKVTEKSDVYSFGVVLMELVTGKKPVDAEEYGENNDIVQWVCSKIRNKTSMI  912

Query  450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
             +VDS+I E FK+DA++VLRIA+ CTA  P  RP+MR VV MLE+AEPCKL S++V+
Sbjct  913  DLVDSSILEGFKKDAVEVLRIAVHCTARTPALRPSMRMVVHMLEEAEPCKLTSVVVN  969


 Score = 92.4 bits (228),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP++HRDVKSSNILLDE  KP+IADFGLAK+LQ N + KD++HV+ GTHGYIAP
Sbjct  802  DRPVMHRDVKSSNILLDEKMKPKIADFGLAKVLQVNGT-KDSSHVVAGTHGYIAP  855



>ref|XP_002271143.2| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
Length=975

 Score =   166 bits (420),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 78/117 (67%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIV WV   +KS+E  + 
Sbjct  848  IAPEYAYTCKVTEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVYWVYNNMKSREDAVG  907

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VDSAI E FKEDA+KVL+I+I CTA +P  RP+MR VVQMLED +PCKL +I+VSK
Sbjct  908  LVDSAISEAFKEDAVKVLQISIHCTAKIPVLRPSMRMVVQMLEDFKPCKLTNIVVSK  964


 Score = 89.0 bits (219),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDR +IHRDVKSSNILLD   KPRIADFGLAK+L + ++  DTTHVI GTHGYIAP
Sbjct  796  CDRTVIHRDVKSSNILLDVDLKPRIADFGLAKML-HGAAGGDTTHVIAGTHGYIAP  850



>ref|XP_010271554.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nelumbo nucifera]
Length=993

 Score =   168 bits (426),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GKKPIEAEYGEN DIV WV +K  S+ES+  
Sbjct  855  IAPEYAYTCKVNEKSDVYSFGVVLMELVTGKKPIEAEYGENKDIVQWVYSKAGSRESMTE  914

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            +VD  I + F+EDA+KVLRIAI CTA LP  RP+MR VVQMLEDAEP +LVSI +++D
Sbjct  915  VVDERIPQGFREDAVKVLRIAIRCTARLPVLRPSMRTVVQMLEDAEPRQLVSIAIAED  972


 Score = 85.5 bits (210),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQ-YNSSCKDTTHVIPGTHGYIAP  729
            +RP+IHRDVKSSNILLDEF KPRIADFGLAKI+        D++ VIPGTHGYIAP
Sbjct  802  ERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVHASGGGGSDSSQVIPGTHGYIAP  857



>ref|XP_003593346.1| Receptor-like protein kinase HAIKU2 [Medicago truncatula]
 gb|AES63597.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=979

 Score =   169 bits (427),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+P+E E+GEN DIVSWV + ++SKES L 
Sbjct  861  MAPEYAYTCKVTEKSDVYSFGVVLMELVTGKRPVEPEFGENKDIVSWVCSNIRSKESALE  920

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VDS I + FKEDAIKVLRIA LCTA  P+SRP+MR +VQMLE+AEPC    +IV+ D 
Sbjct  921  LVDSTIAKHFKEDAIKVLRIATLCTAKAPSSRPSMRTLVQMLEEAEPCAPSKVIVTIDG  979


 Score = 84.3 bits (207),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP++HRDVKSSNILLDE +KPRIADFGLAKI+Q      + THVI GT GY+AP
Sbjct  811  CDRPVMHRDVKSSNILLDEEWKPRIADFGLAKIVQGGG---NWTHVIAGTLGYMAP  863



>ref|XP_007041450.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
 gb|EOX97281.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
Length=984

 Score =   162 bits (410),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 78/126 (62%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+P E EYGEN DIV W+  K KSKE ++ 
Sbjct  851  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPAEPEYGENKDIVYWIQNKEKSKEKLVE  910

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VD  I E  KEDAI VLRIA+LCT   P  RP+MR VV+MLE+AEPCKL  IIV K+  
Sbjct  911  VVDLNISEALKEDAINVLRIAVLCTTKFPALRPSMRAVVKMLEEAEPCKLTDIIVHKNGE  970

Query  267  KLDNPS  250
               N S
Sbjct  971  SSPNGS  976


 Score = 89.7 bits (221),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q N    D THVI GT+GYIAP
Sbjct  800  DRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQ-NGGGGDWTHVIAGTYGYIAP  853



>ref|XP_002313944.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
 gb|EEE87899.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
Length=989

 Score =   159 bits (403),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 76/115 (66%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIV WV +KL+SKES L 
Sbjct  852  IAPEYAYTCKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVYWVCSKLESKESALQ  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV  283
            +VDS I E FKEDAIK+LRIAI CT+ +P  RP+MR VV MLE+ EP +L  ++V
Sbjct  912  VVDSNISEVFKEDAIKMLRIAIHCTSKIPALRPSMRMVVHMLEEVEPLQLTDVVV  966


 Score = 90.1 bits (222),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q      D THVI GTHGYIAP
Sbjct  801  DRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGQ-GDWTHVIAGTHGYIAP  854



>ref|XP_004230660.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=980

 Score =   160 bits (405),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 73/116 (63%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP+EAEYGEN DIV WV +K+++  S++ 
Sbjct  852  IAPEYAYTTKVTEKSDVYSFGVVLMELVTGKKPVEAEYGENIDIVQWVCSKIRNNTSMID  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            +VDS+I E FKEDA++VL+IA+ CT+  P  RP+MR VV MLE+AEPCKL  ++V+
Sbjct  912  LVDSSIFEGFKEDAVEVLKIAVHCTSRTPALRPSMRMVVHMLEEAEPCKLTDVVVN  967


 Score = 87.4 bits (215),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP++HRDVKSSNILLDE  KP+IADFGLAK+L  N + KD++ V+ GTHGYIAP
Sbjct  801  DRPVMHRDVKSSNILLDEQMKPKIADFGLAKVLHVNGT-KDSSQVVAGTHGYIAP  854



>ref|XP_011002775.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=988

 Score =   159 bits (401),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+P E E+GEN DIV WV +KL+SKES L 
Sbjct  852  MAPEYAYTCKVNEKSDVYSFGVVLMELVTGKRPTEPEFGENKDIVYWVCSKLESKESALQ  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VDS I E +KEDAIK+LRIAI CT+ +P  RP+MR VV MLE+ EP +L  ++V K
Sbjct  912  VVDSNISEVYKEDAIKMLRIAIHCTSKIPALRPSMRMVVHMLEEVEPLQLTDVVVDK  968


 Score = 88.6 bits (218),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q      D THVI GTHGY+AP
Sbjct  801  DRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGQ-GDWTHVIAGTHGYMAP  854



>ref|XP_012074538.1| PREDICTED: receptor-like protein kinase HAIKU2 [Jatropha curcas]
 gb|KDP35915.1| hypothetical protein JCGZ_09887 [Jatropha curcas]
Length=1036

 Score =   159 bits (401),  Expect(2) = 8e-56, Method: Composition-based stats.
 Identities = 79/120 (66%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EY YT KV EKSDVYSFGVVLMELV+G++P+E E+GE  DIV WV +K+ SKES L 
Sbjct  899   MAPEYAYTCKVNEKSDVYSFGVVLMELVTGRRPVEPEFGEYKDIVYWVCSKMSSKESALD  958

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             M+DS I E  KEDAIKVLRIAI CTA +P  RP+MR VVQMLE+AEP KL  I V K  A
Sbjct  959   MIDSNISENLKEDAIKVLRIAIHCTAKIPALRPSMRMVVQMLEEAEPHKLTDITVIKKEA  1018


 Score = 86.7 bits (213),  Expect(2) = 8e-56, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q      D +H+I GTHGY+AP
Sbjct  848  DRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGG-GDWSHIIAGTHGYMAP  901



>gb|KCW63493.1| hypothetical protein EUGRSUZ_G01123 [Eucalyptus grandis]
Length=1003

 Score =   162 bits (411),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 79/129 (61%), Positives = 98/129 (76%), Gaps = 4/129 (3%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+G++PIE+E+GEN DIV WV   + SK S+L 
Sbjct  868  IAPEYAYTMKVNEKSDVYSFGVVLMELVTGRRPIESEFGENKDIVYWVRENMSSKNSLLD  927

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS I +  KEDA++VLRIAILCTA +P  RP+MR VVQMLE+AEPC L +I+V     
Sbjct  928  LVDSNISDTLKEDAVEVLRIAILCTANIPTVRPSMRMVVQMLEEAEPCSLNNILVD----  983

Query  267  KLDNPSDNT  241
            K+D  S+ T
Sbjct  984  KVDENSEKT  992


 Score = 82.0 bits (201),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C RPIIHRDVKSSNILLD+ +KPRIADFGLAKI+Q  S   + TH I GT GYIAP
Sbjct  816  CARPIIHRDVKSSNILLDKEWKPRIADFGLAKIVQ-ASPGGNWTHAIAGTLGYIAP  870



>ref|XP_008236214.1| PREDICTED: receptor-like protein kinase HAIKU2, partial [Prunus 
mume]
Length=950

 Score =   161 bits (408),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+PIE E+G+N DIVSWV +K++ KES+L 
Sbjct  832  IAPEYAYTCKVNEKSDVYSFGVVLMELVTGKRPIEPEFGDNKDIVSWVCSKMQYKESVLE  891

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VDS+I +  KEDAIKVL IAI CTA +P  RP+MR VVQMLE+AEP KL SI ++K+ 
Sbjct  892  LVDSSISDDLKEDAIKVLSIAIHCTARVPVLRPSMRMVVQMLEEAEPRKLTSINITKEG  950


 Score = 83.2 bits (204),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 3/54 (6%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            RP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q  + C   THVI GT GYIAP
Sbjct  784  RPVIHRDVKSSNILLDGDWKPRIADFGLAKIMQVGADC---THVIAGTVGYIAP  834



>ref|XP_010065822.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
Length=995

 Score =   162 bits (411),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 76/117 (65%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+G++PIE+E+GEN DIV WV   + SK S+L 
Sbjct  860  IAPEYAYTMKVNEKSDVYSFGVVLMELVTGRRPIESEFGENKDIVYWVRENMSSKNSLLD  919

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VDS I +  KEDA++VLRIAILCTA +P  RP+MR VVQMLE+AEPC L +I+V K
Sbjct  920  LVDSNISDTLKEDAVEVLRIAILCTANIPTVRPSMRMVVQMLEEAEPCSLNNILVDK  976


 Score = 82.0 bits (201),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C RPIIHRDVKSSNILLD+ +KPRIADFGLAKI+Q  S   + TH I GT GYIAP
Sbjct  808  CARPIIHRDVKSSNILLDKEWKPRIADFGLAKIVQ-ASPGGNWTHAIAGTLGYIAP  862



>ref|XP_006367082.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=1008

 Score =   159 bits (403),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 71/116 (61%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP++AE+GEN+DIV WV +K+++  S++ 
Sbjct  880  IAPEYAYTTKVTEKSDVYSFGVVLMELVTGKKPVDAEFGENSDIVQWVCSKIRNNTSMID  939

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            +VDS+I E FKEDA++VL+IA+ CT+  P  RP+MR VV MLE+AEPCKL +++V+
Sbjct  940  LVDSSIFEGFKEDAVEVLKIAVHCTSRTPALRPSMRMVVHMLEEAEPCKLTNVVVN  995


 Score = 84.7 bits (208),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            D P++HRDVKSSNILLDE  KP+IADFGLAK+L  N + KD++ V+ GTHGYIAP
Sbjct  829  DSPVMHRDVKSSNILLDEQMKPKIADFGLAKVLHVNGT-KDSSQVVAGTHGYIAP  882



>gb|EPS73238.1| hypothetical protein M569_01518, partial [Genlisea aurea]
Length=947

 Score =   154 bits (388),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSD+YSFGVVLMELV+G KPI A+ GEN+D+V WV  +LK    ++ 
Sbjct  831  IAPEYGYTSKVNEKSDIYSFGVVLMELVTGLKPIVADSGENSDLVDWVCRRLKMNGDVMG  890

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VDS I + F+E AI+V+++A+LCTA +P+SRP+MR VVQML+ A+PC+L+S+ V K
Sbjct  891  LVDSRIADVFRESAIRVMKVAMLCTARIPSSRPSMRTVVQMLKAAQPCELLSVFVGK  947


 Score = 90.1 bits (222),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            C+RP+IHRDVKSSNILLD+  +PRIADFGLAKIL+   S  D TT +IPGTHGYIAP
Sbjct  777  CERPVIHRDVKSSNILLDDRMQPRIADFGLAKILRPEYSHGDSTTRIIPGTHGYIAP  833



>emb|CDO97335.1| unnamed protein product [Coffea canephora]
Length=1050

 Score =   155 bits (392),  Expect(2) = 7e-55, Method: Composition-based stats.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -3

Query  636   PIKLVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES  457
             P  +  EY Y   V EKSDVYSFGVVLMELV+GKKP+E E+G+N DIVSW+ +KL+S+  
Sbjct  906   PGYIAPEYAYACSVNEKSDVYSFGVVLMELVTGKKPVEPEFGDNKDIVSWIYSKLRSEHR  965

Query  456   ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
              + +VD +I E  +EDA+KVL+IAI CT+  P  RP+M+ VVQMLE+AEPCKL SI+V+
Sbjct  966   TIELVDKSISEALREDAVKVLKIAIHCTSRTPVLRPSMKMVVQMLENAEPCKLSSIVVN  1024


 Score = 87.4 bits (215),  Expect(2) = 7e-55, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNS-SCKDTTHVIPGTHGYIAP  729
            CDRPIIHRDVKSSNILLD   KP+IADFGLAKIL  N  + +++THVI GT GYIAP
Sbjct  855  CDRPIIHRDVKSSNILLDADLKPKIADFGLAKILLANEPNARESTHVIAGTPGYIAP  911



>ref|XP_004485648.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cicer arietinum]
Length=969

 Score =   164 bits (416),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+P+E E+GEN DIV WV + ++SKES   
Sbjct  851  MAPEYAYTCKVTEKSDVYSFGVVLMELVTGKRPVEPEFGENKDIVGWVCSNIRSKESAFE  910

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VDS I + FKEDAIKVLRIA+LCT   P+SRP+MR +VQMLE+AEPC    + V+ D 
Sbjct  911  LVDSTISKKFKEDAIKVLRIAVLCTTKTPSSRPSMRMLVQMLEEAEPCAPTKVTVTIDG  969


 Score = 77.0 bits (188),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDR ++HRDVKSSNILLDE +KPRIADFGLAKI+Q      + +H I GT GY+AP
Sbjct  800  CDRAVMHRDVKSSNILLDEEWKPRIADFGLAKIVQGGGG--NWSHGIAGTLGYMAP  853



>ref|XP_007148314.1| hypothetical protein PHAVU_006G198200g [Phaseolus vulgaris]
 gb|ESW20308.1| hypothetical protein PHAVU_006G198200g [Phaseolus vulgaris]
Length=968

 Score =   157 bits (397),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 74/116 (64%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD  439
            EY YT KV EKSDVYSFGVVLMELV+GK+P+EAE+GEN+DIV WV +  +SKE  L +VD
Sbjct  853  EYAYTCKVTEKSDVYSFGVVLMELVTGKRPMEAEFGENHDIVHWVCSTNRSKEEALELVD  912

Query  438  SAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
              I + FKEDA+KVLRIA+LCT+ +P SRP+MR +VQMLE+A+PC    + V+ DA
Sbjct  913  PTIAKHFKEDAMKVLRIALLCTSKIPASRPSMRMLVQMLEEADPCTPNQMTVTIDA  968


 Score = 84.3 bits (207),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLDE +KPRIADFGLAKIL  N    + T+VI GT GYI P
Sbjct  799  CDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIL--NGGAGNWTNVIAGTLGYIPP  852



>gb|KDO67927.1| hypothetical protein CISIN_1g002250mg [Citrus sinensis]
Length=947

 Score =   153 bits (387),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 72/117 (62%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+PI  E+G++ DIV+WV +K+ S++S+L+
Sbjct  816  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPIVPEFGDSKDIVNWVYSKMDSRDSMLT  875

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VD  I E  KEDA+KVLRIAI CT  LP  RP+MR VVQMLE+AEPC + +I+V K
Sbjct  876  VVDPNISEILKEDALKVLRIAIHCTNKLPAFRPSMRVVVQMLEEAEPCSVTNIVVKK  932


 Score = 87.8 bits (216),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q      D THVI GTHGYIAP
Sbjct  765  DRPVIHRDVKSSNILLDLEWKPRIADFGLAKIVQ-TGEAGDLTHVIAGTHGYIAP  818



>ref|XP_006486805.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=991

 Score =   153 bits (386),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 72/117 (62%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+PI  E+G++ DIV+WV +K+ S++S+L+
Sbjct  860  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPIVPEFGDSKDIVNWVYSKMDSRDSMLT  919

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VD  I E  KEDA+KVLRIAI CT  LP  RP+MR VVQMLE+AEPC + +I+V K
Sbjct  920  VVDPNISEILKEDALKVLRIAIHCTNKLPAFRPSMRVVVQMLEEAEPCSVTNIVVKK  976


 Score = 87.8 bits (216),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q      D THVI GTHGYIAP
Sbjct  809  DRPVIHRDVKSSNILLDLEWKPRIADFGLAKIVQ-TGEAGDLTHVIAGTHGYIAP  862



>ref|XP_006422685.1| hypothetical protein CICLE_v10027748mg [Citrus clementina]
 gb|ESR35925.1| hypothetical protein CICLE_v10027748mg [Citrus clementina]
Length=991

 Score =   153 bits (386),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 72/117 (62%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+PI  E+G++ DIV+WV +K+ S++S+L+
Sbjct  860  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPIVPEFGDSKDIVNWVYSKMDSRDSMLT  919

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VD  I E  KEDA+KVLRIAI CT  LP  RP+MR VVQMLE+AEPC + +I+V K
Sbjct  920  VVDPNISEILKEDALKVLRIAIHCTNKLPAFRPSMRVVVQMLEEAEPCSVTNIVVKK  976


 Score = 88.2 bits (217),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q   +  D THVI GTHGYIAP
Sbjct  809  DRPVIHRDVKSSNILLDLEWKPRIADFGLAKIVQAGEA-GDQTHVIAGTHGYIAP  862



>ref|XP_007199705.1| hypothetical protein PRUPE_ppa000895mg [Prunus persica]
 gb|EMJ00904.1| hypothetical protein PRUPE_ppa000895mg [Prunus persica]
Length=968

 Score =   156 bits (394),  Expect(2) = 6e-54, Method: Composition-based stats.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+P E E+G+N DIVSWV +K++ KES+L 
Sbjct  850  IAPEYAYTCKVNEKSDVYSFGVVLMELVTGKRPTEPEFGDNMDIVSWVCSKMQYKESVLE  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VDS+  +  KEDAIKVL IAI CTA +P  RP+MR VVQMLE+AEP KL SI ++K+ 
Sbjct  910  LVDSSTSDYLKEDAIKVLSIAIHCTARVPVLRPSMRMVVQMLEEAEPRKLTSINITKEG  968


 Score = 83.2 bits (204),  Expect(2) = 6e-54, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 3/54 (6%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            RP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q  + C   THVI GT GYIAP
Sbjct  802  RPVIHRDVKSSNILLDGDWKPRIADFGLAKIMQVGADC---THVIAGTVGYIAP  852



>ref|XP_009420699.1| PREDICTED: receptor-like protein kinase HAIKU2 [Musa acuminata 
subsp. malaccensis]
Length=995

 Score =   154 bits (388),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+G++PIEAEYGEN DIV W S ++ ++ES+++
Sbjct  865  IAPEYAYTWKVNEKSDVYSFGVVLMELVTGRQPIEAEYGENKDIVHWASRRMGNRESVMA  924

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            MVD  I E  +E+A+KVLRIA+LCTA LP +RP+MR VVQMLE+A  C+  S
Sbjct  925  MVDLRIPEWAREEAVKVLRIAVLCTARLPATRPSMRAVVQMLEEAGRCRAFS  976


 Score = 85.1 bits (209),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 6/61 (10%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCK------DTTHVIPGTHGYIA  732
            DRPI+HRDVKSSNILLD+ FKPRIADFGLAK+LQ  +S         + HVI GT+GYIA
Sbjct  807  DRPILHRDVKSSNILLDQCFKPRIADFGLAKVLQSAASGAGGGKEGSSAHVIAGTYGYIA  866

Query  731  P  729
            P
Sbjct  867  P  867



>ref|XP_008787835.1| PREDICTED: uncharacterized protein LOC103705762 [Phoenix dactylifera]
Length=2109

 Score =   151 bits (381),  Expect(2) = 9e-54, Method: Composition-based stats.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 3/122 (2%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EY YT KV EKSDVYSFGVVLMELV+G++PIE E+GEN DIV WVS ++ S ES + 
Sbjct  1753  IAPEYAYTWKVNEKSDVYSFGVVLMELVTGRRPIEPEFGENKDIVCWVSRRMNSGESAVE  1812

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             +VD  I +  +EDA+KVLR+A+LCTA LP  RP+MR VVQMLE+AE   L   I S+DA+
Sbjct  1813  LVDRTIPDWGREDAVKVLRVAVLCTARLPAMRPSMRTVVQMLEEAE---LYCSITSEDAS  1869

Query  267   KL  262
              L
Sbjct  1870  LL  1871


 Score = 87.8 bits (216),  Expect(2) = 9e-54, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  890   RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
             RPI+HRDVKSSNILLDE FKPRIADFGLAK+L        + HVI GTHGYIAP
Sbjct  1702  RPILHRDVKSSNILLDECFKPRIADFGLAKVLYAAGGGDSSAHVIAGTHGYIAP  1755


 Score =   147 bits (372),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EY YT KV EKSDVYSFGVVLMELV+G++PIE E+GEN DIV WVS ++ S ES + 
Sbjct  1972  IAPEYAYTWKVNEKSDVYSFGVVLMELVTGRRPIEPEFGENKDIVCWVSRRMNSGESAVE  2031

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE  310
             +VD  I +  +EDA+KVLR+A+LCTA LP  RP+MR VVQMLE+AE
Sbjct  2032  LVDRTIPDWEREDAVKVLRVAVLCTARLPAMRPSMRTVVQMLEEAE  2077


 Score = 90.5 bits (223),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  893   DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
             DRPI+HRDVKSSNILLDE FKPRIADFGLAK+L        + HVI GTHGYIAP
Sbjct  1920  DRPILHRDVKSSNILLDECFKPRIADFGLAKVLYAAGGGDSSAHVIAGTHGYIAP  1974


 Score =   148 bits (373),  Expect(2) = 7e-53, Method: Composition-based stats.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+G++PIE E+GEN DIV WVS ++ S ES + 
Sbjct  727  IAPEYAYTWKVNEKSDVYSFGVVLMELVTGRRPIEPEFGENKDIVCWVSRRMNSGESAVE  786

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VD  I +  +EDA+KVLR+A+LCTA LP  RP+MR VVQMLE+AE   L   +   +  
Sbjct  787  LVDRTIPDWGREDAVKVLRVAVLCTARLPAMRPSMRTVVQMLEEAEARSLRLKVDKVEGG  846

Query  267  KLDNPSDNTSK  235
            +   P+   S+
Sbjct  847  ERSRPTSPISR  857


 Score = 87.8 bits (216),  Expect(2) = 7e-53, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            RPI+HRDVKSSNILLDE FKPRIADFGLAK+L        + HVI GTHGYIAP
Sbjct  676  RPILHRDVKSSNILLDECFKPRIADFGLAKVLYAAGGGDSSAHVIAGTHGYIAP  729



>gb|KJB77870.1| hypothetical protein B456_012G162000 [Gossypium raimondii]
Length=963

 Score =   146 bits (369),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT  + EK DVYSFGVVLMELV+GK+P+E E+GEN DIV W+ TKL++ E +  
Sbjct  848  IAPEYAYTCNINEKCDVYSFGVVLMELVTGKRPLEPEFGENKDIVHWIYTKLENNEILDE  907

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV  283
            +VD  I    KED IKVLRIA+ CTA +P  RP+MR VVQMLE+A+P KL  IIV
Sbjct  908  VVDMNIANALKEDVIKVLRIAVHCTAKIPVLRPSMRMVVQMLEEADPSKLTDIIV  962


 Score = 92.0 bits (227),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 1/55 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q N S  D TH I GTHGYIAP
Sbjct  797  DRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQ-NGSGGDWTHFIAGTHGYIAP  850



>ref|XP_009407104.1| PREDICTED: uncharacterized protein LOC103989885 [Musa acuminata 
subsp. malaccensis]
Length=1974

 Score =   156 bits (394),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+G++PIEAEYGE+ DIV W + ++ S+ES+ +
Sbjct  872  IAPEYAYTWKVNEKSDVYSFGVVLMELVTGRQPIEAEYGEDKDIVYWATRRMSSRESVAA  931

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VD  IQEP +E+A+KVLR+A LCTA LP  RP+MR VVQMLE+A   + ++ I+SK
Sbjct  932  VVDGRIQEPAREEAVKVLRVAALCTARLPAMRPSMRTVVQMLEEATSGRALAAIISK  988


 Score = 80.9 bits (198),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 39/59 (66%), Positives = 44/59 (75%), Gaps = 4/59 (7%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQ----YNSSCKDTTHVIPGTHGYIAP  729
            DRPI+HRDVKSSNILLD+  KPRIADFGLAK+L       +    + HVI GTHGYIAP
Sbjct  816  DRPILHRDVKSSNILLDDCLKPRIADFGLAKVLHSAAAGGAEEASSAHVIAGTHGYIAP  874


 Score =   134 bits (336),  Expect(2) = 2e-44, Method: Composition-based stats.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 1/110 (1%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             L  EY Y+ K   K DVYSFGVVLMELV+GKKPIE E+GE+ DI+ WVS+K+ +KE  + 
Sbjct  1853  LAPEYAYSSKATTKCDVYSFGVVLMELVTGKKPIEPEFGESRDIIHWVSSKMCTKEGAME  1912

Query  447   MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCK  301
             ++D  I   P KE+ ++VLRIAI CT + P  RPTM  VVQ+L +A+PCK
Sbjct  1913  VLDKQISWNPMKEEMVQVLRIAIRCTCSNPTLRPTMNEVVQLLIEAQPCK  1962


 Score = 74.3 bits (181),  Expect(2) = 2e-44, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887   PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
             PI+HRD+K+SNILLD  F+P++ADFG+AK+LQ       +T VI GT+GY+AP
Sbjct  1803  PIVHRDIKTSNILLDADFEPKVADFGIAKVLQARGDRDTSTTVIAGTYGYLAP  1855



>ref|XP_009346454.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=973

 Score =   156 bits (394),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 74/121 (61%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GKKP+EA +GENNDIVSWV +K++  +S+L 
Sbjct  853  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKKPVEAVFGENNDIVSWVYSKMQCDDSVLE  912

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VD++I +  KEDAI VL IA+ CTA +P  RP+MR VVQMLE+AEP KL  I  +K+  
Sbjct  913  LVDTSISDDLKEDAINVLSIAVRCTAKVPVLRPSMRMVVQMLEEAEPYKLTCISTAKEVE  972

Query  267  K  265
            K
Sbjct  973  K  973


 Score = 79.0 bits (193),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            RP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q    C   T VI GT GYIAP
Sbjct  805  RPVIHRDVKSSNILLDGDWKPRIADFGLAKIMQAGVDC---TQVIAGTLGYIAP  855



>ref|XP_010943231.1| PREDICTED: receptor-like protein kinase HAIKU2 [Elaeis guineensis]
Length=1002

 Score =   141 bits (355),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 64/105 (61%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+PIE E+G+N DIV WVS ++ S ES++ 
Sbjct  866  IAPEYAYTWKVNEKSDVYSFGVVLMELVTGKRPIEPEFGDNKDIVYWVSQRMNSGESVVE  925

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA  313
            ++D  I +  +E+A+KVL++A+LCTA LP  RP+MR VVQMLE+A
Sbjct  926  LLDKRIPDWAREEALKVLKVAVLCTARLPAMRPSMRTVVQMLEEA  970


 Score = 93.2 bits (230),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            DRPI+HRDVKSSNILLDE FKPRIADFGLAK+L        + HVIPGTHGYIAP
Sbjct  814  DRPILHRDVKSSNILLDECFKPRIADFGLAKVLYPAGGGDSSAHVIPGTHGYIAP  868



>ref|XP_008382378.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score =   154 bits (390),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+P+EA +GENNDIVSWV +K++  +S+L 
Sbjct  853  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKEPVEAAFGENNDIVSWVYSKMQCDDSVLE  912

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VD++I +  KEDAI VL IA+ CTA +P  RP+MR VVQMLE+AEP KL  I  +K+  
Sbjct  913  LVDTSISDDLKEDAINVLSIAVRCTAKVPVLRPSMRMVVQMLEEAEPYKLTCISTAKEVE  972

Query  267  K  265
            K
Sbjct  973  K  973


 Score = 79.0 bits (193),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            RP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q    C   T VI GT GYIAP
Sbjct  805  RPVIHRDVKSSNILLDGDWKPRIADFGLAKIMQAGVDC---TQVIAGTLGYIAP  855



>ref|XP_009378558.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
 ref|XP_009378566.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=973

 Score =   152 bits (383),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 72/121 (60%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+P+EAE+GEN DIVSWV +K++  +S L 
Sbjct  853  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPVEAEFGENTDIVSWVCSKMRCVDSELE  912

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VD +I +  K+DAI VL IA+ CTA +P  RP+MR VVQMLE+AEP KL  I ++K+A 
Sbjct  913  LVDRSISDDLKQDAINVLSIAVRCTAKVPVLRPSMRMVVQMLEEAEPYKLNCISIAKEAD  972

Query  267  K  265
            +
Sbjct  973  R  973


 Score = 82.0 bits (201),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            RP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q    C   THVI GT GYIAP
Sbjct  805  RPVIHRDVKSSNILLDGDWKPRIADFGLAKIMQAGVDC---THVIAGTLGYIAP  855



>ref|XP_008372891.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score =   151 bits (381),  Expect(2) = 4e-52, Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT K+ EKSDVYSFGVVLMELV+GK+P+EAE+GEN DIVSWV +K++  +S L 
Sbjct  853  IAPEYAYTCKINEKSDVYSFGVVLMELVTGKRPVEAEFGENTDIVSWVCSKMRCVDSELE  912

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VD +I +  K+DAI VL IA+ CTA +P  RP+MR VVQMLE+AEP KL  I  +K+A 
Sbjct  913  LVDRSISDDLKQDAINVLXIAVRCTAKVPVIRPSMRMVVQMLEEAEPYKLNCISXAKEAD  972

Query  267  K  265
            K
Sbjct  973  K  973


 Score = 82.0 bits (201),  Expect(2) = 4e-52, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 3/54 (6%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            RP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q    C   THVI GT GYIAP
Sbjct  805  RPVIHRDVKSSNILLDGDWKPRIADFGLAKIMQAGVDC---THVIAGTLGYIAP  855



>ref|XP_011658857.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis sativus]
 gb|KGN43819.1| hypothetical protein Csa_7G069690 [Cucumis sativus]
Length=985

 Score =   145 bits (366),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL  451
            +  EY YT K+ EKSDVYSFGVVLMEL +GK+P EAE+GEN DIV W  ++++  K ++ 
Sbjct  864  IAPEYAYTCKINEKSDVYSFGVVLMELATGKQPNEAEFGENKDIVQWAHSRMRELKGNLK  923

Query  450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
             MVD +I E   E+A+KVLRIA+ CTA +P++RP+M+ VV MLE+AEPC  + I+V K+
Sbjct  924  EMVDPSISEAQVENAVKVLRIALRCTAKIPSTRPSMKMVVHMLEEAEPCNFIDIVVKKE  982


 Score = 87.4 bits (215),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNS--SCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLD  +KPRIADFGLAKILQ  +     D++HVI GT GYIAP
Sbjct  809  CDRPVIHRDVKSSNILLDSDWKPRIADFGLAKILQDGNGHGVGDSSHVIAGTLGYIAP  866



>ref|XP_008455077.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=983

 Score =   144 bits (362),  Expect(2) = 7e-52, Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL  451
            +  EY YT K+ EKSDVYSFGVVLMEL +GK+P EAE+GEN DIV W  ++++  K ++ 
Sbjct  862  IAPEYAYTCKINEKSDVYSFGVVLMELATGKQPNEAEFGENKDIVQWAHSRMRELKGNLK  921

Query  450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
             MVD +I E   EDA+KVLRIA+ CTA +P++RP+MR VV MLE+AEP   + I+V K+
Sbjct  922  DMVDPSISEAQVEDAVKVLRIALRCTAKIPSTRPSMRMVVHMLEEAEPYNFIDIVVKKE  980


 Score = 88.6 bits (218),  Expect(2) = 7e-52, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQ--YNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLD  +KPRIADFGLAKILQ  +     D++HVI GT GYIAP
Sbjct  807  CDRPVIHRDVKSSNILLDSDWKPRIADFGLAKILQDGHGHGVGDSSHVIAGTLGYIAP  864



>ref|XP_003541774.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
 gb|KHN19047.1| Receptor-like protein kinase HAIKU2 [Glycine soja]
Length=964

 Score =   149 bits (376),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 69/116 (59%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD  439
            EY YT +V EKSDVYSFGVVLMELV+GK+P+E E+GEN+DIV WV   ++S+E  L +VD
Sbjct  849  EYAYTCRVTEKSDVYSFGVVLMELVTGKRPMEPEFGENHDIVYWVCNNIRSREDALELVD  908

Query  438  SAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
              I +  KEDA+KVL+IA LCT  +P SRP+MR +VQMLE+A+P     +IV+ DA
Sbjct  909  PTIAKHVKEDAMKVLKIATLCTGKIPASRPSMRMLVQMLEEADPFTTTKMIVTIDA  964


 Score = 82.8 bits (203),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRP+IHRDVKSSNILLDE +KPRIADFGLAKILQ      + T+VI GT GY+ P
Sbjct  795  CDRPVIHRDVKSSNILLDEEWKPRIADFGLAKILQ--GGAGNWTNVIAGTVGYMPP  848



>ref|XP_012068112.1| PREDICTED: receptor-like protein kinase HAIKU2 [Jatropha curcas]
 gb|KDP41542.1| hypothetical protein JCGZ_15949 [Jatropha curcas]
Length=974

 Score =   191 bits (486),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGKKPIEAEYGEN DIV WVS+ LKS+ES+ S
Sbjct  844  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKKPIEAEYGENKDIVDWVSSNLKSRESVFS  903

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS I + FKEDA+KVLRIAILCT+ +P+ RPTMR VVQMLE AEPCKLV I++SKD A
Sbjct  904  IVDSRIPQVFKEDAVKVLRIAILCTSRVPSLRPTMRSVVQMLEQAEPCKLVGIVISKDGA  963


 Score =   107 bits (267),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            CDRPIIHRDVKSSNILLDEF KPRIADFGLAKI+Q NS+ KD+THVI GTHGYIAP    
Sbjct  792  CDRPIIHRDVKSSNILLDEFLKPRIADFGLAKIVQANSA-KDSTHVIAGTHGYIAP---E  847

Query  716  FKFYYKL  696
            + + YK+
Sbjct  848  YGYTYKV  854



>ref|XP_002522038.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF40238.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score =   152 bits (384),  Expect(2) = 4e-51, Method: Composition-based stats.
 Identities = 76/117 (65%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+P E E+GEN DIV WV +K+  KE+ L 
Sbjct  859  MAPEYAYTCKVNEKSDVYSFGVVLMELVTGKRPTEPEFGENKDIVYWVHSKISRKENSLD  918

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +VDS I E  KEDAIKVL+IA+ CTA +P  RPTMR VVQMLE+AE  +L  IIV K
Sbjct  919  IVDSNISERLKEDAIKVLQIAVHCTAKIPALRPTMRLVVQMLEEAESHQLSDIIVVK  975


 Score = 77.4 bits (189),  Expect(2) = 4e-51, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 3/58 (5%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQ---YNSSCKDTTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE +KPRIADFGLAKI+Q         + +++I GT+GY+AP
Sbjct  804  DRPVIHRDVKSSNILLDEDWKPRIADFGLAKIVQGGGGGGGGGEWSNMIAGTYGYMAP  861



>ref|XP_009416779.1| PREDICTED: receptor-like protein kinase HAIKU2 [Musa acuminata 
subsp. malaccensis]
Length=1026

 Score =   147 bits (371),  Expect(2) = 5e-51, Method: Composition-based stats.
 Identities = 70/124 (56%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EY YT KV EKSDVYSFGVVLMELV+G++PIEAEYGEN DIV WV+ ++ S+ES+++
Sbjct  884   IAPEYAYTWKVNEKSDVYSFGVVLMELVTGRQPIEAEYGENKDIVCWVAGRMISRESVMA  943

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             +VD    E  +E+A+KVLR+A+LCTA LP  RP+MR VVQML++A   +    I S    
Sbjct  944   LVDGRTPEWRREEAVKVLRVAVLCTARLPTMRPSMRTVVQMLQEAGSGREFVAIGSGKNE  1003

Query  267   KLDN  256
             K++N
Sbjct  1004  KVEN  1007


 Score = 82.4 bits (202),  Expect(2) = 5e-51, Method: Composition-based stats.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 5/60 (8%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCK-----DTTHVIPGTHGYIAP  729
            DRPI+HRDVKSSNILLD+  KPRIADFGLAKIL    + +        HVI GTHGYIAP
Sbjct  827  DRPILHRDVKSSNILLDDCLKPRIADFGLAKILHSVPAGRGAGEASAAHVIAGTHGYIAP  886



>ref|XP_002510007.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF52194.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=973

 Score =   191 bits (484),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+PIE EYG+N DIV W+S+ LKSKE +LS
Sbjct  844  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRPIEPEYGDNKDIVDWISSNLKSKERVLS  903

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS I E F+EDA+KVLRIAILCTA LP  RPTMR VVQMLEDAEPCKLV I++SKD A
Sbjct  904  IVDSRIPEVFREDAVKVLRIAILCTARLPTLRPTMRSVVQMLEDAEPCKLVGIVISKDGA  963


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/67 (69%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            CDRPIIHRDVKSSNILLDE  KPRIADFGLAKI       KD+T VI GTHGYIAP    
Sbjct  793  CDRPIIHRDVKSSNILLDELLKPRIADFGLAKIKA--DGGKDSTQVIAGTHGYIAP---E  847

Query  716  FKFYYKL  696
            + + YK+
Sbjct  848  YGYTYKV  854



>ref|XP_006852741.1| PREDICTED: receptor-like protein kinase HAIKU2 [Amborella trichopoda]
 gb|ERN14208.1| hypothetical protein AMTR_s00033p00104210 [Amborella trichopoda]
Length=967

 Score =   148 bits (373),  Expect(2) = 8e-50, Method: Composition-based stats.
 Identities = 68/107 (64%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY Y+  V EK+DVYSFGVVLMELV+GK+PI+ E+G + DIV WVS+K+ S+ES+L 
Sbjct  844  MAPEYAYSSNVSEKTDVYSFGVVLMELVTGKRPIQPEFGVHGDIVMWVSSKMTSRESVLG  903

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            +VDS IQE  +E+A+KVLRIA+LCT+ LP  RPTMR VVQML DA+P
Sbjct  904  VVDSRIQESMREEAVKVLRIAVLCTSRLPALRPTMRGVVQMLLDADP  950


 Score = 77.8 bits (190),  Expect(2) = 8e-50, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C RP++HRDVKSSNIL+DEFF+ RIADFGLAK++Q   S ++ +  + GT GY+AP
Sbjct  792  CRRPVVHRDVKSSNILIDEFFEARIADFGLAKVVQRVGS-REVSRSVAGTLGYMAP  846



>gb|KHG18049.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=164

 Score =   137 bits (344),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = -3

Query  618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD  439
            EY YT KV EKSDVYSFGVVLMELV GK+P E E+G++ DIV+WV +K K K S+LS++D
Sbjct  52   EYCYTYKVNEKSDVYSFGVVLMELVIGKRPTEPEFGDDEDIVTWVLSKTKDKASVLSIID  111

Query  438  SAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
              I +  KE A KVL++AI CT  L   RPTMR VVQMLE AEP +LV++ + 
Sbjct  112  PRIADASKEYATKVLKMAIFCTNTLAALRPTMRTVVQMLEAAEPRQLVTVAIG  164


 Score = 86.7 bits (213),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 1/52 (2%)
 Frame = -1

Query  884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            +IHRD+KSSNILLDEF KPRIADFGLAK++Q N   +D+THVI GTHGYIAP
Sbjct  1    MIHRDIKSSNILLDEFLKPRIADFGLAKMVQANGG-QDSTHVILGTHGYIAP  51



>ref|XP_006386429.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP64226.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=986

 Score =   186 bits (471),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+ IE EYG+NNDIV WVS+KLK+K+++LS
Sbjct  850  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRAIEPEYGDNNDIVDWVSSKLKTKQNVLS  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS I E FKEDA+ VLRIAILCTA LP  RP MR VVQMLE AEPCKLVSI +SKD A
Sbjct  910  IVDSRIPEAFKEDAVNVLRIAILCTARLPAMRPAMRSVVQMLEAAEPCKLVSIAISKDGA  969


 Score =   101 bits (251),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            CDRPIIHRDVKSSNILLDE FKPRIADFGLAK++Q N   KD+T VI GTHGYIAP    
Sbjct  798  CDRPIIHRDVKSSNILLDELFKPRIADFGLAKMIQANGG-KDSTQVIAGTHGYIAP---E  853

Query  716  FKFYYKL  696
            + + YK+
Sbjct  854  YGYTYKV  860



>ref|XP_011016947.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=987

 Score =   184 bits (467),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 90/120 (75%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+ IE EYG+N DIV WVS+KLK+K+S+LS
Sbjct  850  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRAIEPEYGDNTDIVDWVSSKLKTKQSVLS  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +VDS I E FKEDA+KVLRIAILCTA LP  RP MR VVQMLE  EPCKLVSI +SKD A
Sbjct  910  IVDSRIPEAFKEDAVKVLRIAILCTARLPAMRPAMRSVVQMLEAVEPCKLVSIAISKDGA  969


 Score = 99.8 bits (247),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            CDRPIIHRDVKSSNILLDE FKPRIADFGLAK++Q  S  KD+T VI GTHGYIAP    
Sbjct  798  CDRPIIHRDVKSSNILLDELFKPRIADFGLAKMIQ-ASGGKDSTQVIAGTHGYIAP---E  853

Query  716  FKFYYKL  696
            + + YK+
Sbjct  854  YGYTYKV  860



>gb|KHG17335.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=983

 Score =   183 bits (465),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+PIE E+G+N DIVSWVS+KLK+KES+LS
Sbjct  849  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRPIEPEFGDNKDIVSWVSSKLKNKESVLS  908

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I   FKEDA+KVL+IAILCT  LP  RPTMR VVQMLE+AEPCKLVSI+++KD 
Sbjct  909  IVDPRIPVAFKEDAVKVLKIAILCTTQLPALRPTMRSVVQMLEEAEPCKLVSIVINKDG  967


 Score =   102 bits (255),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI+Q N   KD+THVI GTHGYIAP    
Sbjct  797  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVQANGG-KDSTHVIAGTHGYIAP---E  852

Query  716  FKFYYKL  696
            + + YK+
Sbjct  853  YGYTYKV  859



>ref|XP_010668040.1| PREDICTED: receptor-like protein kinase HAIKU2 [Beta vulgaris 
subsp. vulgaris]
Length=973

 Score =   125 bits (315),  Expect(2) = 3e-48, Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EK DVYSFGVVL+ELV+GK+PI       NDIV WVS KL++   I S
Sbjct  852  IAPEYGYTSKVNEKCDVYSFGVVLLELVTGKRPINEPEFRENDIVDWVSIKLRNSNVISS  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            ++DS+I E   E+ IKVL+IAI CT  LP  RPTM+ VVQMLE+A P KLV  +++K
Sbjct  912  IIDSSIMESENEEVIKVLKIAIFCTRKLPELRPTMKSVVQMLEEAAPSKLVPSLMAK  968


 Score = 94.4 bits (233),  Expect(2) = 3e-48, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++P+IHRDVKSSNILLDEF KPRIADFGLAKI++ N  C ++THV+ GT+GYIAP
Sbjct  800  EKPVIHRDVKSSNILLDEFLKPRIADFGLAKIVKENVVCPNSTHVVAGTYGYIAP  854



>ref|XP_010667749.1| PREDICTED: receptor-like protein kinase HAIKU2 [Beta vulgaris 
subsp. vulgaris]
Length=979

 Score =   182 bits (463),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 83/121 (69%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVL+ELV+GK+PIE E+GE+ DI++WVS+KLK++ES+  
Sbjct  850  IAPEYGYTYKVNEKSDVYSFGVVLIELVTGKRPIEPEFGESKDIINWVSSKLKNRESVFD  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++DS I  P KE+AIK+L+IAILCTA LP  RPTMR VVQMLE+AEPC+LVSI+V KD A
Sbjct  910  IIDSTIASPLKEEAIKILKIAILCTARLPELRPTMRSVVQMLEEAEPCQLVSIVVGKDGA  969

Query  267  K  265
            K
Sbjct  970  K  970


 Score = 98.6 bits (244),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 4/66 (6%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHF  714
            +RP+IHRDVKSSNILLDEF KPRIADFGLAKI+Q N+S +++THVI GTHGYIAP    +
Sbjct  799  ERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVQANAS-RESTHVIAGTHGYIAP---EY  854

Query  713  KFYYKL  696
             + YK+
Sbjct  855  GYTYKV  860



>ref|XP_010060141.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
Length=1050

 Score =   183 bits (464),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 85/119 (71%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV EKSDVYSFGVVLMELV GK+PIE EYGEN DIV+WVS+KLK+++ +  
Sbjct  916   IAPEYGYTYKVNEKSDVYSFGVVLMELVIGKRPIEPEYGENRDIVNWVSSKLKTRQDVFG  975

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
             +VDS I EPFKE+AI VLRIAILCT  LPN RP+MR VVQMLEDAEPC LV ++V KD 
Sbjct  976   IVDSRIPEPFKEEAINVLRIAILCTTKLPNLRPSMRSVVQMLEDAEPCNLVRVVVEKDG  1034


 Score =   104 bits (259),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI+Q NSS  D+THVI GTHGYIAP    
Sbjct  864  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVQANSS-NDSTHVIAGTHGYIAP---E  919

Query  716  FKFYYKL  696
            + + YK+
Sbjct  920  YGYTYKV  926



>gb|KCW66704.1| hypothetical protein EUGRSUZ_F00467 [Eucalyptus grandis]
Length=985

 Score =   182 bits (463),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 85/119 (71%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV GK+PIE EYGEN DIV+WVS+KLK+++ +  
Sbjct  851  IAPEYGYTYKVNEKSDVYSFGVVLMELVIGKRPIEPEYGENRDIVNWVSSKLKTRQDVFG  910

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VDS I EPFKE+AI VLRIAILCT  LPN RP+MR VVQMLEDAEPC LV ++V KD 
Sbjct  911  IVDSRIPEPFKEEAINVLRIAILCTTKLPNLRPSMRSVVQMLEDAEPCNLVRVVVEKDG  969


 Score =   104 bits (259),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI+Q NSS  D+THVI GTHGYIAP    
Sbjct  799  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVQANSS-NDSTHVIAGTHGYIAP---E  854

Query  716  FKFYYKL  696
            + + YK+
Sbjct  855  YGYTYKV  861



>ref|XP_007018364.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
 gb|EOY15589.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
Length=987

 Score =   182 bits (463),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+PIE EYG+N DIVSWV +KLK+KES+LS
Sbjct  851  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRPIEPEYGDNKDIVSWVCSKLKNKESVLS  910

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
             VD  I +  KE+A+KVLRIAILCT ALP  RPTMR VVQMLE+AEPCKLV  ++SKD 
Sbjct  911  TVDPRIPDALKEEAVKVLRIAILCTTALPALRPTMRNVVQMLEEAEPCKLVGFVISKDG  969


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDE  KPRIADFGLAKI+Q N   KD+THVI GTHGYIAP    
Sbjct  799  CERPVIHRDVKSSNILLDEVLKPRIADFGLAKIVQANGG-KDSTHVIAGTHGYIAP---E  854

Query  716  FKFYYKL  696
            + + YK+
Sbjct  855  YGYTYKV  861



>ref|XP_008466102.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=982

 Score =   181 bits (460),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 90/128 (70%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = -3

Query  636  PIKLVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES  457
            P  +  EYGYT KV EKSDVYSFGVVLMELVSGKK IE EYGEN +IV WVS  LK++ES
Sbjct  849  PGYIAPEYGYTYKVDEKSDVYSFGVVLMELVSGKKAIEGEYGENKEIVQWVSKNLKTRES  908

Query  456  ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            +LS+VDS I + +KEDAIKVLRIAILCTA LPN RPTMR VVQMLE+A+PC L+ +IV+K
Sbjct  909  VLSIVDSRIPDAYKEDAIKVLRIAILCTARLPNLRPTMRSVVQMLEEAQPCPLLRVIVTK  968

Query  276  D-AAKLDN  256
            D  + +DN
Sbjct  969  DVGSNIDN  976


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            CDRP+IHRDVKSSNILLDEF KPRIADFGLAKIL   ++  DTTHVI GT GYIAP    
Sbjct  799  CDRPVIHRDVKSSNILLDEFLKPRIADFGLAKILHTTTTSHDTTHVIAGTPGYIAP---E  855

Query  716  FKFYYKL  696
            + + YK+
Sbjct  856  YGYTYKV  862



>gb|KJB58765.1| hypothetical protein B456_009G225300 [Gossypium raimondii]
Length=983

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+PIE E+G+N DIVSWVS+KLK+KES+L 
Sbjct  849  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRPIEPEFGDNKDIVSWVSSKLKNKESVLR  908

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I   FKEDA+KVL+IAILCT  LP  RPTMR VVQMLE+AEPCKLVSI+++KD 
Sbjct  909  IVDPRIPVAFKEDAVKVLKIAILCTTQLPALRPTMRSVVQMLEEAEPCKLVSIVINKDG  967


 Score =   102 bits (255),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI+Q N   KD+THVI GTHGYIAP    
Sbjct  797  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVQANGG-KDSTHVIAGTHGYIAP---E  852

Query  716  FKFYYKL  696
            + + YK+
Sbjct  853  YGYTYKV  859



>ref|XP_002283600.3| PREDICTED: uncharacterized protein LOC100257433 [Vitis vinifera]
Length=2026

 Score =   183 bits (464),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 86/119 (72%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE +YGEN DIVSWV + +K++ES+LS
Sbjct  850  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPDYGENRDIVSWVCSNIKTRESVLS  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VDS I E  KEDA+KVLRIAILCTA LP  RPTMR VVQM+E+AEPC+LV IIV+KD 
Sbjct  910  IVDSRIPEALKEDAVKVLRIAILCTARLPALRPTMRGVVQMIEEAEPCRLVGIIVNKDG  968


 Score =   126 bits (317),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 57/132 (43%), Positives = 88/132 (67%), Gaps = 7/132 (5%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EAE+GEN +I+ WV+TK+ + E  + 
Sbjct  1893  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEAEFGENKNIIYWVATKVGTMEGAME  1952

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             ++D  +   F+++ +++LRI + CT++ P  RPTM  V Q+L +A+PC++       D+ 
Sbjct  1953  VLDKRLSGSFRDEMLQMLRIGLRCTSSSPALRPTMNEVAQLLTEADPCRV-------DSC  2005

Query  267   KLDNPSDNTSKM  232
             KL   +  TS +
Sbjct  2006  KLSCKTKETSNV  2017


 Score = 71.2 bits (173),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 3/54 (6%)
 Frame = -1

Query  887   PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
             PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ  +  KD TT VI GT+GY+AP
Sbjct  1844  PIIHRDIKSTNILLDINYQPKVADFGIAKVLQ--ARGKDFTTTVIAGTYGYLAP  1895


 Score =   106 bits (264),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI+Q N   KD+THVI GTHGYIAP    
Sbjct  797  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKIVQANGGGKDSTHVIAGTHGYIAP---E  853

Query  716  FKFYYKL  696
            + + YK+
Sbjct  854  YGYTYKV  860



>ref|NP_188604.1| leucine rich repeat kinase HAIKU 2 [Arabidopsis thaliana]
 sp|Q9LJM4.1|IKU2_ARATH RecName: Full=Receptor-like protein kinase HAIKU2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02557.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE76277.1| leucine rich repeat kinase HAIKU 2 [Arabidopsis thaliana]
Length=991

 Score =   135 bits (341),  Expect(2) = 5e-47, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESI  454
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP+E ++GENNDIV WV   +K  ++E +
Sbjct  860  IAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPLETDFGENNDIVMWVWSVSKETNREMM  919

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            + ++D++I++ +KEDA+KVL IA+LCT   P +RP M+ VV MLE  EP
Sbjct  920  MKLIDTSIEDEYKEDALKVLTIALLCTDKSPQARPFMKSVVSMLEKIEP  968


 Score = 80.9 bits (198),  Expect(2) = 5e-47, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAP
Sbjct  807  DRPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQADSVQRDFSAPLVKGTLGYIAP  862



>ref|XP_009631895.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=958

 Score =   143 bits (360),  Expect(2) = 6e-47, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+E+E+GEN +IV WVSTK+++KE    
Sbjct  823  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVESEFGENKNIVYWVSTKVETKEGAFE  882

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D  + + FKED IKVLRIAI CT + P  RPTM  VVQ+L +A+PCK 
Sbjct  883  VLDKKVSDSFKEDMIKVLRIAIRCTYSTPAQRPTMNEVVQLLIEADPCKF  932


 Score = 72.8 bits (177),  Expect(2) = 6e-47, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       +T VI GT+GY+AP
Sbjct  773  PIIHRDIKSTNILLDIDYQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAP  825



>ref|XP_002889783.1| hypothetical protein ARALYDRAFT_888256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66042.1| hypothetical protein ARALYDRAFT_888256 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct  603  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME  662

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E ++EDAIK+LRIAILCTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  663  IVDKKIGEMYREDAIKILRIAILCTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  721



>ref|XP_009764826.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=958

 Score =   142 bits (357),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+E+E+GEN +IV WVSTK+++KE    
Sbjct  823  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVESEFGENKNIVYWVSTKVETKEGAFE  882

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D  + + FKED IKVLRIAI CT + P  RPTM  VVQ+L +A+PCK 
Sbjct  883  VLDKNVSDSFKEDMIKVLRIAIRCTYSTPALRPTMNEVVQLLIEADPCKF  932


 Score = 72.8 bits (177),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       +T VI GT+GY+AP
Sbjct  773  PIIHRDIKSTNILLDIDYQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAP  825



>ref|XP_006356797.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=955

 Score =   141 bits (355),  Expect(2) = 3e-46, Method: Composition-based stats.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+E E+G+N +IV WVSTK+++KE    
Sbjct  822  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEPEFGDNKNIVYWVSTKVETKEGAFE  881

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D  + + FKED IKVLRIAI CT + P  RPTM  VVQ+L +A+PCK 
Sbjct  882  VLDKKVSDSFKEDMIKVLRIAIRCTYSTPTLRPTMNEVVQLLIEADPCKF  931


 Score = 72.8 bits (177),  Expect(2) = 3e-46, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       +T VI GT+GY+AP
Sbjct  772  PIIHRDIKSTNILLDIDYQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAP  824



>gb|ACI42311.1| putative leucine rich repeat transmembrane protein kinase [Corchorus 
olitorius]
Length=957

 Score =   138 bits (347),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 64/136 (47%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY ++ K   K DVYSFGVVLMEL++GKKP+EA++GEN +IV W+STKL +KE ++ 
Sbjct  822  LAPEYAFSSKATTKCDVYSFGVVLMELITGKKPVEADFGENKNIVYWISTKLDTKEGVME  881

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS----  280
            ++D  +   F+++ I+VLRIA+ CT   P+ RPTM  VVQ+L +A+PC+L S  +S    
Sbjct  882  VLDKQLSGSFRDEMIQVLRIAMRCTCKNPSQRPTMNEVVQLLIEADPCRLDSCKLSSNKT  941

Query  279  KDAAKLDNPSDNTSKM  232
            K+A+ +    +N S++
Sbjct  942  KEASNVTKVKNNQSEV  957


 Score = 75.5 bits (184),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  772  PIIHRDIKSTNILLDVNYRPKVADFGIAKVLQATGGKDSTTTVIAGTYGYLAP  824



>ref|XP_008219158.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=967

 Score =   138 bits (348),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + 
Sbjct  835  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAME  894

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK---  277
            ++D  + E FKE+ I+VLRIA+ CT   P+ RPTM+ VVQ+L +A+PC+  S   SK   
Sbjct  895  VLDKRLSESFKEEMIQVLRIAVRCTYKAPSLRPTMKEVVQLLIEADPCRFDSCKSSKTKE  954

Query  276  --DAAKLDNPSD  247
              +  K+ +P D
Sbjct  955  SSNMTKIKSPYD  966


 Score = 74.7 bits (182),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  785  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  837



>ref|XP_004238044.1| PREDICTED: receptor-like protein kinase HSL1 [Solanum lycopersicum]
Length=957

 Score =   140 bits (353),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+E E+G+N +IV WVSTK+++KE    
Sbjct  821  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEPEFGDNKNIVYWVSTKVETKEGAFE  880

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D  + + FKED IKVLRIAI CT + P  RPTM  VVQ+L +A+PCK 
Sbjct  881  VLDKKVSDSFKEDMIKVLRIAIRCTYSTPTLRPTMNEVVQLLIEADPCKF  930


 Score = 72.8 bits (177),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       +T VI GT+GY+AP
Sbjct  771  PIIHRDIKSTNILLDIDYQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAP  823



>ref|XP_008339015.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score =   177 bits (448),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 88/121 (73%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIEAE+GEN DIVSWVS+ LKS+ESILS
Sbjct  852  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEAEFGENKDIVSWVSSMLKSRESILS  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDA  271
            MVDS I E +KE+AIKVLRIA+LCTA LP  RP+MR VVQMLE+A E  KL+ I++ KD 
Sbjct  912  MVDSYIPEVYKEEAIKVLRIAVLCTARLPELRPSMRSVVQMLEEAHETFKLLKIVIGKDD  971

Query  270  A  268
            A
Sbjct  972  A  972


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 4/66 (6%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHF  714
            +R +IHRDVKSSNILLDEF KPRIADFGLAKI+Q  +  KD+THVI GTHGYIAP    +
Sbjct  801  ERLVIHRDVKSSNILLDEFLKPRIADFGLAKIVQATAG-KDSTHVIAGTHGYIAP---EY  856

Query  713  KFYYKL  696
             + YK+
Sbjct  857  GYTYKV  862



>emb|CDP00973.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   138 bits (347),  Expect(2) = 6e-46, Method: Composition-based stats.
 Identities = 64/112 (57%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EA+YGEN DI+ WVSTK+++KE  L 
Sbjct  873  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEADYGENKDIIYWVSTKVETKEGPLE  932

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  I   FK++ IK+LR+AI CT   P  RPTM  VVQ+L +A+PCK  S
Sbjct  933  VLDKKISGSFKDEMIKMLRVAIRCTCRNPALRPTMSEVVQLLIEADPCKFGS  984


 Score = 74.3 bits (181),  Expect(2) = 6e-46, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  823  PIIHRDIKSTNILLDINYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  875



>gb|KJB29385.1| hypothetical protein B456_005G097600 [Gossypium raimondii]
Length=975

 Score =   176 bits (447),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 84/119 (71%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+PIE E+G+N DIVSWV +K+ +KES+LS
Sbjct  843  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRPIEPEFGDNKDIVSWVCSKINNKESVLS  902

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E  KEDAIKVLR+AILCT  LP  RPTMR VVQMLE+A+PCKLV I++SK+ 
Sbjct  903  IVDPRIPEVLKEDAIKVLRVAILCTTRLPAIRPTMRTVVQMLEEAKPCKLVGIVISKEG  961


 Score =   100 bits (250),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAKI+Q N + KD+THVI GT+GYIAP    
Sbjct  791  CERPVIHRDVKSSNILLDEFMKPRIADFGLAKIVQSNGA-KDSTHVIAGTYGYIAP---E  846

Query  716  FKFYYKL  696
            + + YK+
Sbjct  847  YGYTYKV  853



>ref|XP_007227013.1| hypothetical protein PRUPE_ppa001184mg [Prunus persica]
 gb|EMJ28212.1| hypothetical protein PRUPE_ppa001184mg [Prunus persica]
Length=886

 Score =   137 bits (345),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + 
Sbjct  754  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAME  813

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK---  277
            ++D  + E FKE+ I+VLRIA+ CT   P+ RPTM+ VVQ+L +A+PC+  S   SK   
Sbjct  814  VLDKRLSESFKEEMIQVLRIAVRCTYKAPSLRPTMKEVVQLLIEADPCRFDSCKSSKTKE  873

Query  276  --DAAKLDNPSD  247
              +  K+ +P D
Sbjct  874  SSNLTKIKSPYD  885


 Score = 75.1 bits (183),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  704  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  756



>ref|XP_009786287.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=953

 Score =   139 bits (350),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+E E+GEN +IV WVSTK+ +KE    
Sbjct  822  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEPEFGENKNIVCWVSTKVDTKEGAFE  881

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  I  PFKE+ IKVLRIAI CT   P  RPTM  VVQML +AEP +        D  
Sbjct  882  VLDKKISGPFKEEMIKVLRIAIGCTYTSPAFRPTMNEVVQMLTEAEPRRY-------DCC  934

Query  267  KLDNPSDNTSKM  232
            KL N + +T  +
Sbjct  935  KLPNKNKHTENV  946


 Score = 72.8 bits (177),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  772  PIIHRDIKSTNILLDIDYQPKVADFGIAKVLQAKGGKDCTTTVIAGTYGYLAP  824



>ref|XP_007018366.1| Leucine-rich repeat transmembrane protein kinase family protein 
[Theobroma cacao]
 gb|EOY15591.1| Leucine-rich repeat transmembrane protein kinase family protein 
[Theobroma cacao]
Length=954

 Score =   137 bits (344),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 90/132 (68%), Gaps = 7/132 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EA++GEN +IV WVS +L +K+ ++ 
Sbjct  821  LAPEYAYSNKATTKCDVYSFGVVLMELITGKKPVEADFGENKNIVYWVSGRLDTKDGVME  880

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   FK++ I+VLRIA+ CT+  PN RPTM  VVQ+L +A+PCK        D+ 
Sbjct  881  VLDKRLSGSFKDEMIQVLRIAMRCTSRNPNHRPTMNEVVQLLIEADPCKF-------DSC  933

Query  267  KLDNPSDNTSKM  232
            KL N +   S +
Sbjct  934  KLSNKTKEASNV  945


 Score = 74.7 bits (182),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  771  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  823



>ref|XP_002883200.1| hypothetical protein ARALYDRAFT_479487 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59459.1| hypothetical protein ARALYDRAFT_479487 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   133 bits (334),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESI  454
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP+E E+ EN+DIV WV   +K  ++E +
Sbjct  863  IAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPVETEFSENSDIVMWVWSISKEMNREMM  922

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            + +VD +I++ +KEDA+KVL IA+LCT   P +RP M+ VV MLE  EP
Sbjct  923  MELVDPSIEDEYKEDALKVLTIALLCTDKSPQARPFMKSVVSMLEKIEP  971


 Score = 78.2 bits (191),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE ++PRIADFGLAKI+Q +   +D++  ++ GT GYIAP
Sbjct  810  DRPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQPDWVQRDSSAPLVEGTLGYIAP  865



>gb|AEP84281.1| leucine rich repeat-containing protein [Corchorus capsularis]
Length=958

 Score =   136 bits (342),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 62/136 (46%), Positives = 96/136 (71%), Gaps = 4/136 (3%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY ++ K   K DVYSFGVVLMEL++GKKP+E+++GEN +IV W+STKL +KE ++ 
Sbjct  823  LAPEYAFSSKATTKCDVYSFGVVLMELITGKKPVESDFGENKNIVYWISTKLDTKEGVME  882

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV----S  280
            ++D  +   F+++ I+VLRIA+ CT   P+ RPTM  VVQ+L +A+PC+L S  +    +
Sbjct  883  VLDKQLSGSFRDEMIQVLRIAMRCTCKNPSQRPTMNEVVQLLIEADPCRLDSCKLTSNKT  942

Query  279  KDAAKLDNPSDNTSKM  232
            K+A+ +    +N S++
Sbjct  943  KEASNVTKVKNNQSEV  958


 Score = 75.1 bits (183),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  773  PIIHRDIKSTNILLDVNYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  825



>ref|XP_006442751.1| hypothetical protein CICLE_v10018723mg [Citrus clementina]
 gb|ESR55991.1| hypothetical protein CICLE_v10018723mg [Citrus clementina]
Length=963

 Score =   136 bits (342),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 92/134 (69%), Gaps = 7/134 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++G+KP+E ++G+N +I+ WVSTK+ +KE I+ 
Sbjct  829  LAPEYAYSSKATTKCDVYSFGVVLMELITGRKPVEDDFGDNKNIIYWVSTKVDTKEGIME  888

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV-----  283
            ++D  +   F+++ I+VLRIAI CT+  P +RPTM  VVQ+L +A+PC+  S        
Sbjct  889  VLDKKLSGSFRDEMIEVLRIAIRCTSKSPATRPTMNEVVQLLAEADPCRFESCKFPNKSN  948

Query  282  --SKDAAKLDNPSD  247
              S +A K+ NPS+
Sbjct  949  KESSNATKIKNPSE  962


 Score = 75.1 bits (183),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  779  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  831



>ref|XP_008378672.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=987

 Score =   175 bits (444),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWVS+ L S+ESILS
Sbjct  853  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVSSMLGSRESILS  912

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDA  271
            MVDS I E +KE+AIKVLRIAILCTA +P  RP+MR VVQMLE+A E  KL+ I++SKD 
Sbjct  913  MVDSYIPEVYKEEAIKVLRIAILCTARVPELRPSMRSVVQMLEEAHETFKLLKIVISKDG  972

Query  270  AKLD  259
            A  D
Sbjct  973  AAAD  976


 Score = 90.5 bits (223),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 4/66 (6%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHF  714
            +R ++HRDVKSSNILLDEF KP+IADFGLAKI+Q  +  KD+THVI GTHGYIAP    +
Sbjct  802  ERLVMHRDVKSSNILLDEFLKPKIADFGLAKIVQATAD-KDSTHVIAGTHGYIAP---EY  857

Query  713  KFYYKL  696
             + YK+
Sbjct  858  GYTYKV  863



>ref|XP_006441549.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
 gb|ESR54789.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
Length=973

 Score =   137 bits (344),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDV+SFGVVL+ELV+G+KPIE EYG+  DIV WVST L + E++L 
Sbjct  848  IAPELAYTCKVSEKSDVFSFGVVLLELVTGRKPIEEEYGDGKDIVYWVSTHLNNHENVLK  907

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPC  304
            ++D  +  E  KED IKVL+IA++CT  LPN RP MR VV+ML DA+PC
Sbjct  908  VLDREVASESIKEDMIKVLKIAVVCTTKLPNLRPPMREVVKMLADADPC  956


 Score = 73.9 bits (180),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KSSNILLDE ++P+IADFG+AKI + +    D +    GTHGYIAP
Sbjct  796  CSPPIIHRDIKSSNILLDEDYEPKIADFGVAKIAENSPKVSDYS-CFAGTHGYIAP  850



>ref|XP_010104545.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
 gb|EXC01146.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
Length=1030

 Score =   175 bits (444),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWV + LKS+ES+L+
Sbjct  894   IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVFSNLKSRESVLN  953

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             +VD  I E  K +AIKVLRIA+LCT  LP  RPTMR VVQMLE+AEPC+LV IIV+KD  
Sbjct  954   LVDQDIPEALKGEAIKVLRIAVLCTDRLPEMRPTMRSVVQMLEEAEPCELVEIIVTKDGG  1013


 Score = 99.8 bits (247),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/68 (68%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSS-CKDTTHVIPGTHGYIAPGTK  720
            CDRP+IHRDVKSSNILLDEF KPRIADFGLAK++Q N++  +++THVI GTHGYIAP   
Sbjct  840  CDRPVIHRDVKSSNILLDEFLKPRIADFGLAKMVQANNNGGQNSTHVIAGTHGYIAP---  896

Query  719  HFKFYYKL  696
             + + YK+
Sbjct  897  EYGYTYKV  904



>ref|XP_009357239.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=983

 Score =   175 bits (444),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWVS+ LKS+ESILS
Sbjct  849  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVSSMLKSRESILS  908

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDA  271
            MVDS I E +KE+AIKVLRIA+LCTA LP  RP+MR VVQMLE+A E  KL+ I++ KD 
Sbjct  909  MVDSFIPELYKEEAIKVLRIAVLCTARLPELRPSMRSVVQMLEEAHETFKLLKIVIGKDD  968

Query  270  A  268
            A
Sbjct  969  A  969


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 4/66 (6%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHF  714
            +R +IHRDVKSSNILLDEF KPRIADFGLAKI+Q  +  KD+THVI GTHGYIAP    +
Sbjct  798  ERLVIHRDVKSSNILLDEFLKPRIADFGLAKIVQATAG-KDSTHVIAGTHGYIAP---EY  853

Query  713  KFYYKL  696
             + YK+
Sbjct  854  GYTYKV  859



>gb|KJB59873.1| hypothetical protein B456_009G278200 [Gossypium raimondii]
Length=975

 Score =   139 bits (351),  Expect(2) = 3e-45, Method: Composition-based stats.
 Identities = 67/135 (50%), Positives = 95/135 (70%), Gaps = 8/135 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYS+GVVLMEL++GKKP+E+++GEN +IV WVSTKL++KE ++ 
Sbjct  840  LAPEYAYSNKATTKCDVYSYGVVLMELITGKKPVESDFGENKNIVYWVSTKLETKEGVME  899

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSIIV  283
             +D ++   FK++ I+VLR A+ CT   P+ RPTM  VVQ+L DA+P     CKL+S   
Sbjct  900  ALDKSLSTSFKDEMIQVLRTAMRCTCKNPSQRPTMNEVVQLLIDADPCRLGSCKLLSTNK  959

Query  282  SKDAA---KLDNPSD  247
            +KDA+   K+ N +D
Sbjct  960  TKDASNVTKIKNQTD  974


 Score = 70.9 bits (172),  Expect(2) = 3e-45, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 3/54 (6%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ  +  KD+T+ VI GT+GY+AP
Sbjct  791  PIIHRDIKSTNILLDANYQPKVADFGIAKVLQ--ARGKDSTNTVIAGTYGYLAP  842



>ref|XP_009599063.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=950

 Score =   139 bits (349),  Expect(2) = 4e-45, Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+E E+GEN +IV WVSTK  +KE    
Sbjct  817  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVETEFGENKNIVYWVSTKADTKEGAFE  876

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  I  PFKE+ IKVLRIAI CT + P  RPTM  VVQML +AEP +        D  
Sbjct  877  VLDKKISGPFKEEMIKVLRIAIGCTYSSPAFRPTMNEVVQMLTEAEPRRY-------DCC  929

Query  267  KLDNPSDNTSKM  232
            KL N + +T  +
Sbjct  930  KLPNKNKHTENI  941


 Score = 71.2 bits (173),  Expect(2) = 4e-45, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILL+  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  767  PIIHRDIKSTNILLNIDYQPKVADFGIAKVLQAKGGKDCTTTVIAGTYGYLAP  819



>gb|KJB29386.1| hypothetical protein B456_005G097700 [Gossypium raimondii]
Length=956

 Score =   136 bits (342),  Expect(2) = 5e-45, Method: Composition-based stats.
 Identities = 65/134 (49%), Positives = 92/134 (69%), Gaps = 7/134 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+E ++GEN +IV W+S KL++KE ++ 
Sbjct  822  LAPEYAYSNKATTKCDVYSFGVVLMELITGKKPVETDFGENKNIVLWISAKLETKEGVVE  881

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS-------I  289
            ++D  + + FKE+ +KVLRIA+ CT   P+ RPTM  VVQ+L ++EP +L S       I
Sbjct  882  VLDKKLSKTFKEEMVKVLRIAMRCTCKNPSQRPTMNEVVQLLIESEPFRLDSSCKSPSKI  941

Query  288  IVSKDAAKLDNPSD  247
              + +A K+ N SD
Sbjct  942  KEAANANKIKNQSD  955


 Score = 73.6 bits (179),  Expect(2) = 5e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  + P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  772  PIIHRDIKSTNILLDVDYHPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  824



>gb|KHG23504.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=962

 Score =   174 bits (441),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELVSGK+PIE E+G+N DIVSWV +K+ +KESILS
Sbjct  830  IAPEYGYTYKVNEKSDVYSFGVVLMELVSGKRPIEPEFGDNKDIVSWVCSKMNNKESILS  889

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +VD  I E  KED IKVLR+AILCT  LP  RPTMR VV ML++AEPCKLV I++SK+ 
Sbjct  890  IVDPRIPEVLKEDVIKVLRVAILCTTRLPAVRPTMRTVVHMLKEAEPCKLVGIVISKEG  948


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+R +IHRDVKSSNILLDEF KPRIADFGLAKI+Q N + KD+THVI GTHGYIAP    
Sbjct  778  CERLVIHRDVKSSNILLDEFMKPRIADFGLAKIVQSNGA-KDSTHVIAGTHGYIAP---E  833

Query  716  FKFYYKL  696
            + + YK+
Sbjct  834  YGYTYKV  840



>ref|XP_006487758.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=963

 Score =   134 bits (337),  Expect(2) = 6e-45, Method: Composition-based stats.
 Identities = 62/134 (46%), Positives = 91/134 (68%), Gaps = 7/134 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++G+KP+E ++G+N +I+ WVS K+ +KE I+ 
Sbjct  829  LAPEYAYSSKATTKCDVYSFGVVLMELITGRKPVEDDFGDNKNIIYWVSIKVDTKEGIME  888

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV-----  283
            ++D  +   F+++ I+VLRIAI CT+  P +RPTM  VVQ+L +A+PC+  S        
Sbjct  889  VLDKKLSGSFRDEMIQVLRIAIRCTSKSPATRPTMNEVVQLLAEADPCRFESCKFPNKSN  948

Query  282  --SKDAAKLDNPSD  247
              S +A K+ NPS+
Sbjct  949  KESSNATKIKNPSE  962


 Score = 75.1 bits (183),  Expect(2) = 6e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  779  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  831



>ref|XP_006478192.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=973

 Score =   135 bits (339),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDV+SFGVVL+ELV+G+KP+E EYG+  DIV WVST L + E++L 
Sbjct  848  IAPELAYTCKVSEKSDVFSFGVVLLELVTGRKPVEEEYGDGKDIVYWVSTHLNNHENVLK  907

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPC  304
            ++D  +  E  KED IK+L+IA++CT  LPN RP MR VV+ML DA+PC
Sbjct  908  VLDCEVASESIKEDMIKLLKIAVVCTTKLPNLRPPMREVVKMLADADPC  956


 Score = 73.9 bits (180),  Expect(2) = 6e-45, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KSSNILLDE ++P+IADFG+AKI + +    D +    GTHGYIAP
Sbjct  796  CSPPIIHRDIKSSNILLDEDYEPKIADFGVAKIAENSPKVSDYS-CFAGTHGYIAP  850



>gb|KDO45819.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45820.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=973

 Score =   135 bits (340),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDV+SFGVVL+ELV+G+KP+E EYG+  DIV WVST L + E++L 
Sbjct  848  IAPELAYTCKVSEKSDVFSFGVVLLELVTGRKPVEEEYGDGKDIVYWVSTHLNNHENVLK  907

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPC  304
            ++D  +  E  KED IK+L+IA++CT  LPN RP MR VV+ML DA+PC
Sbjct  908  VLDCEVASESIKEDMIKLLKIAVVCTTKLPNLRPPMREVVKMLADADPC  956


 Score = 73.9 bits (180),  Expect(2) = 7e-45, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KSSNILLDE ++P+IADFG+AKI + +    D +    GTHGYIAP
Sbjct  796  CSPPIIHRDIKSSNILLDEDYEPKIADFGVAKIAENSPKVSDYS-CFAGTHGYIAP  850



>ref|XP_004299842.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=965

 Score =   135 bits (339),  Expect(2) = 7e-45, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EAE+G+N +I+ WVS K+ +KE  + 
Sbjct  832  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEAEFGDNKNIIYWVSNKVDTKEGAME  891

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  + E FKE+ I+VLRIA+ CT   P+ RPTM+ VVQ+L +A+PC+  S   S    
Sbjct  892  VLDKRLSESFKEEMIQVLRIAVRCTYKAPSLRPTMKEVVQLLIEADPCRFDSCKSSTKTK  951

Query  267  KLDN  256
            +  N
Sbjct  952  EASN  955


 Score = 73.9 bits (180),  Expect(2) = 7e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  + P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  782  PIIHRDIKSTNILLDVNYHPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  834



>gb|KDO42901.1| hypothetical protein CISIN_1g003199mg [Citrus sinensis]
Length=840

 Score =   134 bits (336),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 91/134 (68%), Gaps = 7/134 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++G+KP+E ++G+N +I+ WVS K+ +KE I+ 
Sbjct  706  LAPEYAYSSKATTKCDVYSFGVVLMELITGRKPVEDDFGDNKNIIYWVSIKVDTKEGIME  765

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV-----  283
            ++D  +   F+++ I+VLRIAI CT+  P +RPTM  VVQ+L +A+PC+  S        
Sbjct  766  VLDKKLSGSFRDEMIQVLRIAIRCTSKSPATRPTMNEVVQLLAEADPCRFESCKFPNKSN  825

Query  282  --SKDAAKLDNPSD  247
              S +A K+ NPS+
Sbjct  826  KESSNATKIKNPSE  839


 Score = 75.1 bits (183),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  656  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  708



>ref|XP_007020166.1| Leucine-rich receptor-like protein kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOY17391.1| Leucine-rich receptor-like protein kinase family protein isoform 
1 [Theobroma cacao]
Length=1004

 Score =   140 bits (353),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 67/110 (61%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = -3

Query  618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD  439
            E  YT KV EKSDVYSFGVVL+ELV+G+ P+E EYGE  DIV WV T L + ES+L ++D
Sbjct  882  ELAYTPKVTEKSDVYSFGVVLLELVTGRGPVEEEYGEGKDIVYWVLTHLNNLESVLKVLD  941

Query  438  SAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            + +  E  ++D IKVL++ ILCTA LP+SRPTMR VV+ML DAEPC  +S
Sbjct  942  NEVASETVRDDMIKVLKVGILCTAKLPSSRPTMREVVKMLIDAEPCTFMS  991


 Score = 68.6 bits (166),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS NILLDE ++P+IADFG+AKI + +    + +    GTHGY AP
Sbjct  827  CSPPIIHRDIKSGNILLDEDYEPKIADFGVAKIAEKSPKGSEYS-CFAGTHGYFAP  881



>gb|EYU36418.1| hypothetical protein MIMGU_mgv1a000952mg [Erythranthe guttata]
Length=935

 Score =   133 bits (334),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 59/110 (54%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   + DVYSFGVVLMEL++GKKP+EAE+GEN +I+ WVS+K+++KE  + 
Sbjct  800  LAPEYAYSSKATTRCDVYSFGVVLMELLTGKKPVEAEFGENKNIIYWVSSKVETKEGAID  859

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D  +   +K+D IKVLRIA+ CT   PN RPTM  V Q+L +A+PCK 
Sbjct  860  VLDKRLLGNYKDDMIKVLRIAMRCTCKNPNLRPTMNEVAQLLIEADPCKF  909


 Score = 75.9 bits (185),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ   S KD +T VI GT+GY+AP
Sbjct  749  PIIHRDIKSTNILLDIDYQPKVADFGIAKVLQARGSSKDSSTTVIAGTYGYLAP  802



>ref|XP_006300009.1| hypothetical protein CARUB_v10016232mg [Capsella rubella]
 gb|EOA32907.1| hypothetical protein CARUB_v10016232mg [Capsella rubella]
Length=982

 Score =   130 bits (328),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESI  454
            +  EY YT+ V EKSDVYSFGVVLMELV+GKKP+E E+GEN+DIV WV   +K  ++E +
Sbjct  862  IAPEYAYTRNVNEKSDVYSFGVVLMELVTGKKPVEIEFGENSDIVMWVWRMSKEMNREMM  921

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            + ++D +I++ +KEDA+KVL IA LCT   P +RP M+ VV MLE  EP
Sbjct  922  MELIDPSIEDEYKEDALKVLTIASLCTDKSPQARPFMKSVVSMLEKIEP  970


 Score = 77.8 bits (190),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            DRP+IH DVKSSNILLDE ++PRIADFGLAKI+Q +S+ +D +  ++ GT GYIAP
Sbjct  809  DRPVIHGDVKSSNILLDEEWRPRIADFGLAKIIQPDSAQQDFSAPLVKGTLGYIAP  864



>ref|XP_011074306.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=961

 Score =   134 bits (338),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EAE+GEN +I+ WVSTK+++KE    
Sbjct  828  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEAEFGENKNIIYWVSTKVETKEGAAD  887

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   ++ED IKVLR+A+ CT   P  RPTM  VVQ+L +A+PCK     +S    
Sbjct  888  VLDKRVVGSYEEDMIKVLRVAVRCTCRTPVLRPTMNEVVQLLIEADPCKFDCCKLSNKTK  947

Query  267  KLDNPS  250
            +  NP+
Sbjct  948  ETANPT  953


 Score = 73.9 bits (180),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ   S   TT  I GT+GY+AP
Sbjct  778  PIIHRDIKSTNILLDVDYQPKVADFGIAKVLQARGSKDSTTTEIAGTYGYLAP  830



>ref|XP_010247922.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=975

 Score =   140 bits (354),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 63/110 (57%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E+ Y+ KV EKSD+YSFGVVL+ELV+G++PIE EYGE  DIV WVST L S++ ++ 
Sbjct  857  IAPEFAYSLKVTEKSDIYSFGVVLLELVTGRRPIELEYGEGKDIVYWVSTHLDSRDDVIK  916

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D  +    ++D IKVLRIAILCT  LP+ RPTMR VV+ML DA+PC  
Sbjct  917  ILDHKVSNSVEDDMIKVLRIAILCTKKLPSLRPTMRDVVKMLIDADPCNF  966


 Score = 67.4 bits (163),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 8/67 (12%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C   IIHRD+KS+NILLDE ++P+IADFG+AK +   ++  + +    GTHGYIAP    
Sbjct  807  CSPAIIHRDIKSTNILLDEDYEPKIADFGIAKTV---AASPNDSSCFAGTHGYIAP----  859

Query  716  FKFYYKL  696
             +F Y L
Sbjct  860  -EFAYSL  865



>ref|XP_010061584.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
 gb|KCW68569.1| hypothetical protein EUGRSUZ_F02182 [Eucalyptus grandis]
Length=954

 Score =   132 bits (331),  Expect(2) = 2e-44, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVL+EL++GK+P+E E+GEN +I  WVSTK+ +KE  + 
Sbjct  826  LAPEYAYSSKATTKCDVYSFGVVLLELITGKRPVEHEFGENKNITCWVSTKVDTKEGTVE  885

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   F+ED I+VLRIAI CT   P  RPTM  VV +L +A+PCK  S   S    
Sbjct  886  VLDKRLSSSFREDIIRVLRIAICCTYGAPALRPTMNEVVHLLIEADPCKFGSCKTSDKIK  945

Query  267  KLDNP  253
            +  +P
Sbjct  946  ETFDP  950


 Score = 75.9 bits (185),  Expect(2) = 2e-44, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  F+P++ADFG+AK+LQ       T+ VI GT+GY+AP
Sbjct  776  PIIHRDIKSTNILLDAHFQPKVADFGIAKVLQARGGKDSTSTVIAGTYGYLAP  828



>ref|XP_012068114.1| PREDICTED: receptor-like protein kinase 5 [Jatropha curcas]
Length=956

 Score =   132 bits (332),  Expect(2) = 2e-44, Method: Composition-based stats.
 Identities = 59/124 (48%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY Y+ K   K DVYSFGVVLMEL++GKKPI  ++GEN +I+ WVS K+ +KE ++ 
Sbjct  823  MAPEYAYSSKATTKCDVYSFGVVLMELITGKKPIHTDFGENKNIIYWVSGKVDTKEGVME  882

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   F+++ I+VLRIAI CT + P  RPTM  VVQML +A+PC+  S   S  + 
Sbjct  883  VLDKRLSGSFRDEMIQVLRIAIRCTCSTPALRPTMSEVVQMLIEADPCRFDSCKSSTKSK  942

Query  267  KLDN  256
            ++ N
Sbjct  943  EMSN  946


 Score = 75.1 bits (183),  Expect(2) = 2e-44, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  773  PIIHRDIKSTNILLDVNYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYMAP  825



>ref|XP_007227019.1| hypothetical protein PRUPE_ppa001010mg [Prunus persica]
 gb|EMJ28218.1| hypothetical protein PRUPE_ppa001010mg [Prunus persica]
Length=934

 Score =   172 bits (435),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWV + LKS+ESILS
Sbjct  800  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVCSMLKSRESILS  859

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDA  271
            MVDS + E +KE+AIKVLRIAILCTA LP  RP+MR VVQMLE+A E  KL+ I++SKD 
Sbjct  860  MVDSYLPEAYKEEAIKVLRIAILCTARLPELRPSMRSVVQMLEEAHETFKLMGIVISKDG  919


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 4/66 (6%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHF  714
            +R ++HRDVKSSNILLDEF KPRIADFGLAKI+Q  S+ KD+THV+ GTHGYIAP    +
Sbjct  749  ERLVMHRDVKSSNILLDEFLKPRIADFGLAKIVQ-ASAGKDSTHVVAGTHGYIAP---EY  804

Query  713  KFYYKL  696
             + YK+
Sbjct  805  GYTYKV  810



>ref|XP_004136412.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis sativus]
 gb|KGN60296.1| Receptor protein kinase CLAVATA1 [Cucumis sativus]
Length=981

 Score =   172 bits (435),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 88/135 (65%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  636  PIKLVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES  457
            P  +  EYGYT KV EKSDVYSFGVVLMELVSGKK IE EYGEN +IV WVS  LK++ES
Sbjct  848  PGYIAPEYGYTYKVDEKSDVYSFGVVLMELVSGKKAIEGEYGENKEIVQWVSKNLKTRES  907

Query  456  ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            ILS++DS I + +KEDAIKVLRI ILCTA LPN RP MR VVQMLE A+P  L+ II++K
Sbjct  908  ILSIIDSRIPDAYKEDAIKVLRIGILCTARLPNLRPNMRSVVQMLEGAQPSPLLGIIITK  967

Query  276  DAAKLDNPSDNTSKM  232
            D     + +DN  K+
Sbjct  968  DVG---SNNDNVKKV  979


 Score =   102 bits (253),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            CDRP+IHRDVKSSNILLDEF KPRIADFGLAKIL   +S  DT+HVI GT GYIAP    
Sbjct  798  CDRPVIHRDVKSSNILLDEFLKPRIADFGLAKILHTTASSNDTSHVIAGTPGYIAP---E  854

Query  716  FKFYYKL  696
            + + YK+
Sbjct  855  YGYTYKV  861



>ref|XP_006406469.1| hypothetical protein EUTSA_v10022054mg [Eutrema salsugineum]
 gb|ESQ47922.1| hypothetical protein EUTSA_v10022054mg [Eutrema salsugineum]
Length=994

 Score =   127 bits (318),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 60/109 (55%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLK--SKESI  454
            +  E  YT  V EKSDVYSFGVVLMELV+GKKP+EAE+GEN DIV WV ++ K  ++E +
Sbjct  862  IAPECAYTTNVSEKSDVYSFGVVLMELVTGKKPVEAEFGENRDIVMWVWSRSKEMNRERM  921

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            + +VD  I++ +K+DA++VL IA++CT   P  RP M+ VV MLE  EP
Sbjct  922  MELVDPIIEDEYKKDALRVLTIALICTNKSPQVRPFMKSVVSMLEKTEP  970


 Score = 79.7 bits (195),  Expect(2) = 3e-44, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAP
Sbjct  809  DRPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQPDSVQQDFSAPLVKGTLGYIAP  864



>gb|KJB58763.1| hypothetical protein B456_009G225100 [Gossypium raimondii]
Length=958

 Score =   135 bits (340),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   KSDVYSFGVVLMEL++GKKP+EA +GEN +IV WVSTKL +KE ++ 
Sbjct  824  LAPEYAYSSKATTKSDVYSFGVVLMELITGKKPVEAVFGENKNIVYWVSTKLDTKEGVME  883

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   FK++ I+VLRIA+ CT   P+ RP M  VVQ+L +A+PC+  S  +S +  
Sbjct  884  VLDKRVSGSFKDEMIQVLRIAMRCTYRNPSQRPPMNEVVQLLIEADPCRFDSCKLSINKT  943

Query  267  K  265
            K
Sbjct  944  K  944


 Score = 71.2 bits (173),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ          VI GT+GY+AP
Sbjct  774  PIIHRDIKSTNILLDANYEPKVADFGIAKVLQARGGKDSIITVIAGTYGYLAP  826



>gb|KHN08204.1| Receptor-like protein kinase HAIKU2-like protein [Glycine soja]
Length=822

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWV  K +SKE + S
Sbjct  694  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVHNKARSKEGLRS  753

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             VDS I E + E+  KVLR A+LCT  LP  RPTMR VVQ LEDAEPCKLV I++SKD +
Sbjct  754  AVDSRIPEMYTEETCKVLRTAVLCTGTLPALRPTMRAVVQKLEDAEPCKLVGIVISKDGS  813

Query  267  K  265
            +
Sbjct  814  E  814


 Score = 96.7 bits (239),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAK++Q N     +T VI GTHGYIAP    
Sbjct  641  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKLVQANVGKDSSTRVIAGTHGYIAP---E  697

Query  716  FKFYYKL  696
            + + YK+
Sbjct  698  YGYTYKV  704



>gb|KDP41543.1| hypothetical protein JCGZ_15950 [Jatropha curcas]
Length=469

 Score =   131 bits (330),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY Y+ K   K DVYSFGVVLMEL++GKKPI  ++GEN +I+ WVS K+ +KE ++ 
Sbjct  336  MAPEYAYSSKATTKCDVYSFGVVLMELITGKKPIHTDFGENKNIIYWVSGKVDTKEGVME  395

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   F+++ I+VLRIAI CT + P  RPTM  VVQML +A+PC+  S   S  + 
Sbjct  396  VLDKRLSGSFRDEMIQVLRIAIRCTCSTPALRPTMSEVVQMLIEADPCRFDSCKSSTKSK  455

Query  267  KLDN  256
            ++ N
Sbjct  456  EMSN  459


 Score = 75.1 bits (183),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  286  PIIHRDIKSTNILLDVNYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYMAP  338



>ref|XP_008219159.1| PREDICTED: receptor-like protein kinase HAIKU2 [Prunus mume]
Length=1017

 Score =   171 bits (434),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 86/120 (72%), Positives = 100/120 (83%), Gaps = 1/120 (1%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWV + LKS+ESILS
Sbjct  883   IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVCSMLKSRESILS  942

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDA  271
             MVDS + E +KE+AIKVLRIAILCTA LP  RP+MR VVQMLE+A E  KL+ I++SKD 
Sbjct  943   MVDSYLPEAYKEEAIKVLRIAILCTARLPELRPSMRSVVQMLEEAHETFKLMGIVISKDG  1002


 Score = 92.0 bits (227),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 44/66 (67%), Positives = 54/66 (82%), Gaps = 4/66 (6%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHF  714
            +R ++HRDVKSSNILLDEF KPRIADFGLAKI+Q  S+ KD+THV+ GTHGYIAP    +
Sbjct  832  ERLVMHRDVKSSNILLDEFLKPRIADFGLAKIVQ-ASAGKDSTHVVAGTHGYIAP---EY  887

Query  713  KFYYKL  696
             + YK+
Sbjct  888  GYTYKV  893



>gb|KHG16379.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
 gb|KHG22296.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=475

 Score =   135 bits (341),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   KSDVYSFGVVLMEL++GKKP+EA++GEN +I+ WVSTKL +KE ++ 
Sbjct  341  LAPEYAYSSKATTKSDVYSFGVVLMELITGKKPVEADFGENKNIIYWVSTKLDTKEGVME  400

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   FK++ I+VLRIA+ CT   P  RP M  VVQ+L +A+PC+  S  +S +  
Sbjct  401  VLDKRVSGSFKDEMIQVLRIAMRCTYRNPTQRPPMNEVVQLLIEADPCRFDSCKLSINKT  460

Query  267  K  265
            K
Sbjct  461  K  461


 Score = 70.5 bits (171),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ          VI GT+GY+AP
Sbjct  291  PIIHRDIKSTNILLDANYEPKVADFGIAKVLQARGGKDSIITVIAGTYGYLAP  343



>ref|XP_002510008.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF52195.1| receptor protein kinase, putative [Ricinus communis]
Length=956

 Score =   132 bits (331),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY Y+ K   K DVYSFGVVLMEL++GKKP+E ++GEN +IV+WVSTK+++KE ++ 
Sbjct  823  IAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEEDFGENKNIVNWVSTKVETKEGVME  882

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  +   F  + I+VLRIAI C    P  RPTM  VVQ+L +A+PC+  S   S  A 
Sbjct  883  VLDKKLSGSFWNEMIQVLRIAIRCICKTPAPRPTMNEVVQLLIEADPCRFDSCKSSNKAK  942

Query  267  KLDNPSDNTSK  235
            +  N +   SK
Sbjct  943  ETSNVTKINSK  953


 Score = 74.3 bits (181),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       T+ V+ GT+GYIAP
Sbjct  773  PIIHRDIKSTNILLDVSYQPKVADFGIAKVLQARGGKDSTSTVVAGTYGYIAP  825



>gb|KFK39298.1| hypothetical protein AALP_AA3G226400 [Arabis alpina]
Length=986

 Score =   131 bits (330),  Expect(2) = 7e-44, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLK--SKESI  454
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP+E E+GEN DIV WV +K K  ++E +
Sbjct  856  IAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPVETEFGENRDIVMWVWSKSKDMNREKM  915

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            + ++D  I+   KEDA+KVL IA+LCT   P +RP M+ VV ML+  EP
Sbjct  916  MELIDPIIEYEHKEDALKVLTIALLCTNKSPQARPFMKSVVCMLKKTEP  964


 Score = 73.9 bits (180),  Expect(2) = 7e-44, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            DRP+IH DVKS NILLDE ++P+IADFGLAKI+Q +S  +D +  ++ GT GYIAP
Sbjct  803  DRPVIHLDVKSRNILLDEEWRPKIADFGLAKIIQPDSIQRDFSAPIVKGTLGYIAP  858



>ref|XP_003634589.1| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
 ref|XP_010665363.1| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
Length=974

 Score =   129 bits (325),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSD+YSFGVVL+ELV+G++PIE EYGE  DIV WV T L  +E++  
Sbjct  849  IAPELAYTLKVTEKSDIYSFGVVLLELVTGRRPIEEEYGEGKDIVYWVGTHLSDQENVQK  908

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  I  +  +ED +KVL++AILCT  LP  RPTMR VV+M+ DA+ C L S
Sbjct  909  LLDRDIVSDLVQEDMLKVLKVAILCTNKLPTPRPTMRDVVKMIIDADSCTLKS  961


 Score = 76.3 bits (186),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE ++P+IADFG+AKI   NSS +  +    GTHGYIAP
Sbjct  797  CSPPIIHRDIKSTNILLDEEYEPKIADFGVAKIAD-NSSTESYSSCFAGTHGYIAP  851



>ref|XP_010667798.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=958

 Score =   135 bits (341),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = -3

Query  618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD  439
            +Y  T K   K DVYSFGVVLMELV+GKKP+EAE+GEN +I++W+STK+K+KE  + ++D
Sbjct  828  DYANTSKATTKCDVYSFGVVLMELVTGKKPVEAEFGENKNIINWISTKVKTKEGAMEVLD  887

Query  438  SAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLD  259
            + I   F++D IKV+RIAI CTA  P  RPTM  +VQ+L + +PC+  S   +K      
Sbjct  888  NQISGLFRDDMIKVIRIAIRCTARAPVPRPTMNEIVQLLSEIDPCRFDSCKSTKKTKDTL  947

Query  258  NPS  250
            +P+
Sbjct  948  DPT  950


 Score = 69.3 bits (168),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAP  729
            PI+HRD+KSSNILLD  F+P++ADFG+AK+LQ +   KD++H +I GT+GY+ P
Sbjct  775  PIVHRDIKSSNILLDVDFQPKVADFGVAKVLQ-SKVGKDSSHTLIAGTYGYMDP  827



>ref|NP_001067347.2| Os12g0632800 [Oryza sativa Japonica Group]
 gb|ABA99940.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30366.2| Os12g0632800 [Oryza sativa Japonica Group]
Length=1007

 Score =   117 bits (294),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 62/117 (53%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVL+ELV+G+  I AEYGE+ DIV WVS +L S++ ++S
Sbjct  884  MAPEYSYTWKVTEKSDVYSFGVVLLELVTGRTAIMAEYGESRDIVEWVSRRLDSRDKVMS  943

Query  447  MVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++D++I E + KE+A++VLR+A++CT+  P+ RP+MR VVQMLE A   +  +++ S
Sbjct  944  LLDASIGEEWEKEEAVRVLRVAVVCTSRTPSMRPSMRSVVQMLEAAAIGREFAVVTS  1000


 Score = 87.4 bits (215),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAP  729
            CDRPI+HRDVKSSNILLDE FKPRIADFGLAKIL   ++  DTT   V+ GT GY+AP
Sbjct  829  CDRPILHRDVKSSNILLDESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAP  886



>gb|EAY84008.1| hypothetical protein OsI_39239 [Oryza sativa Indica Group]
Length=992

 Score =   117 bits (294),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 62/117 (53%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVL+ELV+G+  I AEYGE+ DIV WVS +L S++ ++S
Sbjct  869  MAPEYSYTWKVTEKSDVYSFGVVLLELVTGRTAIMAEYGESRDIVEWVSRRLDSRDKVMS  928

Query  447  MVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++D++I E + KE+A++VLR+A++CT+  P+ RP+MR VVQMLE A   +  +++ S
Sbjct  929  LLDASIGEEWEKEEAVRVLRVAVVCTSRTPSMRPSMRSVVQMLEAAAIGREFAVVTS  985


 Score = 87.4 bits (215),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAP  729
            CDRPI+HRDVKSSNILLDE FKPRIADFGLAKIL   ++  DTT   V+ GT GY+AP
Sbjct  814  CDRPILHRDVKSSNILLDESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAP  871



>ref|XP_008466101.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Cucumis melo]
Length=946

 Score =   134 bits (337),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFG+VLMEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + 
Sbjct  817  LAPEYAYSSKATTKCDVYSFGIVLMELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAME  876

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD--  274
            ++D  +   FK++ I+VLRIAI CT   P  RPTM+ VVQ+L +A+PCK  S   S    
Sbjct  877  VLDKRVSCSFKDEMIEVLRIAIRCTYKNPALRPTMKEVVQLLIEADPCKFDSHNKSSKHT  936

Query  273  AAKLDNPSD  247
              K++NP D
Sbjct  937  TTKINNPFD  945


 Score = 70.9 bits (172),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            IIHRD+K++NILLD  + P++ADFG+AK+LQ  +    TT VI GT+GY+AP
Sbjct  768  IIHRDIKTTNILLDVNYHPKVADFGIAKVLQARTGKDSTTTVIAGTYGYLAP  819



>ref|XP_010062414.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 ref|XP_010062415.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 ref|XP_010062416.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 gb|KCW69556.1| hypothetical protein EUGRSUZ_F02986 [Eucalyptus grandis]
Length=989

 Score =   133 bits (334),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  E  YT KV EK+DVYSFGVVL+E+V+G++P+E EYGE  DIV W  T L  ++++L 
Sbjct  863  LAPELAYTLKVSEKTDVYSFGVVLLEIVTGRRPLEDEYGEGRDIVHWTLTHLSDRKNVLK  922

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D  +  +  ++D IKVL++A+LCTA LP+ RPTMR VV ML DAEPC L
Sbjct  923  VLDDKVASDHIEDDMIKVLKVAVLCTAKLPSLRPTMREVVSMLSDAEPCTL  973


 Score = 71.6 bits (174),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE ++P+IADFG+AK ++ +    + +  I GTHGY+AP
Sbjct  811  CSPPIIHRDIKSTNILLDEHYEPKIADFGVAKTVEKSHKGPNCSR-IAGTHGYLAP  865



>ref|XP_004136411.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis sativus]
 gb|KGN60297.1| hypothetical protein Csa_3G893960 [Cucumis sativus]
Length=947

 Score =   134 bits (337),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 88/129 (68%), Gaps = 2/129 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFG+VLMEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + 
Sbjct  818  LAPEYAYSSKATTKCDVYSFGIVLMELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAME  877

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD--  274
            ++D  +   FK++ I+VLRIAI CT   P  RPTM+ VVQ+L +A+PCK  S   S    
Sbjct  878  VLDKRVSCSFKDEMIEVLRIAIRCTYKNPALRPTMKEVVQLLIEADPCKFDSHNKSSKHT  937

Query  273  AAKLDNPSD  247
              K++NP D
Sbjct  938  TTKINNPFD  946


 Score = 70.5 bits (171),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            IIHRD+K++NILLD  + P++ADFG+AK+LQ  +    TT VI GT+GY+AP
Sbjct  769  IIHRDIKTTNILLDVNYHPKVADFGIAKVLQARTGKDSTTTVIAGTYGYLAP  820



>ref|XP_009357235.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1008

 Score =   131 bits (330),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 6/131 (5%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             L  EY Y+ K   K DVYSFGVVLMEL++GK+P+EAE+G+N +I+ WVS K+ +KE    
Sbjct  875   LAPEYAYSSKATTKCDVYSFGVVLMELITGKRPVEAEFGDNKNIIYWVSNKVDTKEGATE  934

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK---  277
             ++D  + + FKE+ I+VLRIA+ CT   P+ RP+M++VVQ+L +A+PC+  S   S    
Sbjct  935   VLDKRLSDSFKEEMIQVLRIAVRCTYKAPSLRPSMKKVVQLLIEADPCRFDSCKSSTKTK  994

Query  276   ---DAAKLDNP  253
                +  K+ NP
Sbjct  995   EAPNVTKVKNP  1005


 Score = 73.2 bits (178),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD   +P++ADFG+AK+LQ  +    TT VI GT+GY+AP
Sbjct  825  PIIHRDIKSTNILLDVNNQPKVADFGIAKVLQARAGKDSTTTVIAGTYGYLAP  877



>ref|XP_002521777.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF40587.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=919

 Score =   129 bits (324),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYSFGVVL+ELV+G++PIE  YGE+ DIV WV T L  +E+++ 
Sbjct  800  IAPEMAYTLKVTEKSDVYSFGVVLLELVTGRRPIEEAYGESKDIVYWVWTHLNDRENVIK  859

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +  E  + D IKVL+IAILCT  LPN RP MR VV+ML DA+P   VS
Sbjct  860  VLDHEVASESLQGDMIKVLKIAILCTTKLPNLRPNMREVVKMLVDADPYITVS  912


 Score = 75.5 bits (184),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KSSNILLDE ++P+IADFG+AK+++ +    D++ V  GTHGYIAP
Sbjct  748  CSPPIIHRDIKSSNILLDEDYEPKIADFGVAKLVEVSYKGCDSSSV-AGTHGYIAP  802



>ref|XP_009335487.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=987

 Score =   169 bits (429),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -3

Query  636  PIKLVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES  457
            P  +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWVS+ L S++S
Sbjct  850  PGYIAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVSSMLGSRDS  909

Query  456  ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVS  280
            ILSMVDS I E  KE+ IKVLRIAILCTA +P  RP+MR VVQMLE+A E  +L+ I++S
Sbjct  910  ILSMVDSYIPEVNKEEVIKVLRIAILCTARVPELRPSMRSVVQMLEEAHETFQLLKIVIS  969

Query  279  KDAAKLD  259
            KD+A  D
Sbjct  970  KDSAAAD  976


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 4/66 (6%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHF  714
            +R ++HRDVKSSNILLDEF KP+IADFGLAKI+Q +++ KD+THVI GT GYIAP    +
Sbjct  802  ERLVMHRDVKSSNILLDEFLKPKIADFGLAKIVQ-DTADKDSTHVIAGTPGYIAP---EY  857

Query  713  KFYYKL  696
             + YK+
Sbjct  858  GYTYKV  863



>ref|XP_010943241.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Elaeis 
guineensis]
Length=968

 Score =   129 bits (323),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMELV+GKKP E E+GEN DI+ WVS+K+ +KE  + 
Sbjct  842  LAPEYAYSTKATTKCDVYSFGVVLMELVTGKKPNEPEFGENQDIIHWVSSKMGTKEGAMD  901

Query  447  MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
             +D  +   PFKED I++LRIA+ CT   P  RP+M  VVQ+L + +P K 
Sbjct  902  AIDKKLSWSPFKEDMIQILRIALRCTCRSPALRPSMNEVVQLLNEVDPSKF  952


 Score = 75.1 bits (183),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PI+HRD+K+SNILLDE F+P++ADFG+AK+LQ     + +  VI GT+GY+AP
Sbjct  792  PIVHRDIKTSNILLDEDFEPKVADFGIAKVLQARGDRESSASVIIGTYGYLAP  844



>ref|XP_002442601.1| hypothetical protein SORBIDRAFT_08g022780 [Sorghum bicolor]
 gb|EES16439.1| hypothetical protein SORBIDRAFT_08g022780 [Sorghum bicolor]
Length=1002

 Score =   123 bits (309),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 59/108 (55%), Positives = 82/108 (76%), Gaps = 6/108 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPI-----EAEYGENNDIVSWVSTKLKSK  463
            +  EY YT KV EKSDVYSFGVVL+ELV+G+  +     E E GE+ D+V WVS +L+S+
Sbjct  875  MAPEYAYTWKVTEKSDVYSFGVVLLELVTGRPAVVVVQGEGEGGESRDLVDWVSRRLESR  934

Query  462  ESILSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQML  322
            E ++S+VD AI E + +E+A++VLR+A+LCT+  P+ RP+MR VVQML
Sbjct  935  EKVMSLVDPAIVEGWAREEAVRVLRVAVLCTSRTPSMRPSMRSVVQML  982


 Score = 80.9 bits (198),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            CDRPI+HRDVKSSNILLDE FKPR+ADFGLAKIL    +   +  V+ GT GY+AP
Sbjct  824  CDRPILHRDVKSSNILLDECFKPRLADFGLAKIL--GGAGDSSAGVVAGTLGYMAP  877



>ref|XP_003522732.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
Length=983

 Score =   169 bits (429),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 81/121 (67%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN DIVSWV  K +SKE + S
Sbjct  855  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIEPEFGENKDIVSWVHNKARSKEGLRS  914

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             VDS I E + E+  KVLR A+LCT  LP  RPTMR VVQ LEDAEPCKLV I++SKD +
Sbjct  915  AVDSRIPEMYTEETCKVLRTAVLCTGTLPALRPTMRAVVQKLEDAEPCKLVGIVISKDGS  974

Query  267  K  265
            +
Sbjct  975  E  975


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAK++Q N     +T VI GTHGYIAP    
Sbjct  802  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKLVQANVGKDSSTRVIAGTHGYIAP---E  858

Query  716  FKFYYKL  696
            + + YK+
Sbjct  859  YGYTYKV  865



>ref|XP_009335485.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=964

 Score =   134 bits (338),  Expect(2) = 3e-43, Method: Composition-based stats.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EAE+G+N +I+ WVS K+ +KE  + 
Sbjct  831  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEAEFGDNKNIIYWVSNKVDTKEGAME  890

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK---  277
            ++D  + + F+E+ I+VLRIA+ CT   P+ RP+M+ VVQ+L +A+PC+ VS   S    
Sbjct  891  VLDKQLLDSFQEEMIQVLRIAVRCTCKAPSLRPSMKEVVQLLIEADPCRFVSCKSSTKTK  950

Query  276  ---DAAKLDNP  253
               +  K+ NP
Sbjct  951  EAPNVTKVKNP  961


 Score = 68.9 bits (167),  Expect(2) = 3e-43, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD   + ++ADFG+AK+LQ +     TT VI GT+GY+AP
Sbjct  781  PIIHRDIKSTNILLDVNNQAKVADFGIAKVLQASGGKDSTTTVIAGTYGYLAP  833



>gb|KJB60054.1| hypothetical protein B456_009G287800 [Gossypium raimondii]
 gb|KJB60055.1| hypothetical protein B456_009G287800 [Gossypium raimondii]
Length=977

 Score =   135 bits (340),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYSFGVVL+ELV+GK  IE EYGE  DIV WV T L   E+++ 
Sbjct  852  IAPELAYTLKVTEKSDVYSFGVVLLELVTGKASIEEEYGEGKDIVYWVLTHLGDGENVVK  911

Query  447  MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            ++D  +  E  ++D IKVL+I ILC A LPN RPTMR VV ML DAEPC  +S  +  D
Sbjct  912  VLDDRVDVETVQDDMIKVLKIGILCAAKLPNLRPTMREVVNMLMDAEPCTAISADIKSD  970


 Score = 67.8 bits (164),  Expect(2) = 4e-43, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS NILLD+ ++P+IADFG+AKI + +    + +    GTHGYIAP
Sbjct  800  CSPPIIHRDIKSCNILLDDDYEPKIADFGVAKIAEKSLEGSEYSS-FAGTHGYIAP  854



>ref|XP_010489950.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=987

 Score =   125 bits (313),  Expect(2) = 5e-43, Method: Composition-based stats.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESI  454
            +  EY YT+ V EKSDVYSFGVVL+ELV+GKKP+E E+GEN+DIV WV   +K  ++E +
Sbjct  862  IAPEYAYTRSVSEKSDVYSFGVVLLELVTGKKPVEIEFGENSDIVMWVWRMSKEMNREMM  921

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE  310
              ++D +I+  +KEDA+KVL IA+LCT   P +RP M+ VV MLE  E
Sbjct  922  TELIDPSIEVEYKEDALKVLTIALLCTNKSPQARPFMKSVVSMLEKIE  969


 Score = 78.2 bits (191),  Expect(2) = 5e-43, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            D+P+IHRDVKSSNILLDE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAP
Sbjct  809  DQPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQPDSVQQDFSAPLVKGTLGYIAP  864



>ref|XP_010468302.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=985

 Score =   127 bits (319),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLK--SKESI  454
            +  EY YT+ V EKSDVYSFGVVL+ELV+GKKP+E E+GEN+DIV WV  K K  ++E +
Sbjct  860  IAPEYAYTRNVNEKSDVYSFGVVLLELVTGKKPVEIEFGENSDIVMWVRRKSKKMNREMM  919

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE  310
            + ++D +I+  +KEDA+KVL IA++CT   P++RP M+ VV MLE  E
Sbjct  920  MELMDPSIEVEYKEDALKVLTIALICTDKSPHARPFMKSVVSMLEKIE  967


 Score = 75.5 bits (184),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE ++PRIADFGLAK +Q +   +D +  ++ GT GYIAP
Sbjct  807  DRPVIHRDVKSSNILLDEEWRPRIADFGLAKFIQPDLVQQDFSAPLVKGTLGYIAP  862



>emb|CDY42201.1| BnaA01g25940D [Brassica napus]
Length=921

 Score =   123 bits (308),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 2/105 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTK--LKSKESI  454
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP+E E+GEN DIVSWV ++     KE +
Sbjct  790  IAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPMEVEFGENRDIVSWVLSRSKEMEKEKM  849

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE  319
            + ++D  I+  +KEDA+KVL IA+LCT   P  RP M+ VV+MLE
Sbjct  850  MELIDPVIEYEYKEDALKVLTIALLCTGKSPQVRPFMKSVVRMLE  894


 Score = 79.7 bits (195),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            D+P+IHRDVKSSNILLDE ++PRIADFGL+KI+Q +S  +D ++ ++ GT GYIAP
Sbjct  737  DQPVIHRDVKSSNILLDEEWRPRIADFGLSKIIQSDSVQRDVSSSIVEGTLGYIAP  792



>ref|XP_012079733.1| PREDICTED: receptor-like protein kinase HSL1 [Jatropha curcas]
 gb|KDP31632.1| hypothetical protein JCGZ_14857 [Jatropha curcas]
Length=971

 Score =   130 bits (328),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK+DVYS GVVL+ELV+G++ IE  YGE  DIV WV T L +++++L 
Sbjct  846  IAPEMAYTLKVTEKNDVYSLGVVLLELVTGRRAIEDAYGEGKDIVYWVWTHLNNRKNVLK  905

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  I  E  +ED IKVL+IAILCT  LPN RPTMR VV+ML DA+PC   S
Sbjct  906  VLDEKISSESVQEDMIKVLKIAILCTTKLPNLRPTMREVVKMLVDADPCSFRS  958


 Score = 72.0 bits (175),  Expect(2) = 6e-43, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KSSNILLDE ++P+IADFG+AK+ + +SS    +  + GTHGYIAP
Sbjct  793  CCPPIIHRDIKSSNILLDEDYEPKIADFGVAKLAKMSSSKSCDSSCLAGTHGYIAP  848



>ref|XP_010420074.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=988

 Score =   122 bits (305),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESI  454
            +  EY YT+ V EKSDV+SFGVVL+ELV+GKKP+E E+GEN DIV WV   +K  ++E +
Sbjct  863  IAPEYAYTRSVSEKSDVFSFGVVLLELVTGKKPVEIEFGENIDIVMWVWRMSKEMNREMM  922

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE  310
              ++D +I+  +KEDA+KVL IA+LCT   P +RP M+ VV MLE  E
Sbjct  923  AELIDPSIEVEYKEDALKVLTIALLCTNKSPQARPFMKSVVSMLEKIE  970


 Score = 80.5 bits (197),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            DRP+IHRDVKSSNILLDE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAP
Sbjct  810  DRPVIHRDVKSSNILLDEKWRPRIADFGLAKIIQPDSVQRDFSAPLVKGTLGYIAP  865



>ref|XP_004148401.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis sativus]
 ref|XP_011649711.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis sativus]
 gb|KGN62784.1| hypothetical protein Csa_2G372790 [Cucumis sativus]
Length=942

 Score =   132 bits (331),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKPIE EYGEN +IV WVS K+ +KE +L 
Sbjct  814  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPIETEYGENKNIVFWVSNKVDTKEGVLE  873

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D+ ++  FK+D IK LRIAI CT   P  RP +  VVQ+L++ +PCK 
Sbjct  874  ILDNKLKGLFKDDIIKALRIAIRCTYKNPVLRPAIGEVVQLLQEVDPCKF  923


 Score = 70.5 bits (171),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 45/54 (83%), Gaps = 4/54 (7%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAP  729
            P+IHRD+K++NILLD  ++P++ADFG+AK+LQ     KD+T+ VI GT+GY+AP
Sbjct  766  PVIHRDIKTTNILLDANYQPKVADFGIAKVLQ---GTKDSTNSVIAGTYGYLAP  816



>ref|XP_009111593.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=970

 Score =   122 bits (307),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 2/105 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTK--LKSKESI  454
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP E E+GEN DIVSWV ++     KE +
Sbjct  839  IAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPTEVEFGENRDIVSWVLSRSKEMEKEKM  898

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE  319
            + ++D  I+  +KEDA+KVL IA+LCT   P  RP M+ VV+MLE
Sbjct  899  MELIDPVIEYEYKEDALKVLTIALLCTGKSPQVRPFMKSVVRMLE  943


 Score = 79.7 bits (195),  Expect(2) = 8e-43, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            D+P+IHRDVKSSNILLDE ++PRIADFGL+KI+Q +S  +D ++ ++ GT GYIAP
Sbjct  786  DQPVIHRDVKSSNILLDEEWRPRIADFGLSKIIQSDSVQRDVSSSIVEGTLGYIAP  841



>emb|CDX95422.1| BnaC01g33140D [Brassica napus]
Length=970

 Score =   122 bits (305),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 2/105 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTK--LKSKESI  454
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP+E E+GEN DIVSWV ++     KE +
Sbjct  839  IAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPMEVEFGENRDIVSWVLSRSKEMEKEKM  898

Query  453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE  319
            + ++D  I+  +KEDA+KVL I +LCT   P  RP M+ VV+MLE
Sbjct  899  MELIDPVIEYEYKEDALKVLTIGLLCTGKSPQVRPFMKSVVRMLE  943


 Score = 80.1 bits (196),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -1

Query  893  DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            D+P+IHRDVKSSNILLDE ++PRIADFGLAKI+Q +S  +D ++ ++ GT GYIAP
Sbjct  786  DQPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQPDSVQRDVSSSIVEGTLGYIAP  841



>ref|XP_010943249.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Elaeis 
guineensis]
Length=894

 Score =   127 bits (318),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMELV+GKKP E E+GEN DI+ WVS+K+ +KE  + 
Sbjct  768  LAPEYAYSTKATTKCDVYSFGVVLMELVTGKKPNEPEFGENQDIIHWVSSKMGTKEGAMD  827

Query  447  MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
             +D  +   PFKED I++LRIA+ CT   P  RP+M  VVQ+L + +P K 
Sbjct  828  AIDKKLSWSPFKEDMIQILRIALRCTCRSPALRPSMNEVVQLLNEVDPSKF  878


 Score = 75.1 bits (183),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PI+HRD+K+SNILLDE F+P++ADFG+AK+LQ     + +  VI GT+GY+AP
Sbjct  718  PIVHRDIKTSNILLDEDFEPKVADFGIAKVLQARGDRESSASVIIGTYGYLAP  770



>gb|EAZ21323.1| hypothetical protein OsJ_36977 [Oryza sativa Japonica Group]
Length=1006

 Score =   114 bits (286),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVL+ELV+G+  I AEYGE  DIV WV  +L S++ ++S
Sbjct  883  MAPEYSYTWKVTEKSDVYSFGVVLLELVTGRTAIMAEYGEGRDIVEWVFRRLDSRDKVMS  942

Query  447  MVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++D++I E + KE+A++VLR+A++CT+  P+ RP+MR VVQMLE A   +  +++ S
Sbjct  943  LLDASIGEEWEKEEAVRVLRVAVVCTSRTPSMRPSMRSVVQMLEAAAIGREFAVVTS  999


 Score = 87.4 bits (215),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAP  729
            CDRPI+HRDVKSSNILLDE FKPRIADFGLAKIL   ++  DTT   V+ GT GY+AP
Sbjct  828  CDRPILHRDVKSSNILLDESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAP  885



>ref|XP_011096686.1| PREDICTED: receptor-like protein kinase HAIKU2 [Sesamum indicum]
Length=989

 Score =   135 bits (339),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y+ KV EKSDVYSFGVVL+ELV+GKKPIE +YGE  D+V WVST L ++E++  
Sbjct  865  IAPEMAYSIKVTEKSDVYSFGVVLLELVTGKKPIEEDYGEGKDLVYWVSTHLNNRENVQK  924

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +  E  ++D IKVL+IA LCT+ LPN RP+M+ VV+ML DAEPC   S
Sbjct  925  ILDHKVATELVQDDMIKVLKIATLCTSKLPNLRPSMKEVVKMLIDAEPCSFRS  977


 Score = 67.0 bits (162),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE ++ +IADFG+AK+    S          GTHGYIAP
Sbjct  812  CCPPIIHRDIKSTNILLDEDYEAKIADFGVAKVADQVSPGGSELSCFAGTHGYIAP  867



>ref|XP_003526517.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=963

 Score =   127 bits (318),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL-  451
            L  E+ Y+ +   K DVYSFGV+LMEL++GKKP+EAE+GEN +IV WVS K++ KE    
Sbjct  830  LAPEFAYSSRATTKCDVYSFGVILMELLTGKKPVEAEFGENRNIVFWVSNKVEGKEGARP  889

Query  450  -SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSI  289
              ++D  +   FKED +KVLRIAI CT   P SRPTM+ VVQ+L +AEP     CKL + 
Sbjct  890  SEVLDPKLSCSFKEDMVKVLRIAIRCTYKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTK  949

Query  288  IVS  280
             VS
Sbjct  950  DVS  952


 Score = 74.7 bits (182),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  780  PIIHRDIKSTNILLDVDYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  832



>ref|XP_008444976.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=944

 Score =   133 bits (334),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKPIE EYGEN +IV WVS K+ +KE +L 
Sbjct  814  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPIETEYGENKNIVFWVSNKVDTKEGVLE  873

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
            ++D+ ++  F++D IK LRIAI CT   P  RP M  VVQ+L++ +PCK 
Sbjct  874  ILDNKLKGLFRDDIIKALRIAIRCTYKNPVLRPAMGEVVQLLQEVDPCKF  923


 Score = 68.2 bits (165),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 4/54 (7%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAP  729
            P+IHRD+K++NILLD   +P++ADFG+AK+LQ     KD+T+ VI GT+GY+AP
Sbjct  766  PVIHRDIKTTNILLDANCQPKVADFGIAKVLQ---GTKDSTNSVIAGTYGYLAP  816



>ref|XP_006852742.1| PREDICTED: receptor-like protein kinase HAIKU2 [Amborella trichopoda]
 gb|ERN14209.1| hypothetical protein AMTR_s00033p00105380 [Amborella trichopoda]
Length=960

 Score =   129 bits (323),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYS+GV+LMEL++GKKP+EAE+GEN +IV W+S K+ +KE    
Sbjct  835  LAPEYAYSSKATTKCDVYSYGVLLMELITGKKPVEAEFGENKNIVYWISKKVATKEGTKD  894

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D  + E F +D +K LRI++LCT  +P  RP M  VVQML +A+P +  +   S +A 
Sbjct  895  VLDKQLAELFTDDMVKALRISVLCTNNMPAYRPKMNEVVQMLIEADPARGFNAFKS-EAI  953

Query  267  KLDNPSD  247
            K+ +PS+
Sbjct  954  KVKSPSE  960


 Score = 72.4 bits (176),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  F+P++ADFG+AK+LQ   S    TT  I GT+GY+AP
Sbjct  784  PIIHRDIKSTNILLDADFQPKVADFGVAKVLQSRGSGDSITTTAIAGTYGYLAP  837



>ref|XP_008787759.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=952

 Score =   125 bits (315),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMELV+GKKP E E+GEN DI+ WVS+K+ +KE  + 
Sbjct  826  LAPEYAYSTKATTKCDVYSFGVVLMELVTGKKPNEPEFGENQDIIHWVSSKMGTKERAMD  885

Query  447  MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL  298
             +D  +   PFKE+ I+VLRIA+ CT   P  RP+M  VVQ+L + +P K 
Sbjct  886  AIDKQLSWSPFKEEMIQVLRIALRCTLRTPALRPSMNEVVQLLLEVDPSKF  936


 Score = 75.5 bits (184),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PI+HRD+K+SNILLDE F+P++ADFG+AK+LQ     + +  VI GT+GY+AP
Sbjct  776  PIVHRDIKTSNILLDEDFEPKVADFGVAKVLQARGDHESSATVITGTYGYLAP  828



>ref|XP_003526519.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
 gb|KHN09043.1| Receptor-like protein kinase HAIKU2 [Glycine soja]
Length=983

 Score =   167 bits (422),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+P E E+GEN DIVSWV  K +SKE + S
Sbjct  855  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPTEPEFGENKDIVSWVHNKARSKEGLRS  914

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             VDS I E + E+A KVLR A+LCT  LP  RPTMR VVQ LEDAEPCKLV I+++KD +
Sbjct  915  AVDSRIPEMYTEEACKVLRTAVLCTGTLPALRPTMRAVVQKLEDAEPCKLVGIVITKDDS  974

Query  267  K  265
            +
Sbjct  975  E  975


 Score = 98.6 bits (244),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C++P+IHRDVKSSNILLDEF KPRIADFGLAK++Q N     +THVI GTHGYIAP    
Sbjct  802  CEKPVIHRDVKSSNILLDEFLKPRIADFGLAKVIQANVVKDSSTHVIAGTHGYIAP---E  858

Query  716  FKFYYKL  696
            + + YK+
Sbjct  859  YGYTYKV  865



>ref|XP_008352752.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=963

 Score =   128 bits (322),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 61/131 (47%), Positives = 86/131 (66%), Gaps = 6/131 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EAE+G+N +I+ WVS K+ +KE    
Sbjct  830  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEAEFGDNKNIIYWVSNKVDTKEGATE  889

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK---  277
            ++D    + FKE+ I+VLRIA+ CT   P+ RP+M+  VQ+L +A+PC+  S   S    
Sbjct  890  VLDKRSSDSFKEEMIQVLRIAVRCTYKAPSLRPSMKEXVQLLIEADPCRFDSCKSSTKTK  949

Query  276  ---DAAKLDNP  253
               +  K+ NP
Sbjct  950  EAPNVTKVKNP  960


 Score = 72.4 bits (176),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD   +P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  780  PIIHRDIKSTNILLDVNNQPKVADFGIAKVLQARXGKDSTTTVIAGTYGYLAP  832



>ref|XP_007137285.1| hypothetical protein PHAVU_009G114400g [Phaseolus vulgaris]
 gb|ESW09279.1| hypothetical protein PHAVU_009G114400g [Phaseolus vulgaris]
Length=959

 Score =   125 bits (313),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL-  451
            L  E+ Y+ +   K DVYSFGV+LMEL++GKKP+EAE+GEN +IV WVS K++ KE    
Sbjct  826  LAPEFAYSSRATTKCDVYSFGVILMELLTGKKPVEAEFGENRNIVFWVSNKVEGKEGARP  885

Query  450  -SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSI  289
              + D  +   FK+D IKVLR+AI CT   P SRPTM+ VVQ+L +AEP     CKL + 
Sbjct  886  SEVFDPRLSCSFKDDMIKVLRVAIRCTYKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTK  945

Query  288  IVS  280
             VS
Sbjct  946  DVS  948


 Score = 75.5 bits (184),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++PR+ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  776  PIIHRDIKSTNILLDVDYQPRVADFGIAKVLQARGVKDSTTTVIAGTYGYLAP  828



>gb|KHN37211.1| Receptor-like protein kinase HSL1-like protein [Glycine soja]
Length=840

 Score =   125 bits (314),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 7/124 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL-  451
            L  E+ Y+ +   K DVYSFGV+LMEL++GKKP+EAE+GEN +IV WVS K++ KE    
Sbjct  707  LAPEFAYSSRATTKCDVYSFGVILMELLTGKKPVEAEFGENRNIVFWVSNKVEGKEGARP  766

Query  450  -SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSI  289
              ++D  +   FKED +KVLRIAI CT   P SRPTM+ VVQ+L +AEP     CKL + 
Sbjct  767  SEVLDPKLSCSFKEDMVKVLRIAIRCTYKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTK  826

Query  288  IVSK  277
             VS 
Sbjct  827  DVSN  830


 Score = 74.7 bits (182),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  657  PIIHRDIKSTNILLDVDYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  709



>ref|XP_002526416.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF35992.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=210

 Score =   127 bits (320),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYSFGVVL+ELV+G++PIE  YGE+ DIV WV T L  +E+++ 
Sbjct  91   IAPEMAYTLKVTEKSDVYSFGVVLLELVTGRRPIEEAYGESKDIVYWVWTHLNDRENVIK  150

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D  +  E  + D IKVL+IAILCT  LPN RP MR VV+ML DA+P
Sbjct  151  VLDHEVASESLQGDMIKVLKIAILCTTKLPNLRPNMREVVKMLVDADP  198


 Score = 72.8 bits (177),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KSSNILLDE ++P+IADFG+AK+++ +    D++ V  GTHGYIAP
Sbjct  39   CSPPIIHRDIKSSNILLDEDYEPKIADFGVAKLVEVSYKGCDSSSV-AGTHGYIAP  93



>ref|XP_007225361.1| hypothetical protein PRUPE_ppa000880mg [Prunus persica]
 gb|EMJ26560.1| hypothetical protein PRUPE_ppa000880mg [Prunus persica]
Length=972

 Score =   129 bits (324),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++PIE +YGE  DIV WVST L  +E+++ 
Sbjct  832  IAPELAYTPKVTEKCDVYSFGVVLLELVTGRRPIEEDYGEGKDIVYWVSTNLSDRENVVK  891

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D  +  E   +D IKVL++A+LCT  LP+ RPTMR V++ML DA+P
Sbjct  892  ILDDKVANESVLDDMIKVLKVAVLCTTKLPSLRPTMRDVIKMLTDADP  939


 Score = 70.9 bits (172),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLD  ++P++ADFG+AKI + +    D +  + GTHGYIAP
Sbjct  780  CSPPIIHRDIKSTNILLDNDYEPKVADFGVAKIAENSQKGSDYSS-LAGTHGYIAP  834



>ref|XP_010103492.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC46783.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=982

 Score =   133 bits (334),  Expect(2) = 4e-42, Method: Composition-based stats.
 Identities = 69/131 (53%), Positives = 88/131 (67%), Gaps = 10/131 (8%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++PIE EYGE  DIV WVST L + E ++ 
Sbjct  852  IAPELAYTLKVTEKCDVYSFGVVLLELVTGRRPIEDEYGEGKDIVYWVSTHLNNLEDVMK  911

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            ++D  +  E  ++D IKVL+IA+ CT  LP  RP+MR VV+ML DAEPC L S       
Sbjct  912  VLDCRVASEVLQDDMIKVLKIAVSCTKKLPTLRPSMREVVKMLVDAEPCTLKS-------  964

Query  270  AKLDNPSDNTS  238
               DN SD++S
Sbjct  965  --QDNNSDHSS  973


 Score = 67.0 bits (162),  Expect(2) = 4e-42, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLDE ++P++ADFG+AKI  +  S  D + V  GTHGYIAP
Sbjct  802  CLPAIIHRDIKSTNILLDEEYEPKVADFGVAKIAAHKGS--DFSSV-AGTHGYIAP  854



>ref|XP_004963298.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Setaria 
italica]
Length=987

 Score =   115 bits (289),  Expect(2) = 5e-42, Method: Composition-based stats.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 7/108 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKK---PIEAEYGENNDIVSWVSTKLKSKES  457
            +  EY YT KV EKSDVYSFGVVL+ELV+G+    P+E   G   D+V WVS +L+S+E 
Sbjct  863  MAPEYAYTWKVTEKSDVYSFGVVLLELVTGRPAMVPVEEGGG---DLVEWVSRRLESREK  919

Query  456  ILSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED  316
             +S+VD+ + E + +E+A++VLR+A+LCT+  P  RP+MR VVQMLED
Sbjct  920  AMSLVDARVTEGWAREEAVQVLRVAVLCTSRTPAMRPSMRSVVQMLED  967


 Score = 84.0 bits (206),  Expect(2) = 5e-42, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAP  729
            CDRPI+HRDVKSSNILLDE FKPR+ADFGLAKIL   S+  D++  V+ GT GY+AP
Sbjct  809  CDRPILHRDVKSSNILLDEAFKPRLADFGLAKILTAASARVDSSAGVVAGTLGYMAP  865



>ref|XP_007137286.1| hypothetical protein PHAVU_009G114500g [Phaseolus vulgaris]
 gb|ESW09280.1| hypothetical protein PHAVU_009G114500g [Phaseolus vulgaris]
Length=981

 Score =   166 bits (419),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 80/121 (66%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSDVYSFGVVLMELV+GK+PIE E+GEN D+VSWV  K +S E + S
Sbjct  852  IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKRPIETEFGENKDMVSWVHNKARSIEGLSS  911

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             VDS I E +KE+A KVLR A+LCT  LP  RPTMR VVQ LEDAEP KLV I++SKD +
Sbjct  912  AVDSRIPEMYKEEACKVLRTAVLCTGTLPALRPTMRAVVQKLEDAEPFKLVGIVISKDGS  971

Query  267  K  265
            +
Sbjct  972  E  972


 Score = 95.1 bits (235),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+RP+IHRDVKSSNILLDEF KPRIADFGLAK++Q N      T VI GTHGYIAP    
Sbjct  799  CERPVIHRDVKSSNILLDEFLKPRIADFGLAKVVQANVGKDSYTGVIAGTHGYIAP---E  855

Query  716  FKFYYKL  696
            + + YK+
Sbjct  856  YGYTYKV  862



>gb|EPS67674.1| hypothetical protein M569_07098, partial [Genlisea aurea]
Length=878

 Score =   126 bits (316),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY YT K   K DVYSFGVVLMELV+GKKP+E E+GEN DIV WVS+ L++KE  + 
Sbjct  772  LAPEYAYTSKATTKCDVYSFGVVLMELVTGKKPVETEFGENKDIVYWVSSNLETKEEAIK  831

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            +VD  +Q  + ++ I+VLR+A+LCT    ++RPTM  VV++L + +P
Sbjct  832  LVDKRVQSSYHDEMIEVLRLAMLCTCKAASTRPTMNDVVRLLLEGDP  878


 Score = 73.2 bits (178),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP  729
            PIIHRD+KS+N+LLD  + P++ADFG+AKI+Q   S +D TT  I GT+GY+AP
Sbjct  721  PIIHRDIKSTNVLLDLNYHPKVADFGIAKIMQCRESSRDSTTTAIAGTYGYLAP  774



>ref|XP_008218929.1| PREDICTED: receptor-like protein kinase HAIKU2 [Prunus mume]
Length=985

 Score =   130 bits (326),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++PIE +YGE  DIV WVST L  +E+++ 
Sbjct  854  IAPELAYTPKVTEKCDVYSFGVVLLELVTGRRPIEEDYGEGKDIVYWVSTNLSDRENVVK  913

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +  E  ++D IKVL++A+LCT  LP+ RPTMR +++ML DA+P    S
Sbjct  914  ILDDRVANESVQDDMIKVLKVAVLCTTKLPSLRPTMRDIIKMLTDADPSTFRS  966


 Score = 68.9 bits (167),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLD   +P++ADFG+AKI + +    D +  + GTHGYIAP
Sbjct  802  CSPPIIHRDIKSTNILLDNDHEPKVADFGVAKIAENSQKGSDYSS-LAGTHGYIAP  856



>ref|XP_004501072.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=966

 Score =   124 bits (310),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL-  451
            L  EY Y+ +   K DVYSFGV+LMEL++G+KPIE+E+GEN +IV WVS K++ KE    
Sbjct  831  LAPEYAYSSRATTKCDVYSFGVILMELLTGRKPIESEFGENRNIVFWVSNKVEGKEGARP  890

Query  450  -SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLV  295
              + D  +   FK+D +K+LRIAI CT   P SRPTM+ VVQ+L +AEP     CKL+
Sbjct  891  SEVFDPKLSCSFKDDMVKLLRIAIRCTYKAPASRPTMKEVVQLLIEAEPKSSDSCKLL  948


 Score = 75.5 bits (184),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLDE + P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  781  PIIHRDIKSTNILLDEDYHPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  833



>ref|XP_009362411.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=986

 Score =   135 bits (339),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 64/133 (48%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++PIE +YGE  DIV WVST L  +E+++ 
Sbjct  852  IAPELAYTAKVNEKCDVYSFGVVLLELVTGRRPIEEDYGEGKDIVYWVSTHLSDREAVVK  911

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            ++D  +  E  ++D IKVL++A+LCT  LP+ RPTMR V++ML DA+PC   S   + + 
Sbjct  912  ILDEKVADESVQDDMIKVLKVAVLCTTKLPSLRPTMREVIKMLADADPCSFRSGNNTGND  971

Query  270  AKLDNPSDNTSKM  232
             K+ + S +T ++
Sbjct  972  KKVKDFSPSTDEL  984


 Score = 63.9 bits (154),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLD+ ++ ++ADFG+AKI + +    D +    GTHGYIAP
Sbjct  800  CSPAIIHRDIKSTNILLDDDYEAKVADFGVAKIAENSQKGSDYSS-FAGTHGYIAP  854



>gb|KHG27129.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=977

 Score =   130 bits (328),  Expect(2) = 8e-42, Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYSFGVVL+ELV+GK  IE EYGE  DIV WV T L   E+++ 
Sbjct  852  IAPELAYTLKVTEKSDVYSFGVVLLELVTGKASIEEEYGEGKDIVYWVLTHLGDGENVVK  911

Query  447  MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            ++D  +  E  ++D IKVL+I ILC A LPN RPTMR VV ML DAE C  +S  +  D
Sbjct  912  VLDDRVAVETVQDDMIKVLKIGILCAAKLPNLRPTMREVVNMLMDAETCTSISADIKSD  970


 Score = 68.2 bits (165),  Expect(2) = 8e-42, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS NILLD+ ++P+IADFG+AKI + +    + +    GTHGYIAP
Sbjct  800  CSPPIIHRDIKSCNILLDDNYEPKIADFGVAKIAEKSLEGSEYSS-FAGTHGYIAP  854



>ref|XP_010268650.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=951

 Score =   129 bits (323),  Expect(2) = 9e-42, Method: Composition-based stats.
 Identities = 58/109 (53%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY Y+ K   K DVYSFGVVLMELV+GK+PIEAE+GEN +I+ WVS+K+++K+  + 
Sbjct  825  MAPEYAYSSKATVKCDVYSFGVVLMELVTGKQPIEAEFGENKNIIYWVSSKVETKQGAVE  884

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCK  301
            ++D  +   FKE+ I+VLRI+I CT   P+ RPTM  VVQ+L +A+PC+
Sbjct  885  VLDKRLLGLFKEEMIQVLRISIRCTCKAPSLRPTMNEVVQLLVEADPCR  933


 Score = 69.7 bits (169),  Expect(2) = 9e-42, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PI+HRD+KS+NILL+  ++P++ADFG+AK+L    S   +T VI GT+GY+AP
Sbjct  775  PIVHRDIKSTNILLNADYQPKVADFGVAKVLLARGSKDSSTTVIAGTYGYMAP  827



>ref|XP_004299841.2| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=1022

 Score =   165 bits (417),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 79/121 (65%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV EKSDVYSFGVVLMELV+GKKPI+  +G+N DIV+W+   LK +ES+L 
Sbjct  890   IAPEYGYTYKVNEKSDVYSFGVVLMELVTGKKPIDPSFGDNKDIVNWICDNLKCRESVLG  949

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDA  271
             +VDS I E ++E+AIKVLRIAILCTA LP  RP+MR VVQMLE+A EP KL+ I++SKD 
Sbjct  950   VVDSYIPEAYREEAIKVLRIAILCTARLPELRPSMRSVVQMLEEAHEPMKLLGIVISKDG  1009

Query  270   A  268
             +
Sbjct  1010  S  1010


 Score = 95.5 bits (236),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH  717
            C+R +IHRDVKSSNILLDEF KPRIADFGLAKI+Q N    D+THV+ GTHGYIAP    
Sbjct  838  CERLVIHRDVKSSNILLDEFLKPRIADFGLAKIVQTN-GINDSTHVVAGTHGYIAP---E  893

Query  716  FKFYYKL  696
            + + YK+
Sbjct  894  YGYTYKV  900



>ref|XP_003523762.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=966

 Score =   126 bits (316),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL-  451
            L  E+ Y+ +   K DVYS+GV+LMEL++GKKP+EAE+GEN +IV WVS K++ KE    
Sbjct  833  LAPEFAYSSRATTKCDVYSYGVILMELLTGKKPVEAEFGENRNIVFWVSNKVEGKEGARP  892

Query  450  -SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSI  289
              ++D  +   FKED IKVLRIAI CT   P SRPTM+ VVQ+L +AEP     CKL + 
Sbjct  893  SEVLDPKLSCSFKEDMIKVLRIAIRCTYKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTN  952

Query  288  IVS  280
             VS
Sbjct  953  DVS  955


 Score = 72.0 bits (175),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD   +P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  783  PIIHRDIKSTNILLDVDNQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  835



>ref|XP_004309904.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=982

 Score =   130 bits (326),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+GK+PIE +YGE  DIV W S  L  +E +L 
Sbjct  852  IAPELAYTAKVTEKCDVYSFGVVLLELVTGKRPIEDDYGEGKDIVYWASANLNDREHVLK  911

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +  E  ++D IKVL++AILCT  LP+ RPTMR V++ML DA+P    S
Sbjct  912  VLDDKVADENIQDDMIKVLKVAILCTTKLPSLRPTMREVIKMLTDADPSTFTS  964


 Score = 68.2 bits (165),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLD+ ++ ++ADFG+AKI+Q N+          GTHGYIAP
Sbjct  800  CSPPIIHRDIKSTNILLDDDYEAKVADFGVAKIVQ-NTHKGSEYSSFAGTHGYIAP  854



>gb|KFK40815.1| hypothetical protein AALP_AA2G044900 [Arabis alpina]
Length=959

 Score =   124 bits (312),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP++A +GEN +IV+WVSTK+ +KE ++ 
Sbjct  825  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDACFGENKNIVNWVSTKIDTKEGLIE  884

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + E  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  885  TLDKRLTESSKADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  931


 Score = 73.6 bits (179),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ  S    TT VI GT+GY+AP
Sbjct  776  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARSK-DSTTTVIAGTYGYLAP  827



>ref|XP_008361619.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score =   134 bits (336),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++PIE +YGE  DIV WVST L  +E+++ 
Sbjct  852  IAPELAYTAKVNEKCDVYSFGVVLLELVTGRRPIEEDYGEGKDIVYWVSTHLSDREAVVK  911

Query  447  MVDSAIQE-PFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            ++D  + +   ++D IKVL++A+LCT  LP+ RPTMR V++ML DA+PC   S   + + 
Sbjct  912  ILDEKVADVSVQDDMIKVLKVAVLCTTKLPSLRPTMREVIKMLADADPCSFRSGNNTGND  971

Query  270  AKLDNPSDNTSKM  232
             K+ + S  T ++
Sbjct  972  KKVKDVSPGTDEL  984


 Score = 63.9 bits (154),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLD+ ++ ++ADFG+AKI + +    D +    GTHGYIAP
Sbjct  800  CSPAIIHRDIKSTNILLDDDYEAKVADFGVAKIAENSQKGSDYSS-FAGTHGYIAP  854



>ref|XP_008339164.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score =   134 bits (336),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++PIE +YGE  DIV WVST L  +E+++ 
Sbjct  852  IAPELAYTAKVNEKCDVYSFGVVLLELVTGRRPIEEDYGEGKDIVYWVSTHLSDREAVVK  911

Query  447  MVDSAIQE-PFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            ++D  + +   ++D IKVL++A+LCT  LP+ RPTMR V++ML DA+PC   S   + + 
Sbjct  912  ILDEKVADVSVQDDMIKVLKVAVLCTTKLPSLRPTMREVIKMLADADPCSFRSGNNTGND  971

Query  270  AKLDNPSDNTSKM  232
             K+ + S  T ++
Sbjct  972  KKVKDVSPGTDEL  984


 Score = 63.9 bits (154),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLD+ ++ ++ADFG+AKI + +    D +    GTHGYIAP
Sbjct  800  CSPAIIHRDIKSTNILLDDDYEAKVADFGVAKIAENSQKGSDYSS-FAGTHGYIAP  854



>ref|XP_007131311.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
 ref|XP_007131312.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
 gb|ESW03305.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
 gb|ESW03306.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
Length=974

 Score =   132 bits (333),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y   + EKSDVYSFGVVL+ELVSG++PIE +YGE  DIV WV T L  +ESIL+
Sbjct  850  IAPELAYATDITEKSDVYSFGVVLLELVSGREPIEEDYGEAKDIVYWVLTHLNDRESILN  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +     ED IK+L+I I CT  LP+ RPTMR VV+ML DAEPC L S
Sbjct  910  ILDERVASECVEDMIKMLKIGIKCTTKLPSVRPTMREVVKMLIDAEPCALKS  961


 Score = 65.1 bits (157),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 11/61 (18%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL-----QYNSSCKDTTHVIPGTHGYIA  732
            C+ P+IHRD+KSSNILLDE ++P+IADFG+A+       Q   SC      + GT GYIA
Sbjct  798  CNPPVIHRDIKSSNILLDEDYEPKIADFGIARFAEKSDKQLGYSC------LAGTLGYIA  851

Query  731  P  729
            P
Sbjct  852  P  852



>gb|KHN08203.1| Receptor-like protein kinase HSL1-like protein [Glycine soja]
Length=840

 Score =   125 bits (313),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 7/124 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL-  451
            L  E+ Y+ +   K DVYS+GV+LMEL++GKKP+EAE+GEN +IV WVS K++ KE    
Sbjct  707  LAPEFAYSSRATTKCDVYSYGVILMELLTGKKPVEAEFGENRNIVFWVSNKVEGKEGARP  766

Query  450  -SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSI  289
              ++D  +   FKED IKVLRIAI CT   P SRPTM+ VVQ+L +AEP     CKL + 
Sbjct  767  SEVLDPKLSCSFKEDMIKVLRIAIRCTYKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTN  826

Query  288  IVSK  277
             VS 
Sbjct  827  DVSN  830


 Score = 72.4 bits (176),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD   +P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  657  PIIHRDIKSTNILLDVDNQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  709



>ref|XP_008378674.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=964

 Score =   128 bits (322),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 6/131 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GK+P+EAE+G+N +I+ WVS K+ +KE  + 
Sbjct  831  LAPEYAYSSKATTKCDVYSFGVVLMELITGKRPVEAEFGDNKNIIYWVSNKVDTKEGAME  890

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK---  277
            ++D  + +  +E+ I+VLRIA+ CT   P+ RP+M+ VVQ+L +A+PC+  S   S    
Sbjct  891  VLDKRLSDSXQEEMIQVLRIAVXCTYKAPSLRPSMKEVVQLLIEADPCRFDSCKSSTKTK  950

Query  276  ---DAAKLDNP  253
               +  K+ NP
Sbjct  951  EAPNVTKVKNP  961


 Score = 68.9 bits (167),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD   + ++ADFG+AK+LQ +     TT VI GT+GY+AP
Sbjct  781  PIIHRDIKSTNILLDVNNQAKVADFGIAKVLQASGGKDSTTTVIAGTYGYLAP  833



>ref|XP_008456679.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
 ref|XP_008456680.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=976

 Score =   127 bits (318),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYS+GVVL+EL++G++PIE EYGE  DIV W+ST L  +++ L 
Sbjct  850  IAPELAYTPKVSEKSDVYSYGVVLLELITGRRPIEDEYGEGKDIVYWISTHLDDRDNALK  909

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D  +  E  + D IKVL+IA+LCT  LP+ RP+MR VV+ML DA+P
Sbjct  910  LLDIRVASEAIQNDMIKVLKIAVLCTTKLPSLRPSMREVVKMLSDADP  957


 Score = 70.5 bits (171),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 3/57 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL-QYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLD  ++P+IADFG+AK+  Q+ S+ + ++  + GTHGYIAP
Sbjct  798  CSPPIIHRDIKSTNILLDGDYEPKIADFGVAKVADQFQSASEHSS--LAGTHGYIAP  852



>ref|XP_004140933.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis sativus]
 ref|XP_011656604.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis sativus]
 gb|KGN46082.1| hypothetical protein Csa_6G052080 [Cucumis sativus]
Length=976

 Score =   127 bits (318),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYS+GVVL+EL++G++PIE EYGE  DIV W+ST L  ++  L 
Sbjct  850  IAPELAYTPKVSEKSDVYSYGVVLLELITGRRPIEDEYGEGKDIVYWISTHLDDRDHALK  909

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D  +  E  + D IKVL+IA+LCT  LP+ RP+MR VV+ML DA+P
Sbjct  910  LLDIRVASEAIQNDMIKVLKIAVLCTTKLPSLRPSMREVVKMLSDADP  957


 Score = 70.5 bits (171),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 3/57 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL-QYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLD  ++P+IADFG+AK+  Q+ S+ + ++  + GTHGYIAP
Sbjct  798  CSPPIIHRDIKSTNILLDGDYEPKIADFGVAKVADQFQSASEHSS--LAGTHGYIAP  852



>gb|KEH36108.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=965

 Score =   120 bits (300),  Expect(2) = 4e-41, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 84/125 (67%), Gaps = 7/125 (6%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL-  451
            L  EY Y+ +   K DVYSFGV+L+EL++G+KPIE+E+GEN +IV WV+ K++ KE    
Sbjct  831  LAPEYAYSPRATTKCDVYSFGVILLELLTGRKPIESEFGENRNIVFWVANKVEGKEGARP  890

Query  450  -SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSI  289
              + D  +   FK+D +KVLRIAI C+   P SRPTM+ VVQ+L +AEP     CKL + 
Sbjct  891  SEVFDPKLSCSFKDDMVKVLRIAIRCSYKAPASRPTMKEVVQLLIEAEPRKSDSCKLSTK  950

Query  288  IVSKD  274
             VS +
Sbjct  951  DVSTN  955


 Score = 76.6 bits (187),  Expect(2) = 4e-41, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLDE + P++ADFG+AK+LQ   +   TT VI GT+GY+AP
Sbjct  781  PIIHRDIKSTNILLDEDYHPKVADFGIAKVLQARGAKDSTTTVIAGTYGYLAP  833



>ref|XP_002301126.1| hypothetical protein POPTR_0002s11230g [Populus trichocarpa]
 gb|EEE80399.1| hypothetical protein POPTR_0002s11230g [Populus trichocarpa]
Length=925

 Score =   120 bits (301),  Expect(2) = 4e-41, Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EA+YGE+ +I++ VSTK+ +KE ++ 
Sbjct  792  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEADYGESKNIINLVSTKVDTKEGVME  851

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA  313
            ++D  +   F+++ I+VLRIAI CT   P  RPTM  VVQ+L +A
Sbjct  852  VLDKRLSGSFRDEMIQVLRIAIRCTYKTPALRPTMNEVVQLLIEA  896


 Score = 76.3 bits (186),  Expect(2) = 4e-41, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  742  PIIHRDIKSTNILLDANYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  794



>ref|XP_006402253.1| hypothetical protein EUTSA_v10012576mg [Eutrema salsugineum]
 gb|ESQ43706.1| hypothetical protein EUTSA_v10012576mg [Eutrema salsugineum]
Length=976

 Score =   124 bits (310),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  833  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  892

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             VD  + E  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  893  TVDKRLSESSKADIINALRVAIRCTSRTPTIRPTMTEVVQLLIDAAP  939


 Score = 71.6 bits (174),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  784  PIIHRDIKSTNILLDINYQPKVADFGIAKVLQARGK-DSTTTVIAGTYGYLAP  835



>ref|XP_002865749.1| hypothetical protein ARALYDRAFT_495025 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42008.1| hypothetical protein ARALYDRAFT_495025 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   124 bits (312),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  830  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  889

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D ++ E  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  890  TLDKSLSESSKADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  936


 Score = 70.5 bits (171),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  781  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  832



>ref|XP_006591868.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=970

 Score =   133 bits (335),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y   + EKSDVYSFGVVL+ELVSG++PIE EYGE  DIV WV + L  +ESIL+
Sbjct  850  IAPELAYATDITEKSDVYSFGVVLLELVSGREPIEEEYGEAKDIVYWVLSNLNDRESILN  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +     ED IKVL+IAI CT  LP+ RPTMR VV+ML DAEPC   S
Sbjct  910  ILDERVTSESVEDMIKVLKIAIKCTTKLPSLRPTMREVVKMLIDAEPCAFKS  961


 Score = 61.6 bits (148),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 11/61 (18%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL-----QYNSSCKDTTHVIPGTHGYIA  732
            C+ P+IHRD+KSSNILLDE ++ +IADFG+A+       Q   SC      + GT GYIA
Sbjct  798  CNPPVIHRDIKSSNILLDEDYESKIADFGIARFAEKSDKQLGYSC------LAGTLGYIA  851

Query  731  P  729
            P
Sbjct  852  P  852



>ref|XP_006350342.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=957

 Score =   130 bits (326),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  E  YT +V EKSDVYSFGVVL+ELV+G+KPIE  YGE  D+V W ST L  K S+L+
Sbjct  850  LAPEIAYTSRVTEKSDVYSFGVVLLELVTGRKPIEETYGEGKDLVYWASTHLNDKGSVLN  909

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D   + E  ++D IKVLRI+ LCT  LPN RP+M+ VV ML DAEP
Sbjct  910  ILDQKVVSELIQDDMIKVLRISALCTTKLPNLRPSMKEVVNMLVDAEP  957


 Score = 65.1 bits (157),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE ++ +++DFG+AK+ + +S   + +    GTHGY+AP
Sbjct  798  CVPPIIHRDIKSTNILLDEEYEAKVSDFGVAKVSEISSRVSEFS-CFAGTHGYLAP  852



>ref|XP_009123552.1| PREDICTED: receptor-like protein kinase HSL1 [Brassica rapa]
Length=966

 Score =   123 bits (309),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 61/131 (47%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGV+LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  832  LAPEYAYSSKATTKCDVYSFGVMLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  891

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS----  280
             +D  + E  K D I  LR+AI CT+  P  RP+M  VVQ+L DA P + + +       
Sbjct  892  TLDKRLSESSKADMINALRVAIRCTSRTPTIRPSMNEVVQLLIDAAPQEGLDMASKSRTK  951

Query  279  -KDAAKLDNPS  250
             KDA   DNP+
Sbjct  952  IKDAILSDNPT  962


 Score = 71.6 bits (174),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  783  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVIAGTYGYLAP  834



>ref|XP_006858563.2| PREDICTED: receptor-like protein kinase HAIKU2 [Amborella trichopoda]
Length=1781

 Score =   134 bits (336),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 62/130 (48%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  E  Y+ K  EKSDVYSFGV+L+ELV+GK+P+E E+ E  DIV WV + L ++E+  S
Sbjct  881   IAPELAYSMKATEKSDVYSFGVILLELVTGKRPLEPEFQEGKDIVDWVCSHLATRETACS  940

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             ++D+ + + ++ED +KVL++A LCT  LP  RP+MR VV+ML DAEPC  VS I  K + 
Sbjct  941   ILDTRVSDYYEEDMLKVLKMATLCTTKLPTLRPSMREVVKMLVDAEPC--VSGIKDKLSE  998

Query  267   KLDNPSDNTS  238
             + D  S+ ++
Sbjct  999   RFDCESEAST  1008


 Score = 61.2 bits (147),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KSSN+LLDE  + +I DFG+A+++   S   + +    GTHGYIAP
Sbjct  831  CSPAIIHRDIKSSNVLLDEALEAKIGDFGIARVV---SEGGEASSGFVGTHGYIAP  883



>ref|NP_001241340.1| receptor-like protein kinase HSL1-like [Glycine max]
 gb|ACM89538.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN32461.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=955

 Score =   133 bits (334),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y   + EKSDVYSFGVVL+ELVSG++PIE EYGE  DIV WV + L  +ESIL+
Sbjct  835  IAPELAYATDITEKSDVYSFGVVLLELVSGREPIEEEYGEAKDIVYWVLSNLNDRESILN  894

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +     ED IKVL+IAI CT  LP+ RPTMR VV+ML DAEPC   S
Sbjct  895  ILDERVTSESVEDMIKVLKIAIKCTTKLPSLRPTMREVVKMLIDAEPCAFKS  946


 Score = 61.6 bits (148),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 11/61 (18%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL-----QYNSSCKDTTHVIPGTHGYIA  732
            C+ P+IHRD+KSSNILLDE ++ +IADFG+A+       Q   SC      + GT GYIA
Sbjct  783  CNPPVIHRDIKSSNILLDEDYESKIADFGIARFAEKSDKQLGYSC------LAGTLGYIA  836

Query  731  P  729
            P
Sbjct  837  P  837



>gb|KJB64049.1| hypothetical protein B456_010G030500 [Gossypium raimondii]
Length=951

 Score =   129 bits (323),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP++A++GE  +IV WV+TKL +KE ++ 
Sbjct  817  LAPEYAYSNKATTKCDVYSFGVVLMELITGKKPVDADFGEYKNIVYWVTTKLDTKEGVME  876

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPC  304
            ++D  +   FK++ I+VLRIA+ CT   P+ RPTM  VVQ+L   +PC
Sbjct  877  VIDKNLLGSFKDEMIQVLRIAMCCTCKNPSQRPTMNEVVQLLIQTDPC  924


 Score = 66.2 bits (160),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 42/53 (79%), Gaps = 5/53 (9%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PI+HRD+KS+NILLD  ++P++ADFG+AK+L+       T+ +I GT+GY+AP
Sbjct  772  PIVHRDIKSTNILLDINYQPKVADFGIAKVLK-----DSTSTIIAGTYGYLAP  819



>emb|CDX71602.1| BnaC09g26430D [Brassica napus]
Length=953

 Score =   123 bits (308),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 61/131 (47%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGV+LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  819  LAPEYAYSSKATIKCDVYSFGVMLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  878

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS----  280
             +D  + E  K D I  LR+AI CT+  P  RP+M  VVQ+L DA P + + +       
Sbjct  879  TLDKRLSESSKTDMINALRVAIRCTSRTPTIRPSMNEVVQLLIDAAPQEGLDMASKSRTK  938

Query  279  -KDAAKLDNPS  250
             KDA   DNP+
Sbjct  939  IKDAILSDNPT  949


 Score = 71.2 bits (173),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  770  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVIAGTYGYLAP  821



>ref|XP_008674123.1| PREDICTED: receptor-like protein kinase HAIKU2 [Zea mays]
 tpg|DAA54763.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=989

 Score =   116 bits (291),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 56/104 (54%), Positives = 79/104 (76%), Gaps = 5/104 (5%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVL+ELV+G+  +     E+ D+V WVS +L+S+E ++S
Sbjct  871  MAPEYAYTCKVTEKSDVYSFGVVLLELVTGRPAVV----ESRDLVDWVSRRLESREKVMS  926

Query  447  MVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE  319
            +VD  I E + +E+A++VLR+A+LCT+  P+ RP+MR VVQMLE
Sbjct  927  LVDPGIVEGWAREEAVRVLRVAVLCTSRTPSMRPSMRSVVQMLE  970


 Score = 78.2 bits (191),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL--QYNSSCKDTTHVIPGTHGYIAP  729
            CDRPI+HRDVKSSNILLDE FKPR+ADFGLAKIL          +  V+ GT GY+AP
Sbjct  816  CDRPILHRDVKSSNILLDESFKPRLADFGLAKILSSAGGGGGHSSAGVVAGTLGYMAP  873



>ref|XP_008357591.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
 ref|XP_008357592.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=990

 Score =   130 bits (328),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++P+E +YGE  DIV WVST L  +E+++ 
Sbjct  851  IAPELAYTAKVNEKCDVYSFGVVLLELVTGRRPVEEDYGEGKDIVYWVSTHLSDREAVVK  910

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +  E  ++D IKVL++A+LCT  LP+ RPTMR V++ML  A+PC   S
Sbjct  911  ILDDKVAHECVEDDMIKVLKVAVLCTTKLPSLRPTMRDVIKMLTAADPCTFRS  963


 Score = 63.9 bits (154),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLD+ ++ ++ADFG+AKI + +    D +  + GTHGYIAP
Sbjct  799  CSPAIIHRDIKSTNILLDDDYEAKVADFGVAKIAESSQKGCDYSS-LAGTHGYIAP  853



>ref|XP_008378748.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
 ref|XP_008378749.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=990

 Score =   130 bits (328),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++P+E +YGE  DIV WVST L  +E+++ 
Sbjct  851  IAPELAYTAKVNEKCDVYSFGVVLLELVTGRRPVEEDYGEGKDIVYWVSTHLSDREAVVK  910

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +  E  ++D IKVL++A+LCT  LP+ RPTMR V++ML  A+PC   S
Sbjct  911  ILDDKVAHECVEDDMIKVLKVAVLCTTKLPSLRPTMRDVIKMLTAADPCTFRS  963


 Score = 63.9 bits (154),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLD+ ++ ++ADFG+AKI + +    D +  + GTHGYIAP
Sbjct  799  CSPAIIHRDIKSTNILLDDDYEAKVADFGVAKIAESSQKGCDYSS-LAGTHGYIAP  853



>emb|CDY37769.1| BnaA10g05520D [Brassica napus]
Length=1111

 Score =   124 bits (310),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 61/131 (47%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             L  EY Y+ K   K DVYSFGV+LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  977   LAPEYAYSSKATTKCDVYSFGVMLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  1036

Query  447   MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS----  280
              +D  + E  K D I  LR+AI CT+  P  RP+M  VVQ+L DA P + + +       
Sbjct  1037  TLDKRLSESSKADMINALRVAIRCTSRTPTIRPSMNEVVQLLIDAAPQEGLDMASKSRTK  1096

Query  279   -KDAAKLDNPS  250
              KDA   DNP+
Sbjct  1097  IKDAILSDNPT  1107


 Score = 70.9 bits (172),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  928  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVIAGTYGYLAP  979



>ref|NP_199777.1| receptor like kinase [Arabidopsis thaliana]
 dbj|BAB10911.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59387.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95842.1| receptor like kinase [Arabidopsis thaliana]
Length=966

 Score =   124 bits (310),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  832  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  891

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + E  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  892  TLDKRLSESSKADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDATP  938


 Score = 70.5 bits (171),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  783  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  834



>dbj|BAC42540.1| putative receptor protein kinase [Arabidopsis thaliana]
Length=966

 Score =   124 bits (310),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  832  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  891

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + E  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  892  TLDKRLSESSKADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDATP  938


 Score = 70.5 bits (171),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  783  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  834



>ref|XP_009780300.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=1001

 Score =   129 bits (325),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT +V EKSD+YSFGVVL+ELV+G+KPIE  +GE  D+V W ST L  KESI+ 
Sbjct  875  MAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVK  934

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D   + E  +ED IKVLRIA LCT  LPN RP M+ VV++L DAEP
Sbjct  935  VLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLLVDAEP  982


 Score = 64.3 bits (155),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE ++ +++DFG+AK+ + +S   + +    GTHGY+AP
Sbjct  823  CCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELS-CFAGTHGYMAP  877



>ref|NP_001048946.2| Os03g0145000 [Oryza sativa Japonica Group]
 gb|AAO17351.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93945.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ25561.1| hypothetical protein OsJ_09387 [Oryza sativa Japonica Group]
 dbj|BAF10860.2| Os03g0145000 [Oryza sativa Japonica Group]
Length=1030

 Score =   127 bits (320),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 4/134 (3%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV +KSD+YSFGVVLMEL++G++PIE EYGE+ DIV W+  +L+S   +  
Sbjct  891   IAPEYGYTLKVDQKSDIYSFGVVLMELLTGRRPIEPEYGESQDIVGWIRERLRSNTGVEE  950

Query  447   MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVS  280
             ++D+++    +  +E+ + VLR+A+LCTA  P  RPTMR VV ML +A+P  K  S  V+
Sbjct  951   LLDASVGGRVDHVREEMLLVLRVAVLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVA  1010

Query  279   KDAAKLDNPSDNTS  238
                   D P   TS
Sbjct  1011  ATVVDKDKPVFTTS  1024


 Score = 66.6 bits (161),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  P+IHRDVKSSN+LLD+    +IADFGLA+++   +   +T  V+ G++GYIAP
Sbjct  841  CRPPVIHRDVKSSNVLLDDNMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAP  893



>ref|XP_009628481.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=987

 Score =   129 bits (324),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT +V EKSD+YSFGVVL+ELV+G+KPIE  +GE  D+V W ST L  KESI+ 
Sbjct  861  MAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDTFGEGKDLVYWTSTHLNDKESIVK  920

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D   + E  +ED IKVLRIA LCT  LPN RP M+ VV++L DAEP
Sbjct  921  VLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLLVDAEP  968


 Score = 65.1 bits (157),  Expect(2) = 2e-40, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE ++ +I+DFG+AK+ + +S   + +    GTHGY+AP
Sbjct  809  CCPPIIHRDIKSTNILLDEDYEAKISDFGVAKVSEISSRGSELS-CFAGTHGYMAP  863



>tpg|DAA54762.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=548

 Score =   115 bits (288),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 78/101 (77%), Gaps = 5/101 (5%)
 Frame = -3

Query  618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD  439
            EY YT KV EKSDVYSFGVVL+ELV+G+  +     E+ D+V WVS +L+S+E ++S+VD
Sbjct  433  EYAYTCKVTEKSDVYSFGVVLLELVTGRPAVV----ESRDLVDWVSRRLESREKVMSLVD  488

Query  438  SAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE  319
              I E + +E+A++VLR+A+LCT+  P+ RP+MR VVQMLE
Sbjct  489  PGIVEGWAREEAVRVLRVAVLCTSRTPSMRPSMRSVVQMLE  529


 Score = 78.6 bits (192),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL--QYNSSCKDTTHVIPGTHGYIAP  729
            CDRPI+HRDVKSSNILLDE FKPR+ADFGLAKIL          +  V+ GT GY+AP
Sbjct  375  CDRPILHRDVKSSNILLDESFKPRLADFGLAKILSSAGGGGGHSSAGVVAGTLGYMAP  432



>gb|ERN20030.1| hypothetical protein AMTR_s00071p00174710 [Amborella trichopoda]
Length=913

 Score =   132 bits (333),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 61/123 (50%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y+ K  EKSDVYSFGV+L+ELV+GK+P+E E+ E  DIV WV + L ++E+  S
Sbjct  791  IAPELAYSMKATEKSDVYSFGVILLELVTGKRPLEPEFQEGKDIVDWVCSHLATRETACS  850

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            ++D+ + + ++ED +KVL++A LCT  LP  RP+MR VV+ML DAEPC  VS I  K + 
Sbjct  851  ILDTRVSDYYEEDMLKVLKMATLCTTKLPTLRPSMREVVKMLVDAEPC--VSGIKDKLSE  908

Query  267  KLD  259
            + D
Sbjct  909  RFD  911


 Score = 61.2 bits (147),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KSSN+LLDE  + +I DFG+A+++   S   + +    GTHGYIAP
Sbjct  741  CSPAIIHRDIKSSNVLLDEALEAKIGDFGIARVV---SEGGEASSGFVGTHGYIAP  793



>ref|XP_010440851.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=970

 Score =   123 bits (308),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  835  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLME  894

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + E  + D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  895  TLDKRLAESSRADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  941


 Score = 70.5 bits (171),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  786  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  837



>ref|XP_010442431.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=970

 Score =   122 bits (307),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  835  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  894

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + E  + D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  895  TLDKRLAESSRADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  941


 Score = 70.5 bits (171),  Expect(2) = 3e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  786  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  837



>ref|XP_010482244.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Camelina 
sativa]
Length=970

 Score =   122 bits (307),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  835  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  894

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + E  + D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  895  TLDKRLAESSRADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  941


 Score = 70.5 bits (171),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  786  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  837



>ref|XP_010482245.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Camelina 
sativa]
Length=970

 Score =   122 bits (307),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  835  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLME  894

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + E  + D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  895  TLDKRLAESSRADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  941


 Score = 70.5 bits (171),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  786  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  837



>ref|XP_011017021.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=958

 Score =   117 bits (293),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+EA++GE  +I+  VSTK+ +KE ++ 
Sbjct  825  LAPEYAYSSKATTKCDVYSFGVVLMELITGKKPVEADFGECKNIIHLVSTKVDTKEGVME  884

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA  313
            ++D  +   F+++ I+VLRIAI CT   P  RPTM  VVQ+L +A
Sbjct  885  VLDKKLSGSFRDEMIQVLRIAIRCTYKTPALRPTMNEVVQLLIEA  929


 Score = 75.9 bits (185),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  775  PIIHRDIKSTNILLDANYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAP  827



>ref|XP_009416959.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416961.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416962.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416963.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   127 bits (318),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y+ KV EK+DVYSFG+VL+EL++G  P+E +YGE  DIV WVST L ++++   
Sbjct  844  IAPELAYSVKVTEKTDVYSFGIVLLELLTGHGPVEPQYGEGKDIVYWVSTHL-NQQNASE  902

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++DS +  P +E  +KVL++AILCT  LPN RPTMR VV ML DA+PC L +
Sbjct  903  ILDSRVSSPAEECMMKVLKVAILCTTKLPNLRPTMREVVNMLIDADPCNLAA  954


 Score = 66.2 bits (160),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 7/57 (12%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL-QYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLDE ++ +IADFG+AKI  + +SSC        GTHGYIAP
Sbjct  796  CSPAIIHRDIKSNNILLDEDYEAKIADFGIAKIAEESDSSC------FAGTHGYIAP  846



>gb|EAY88517.1| hypothetical protein OsI_09989 [Oryza sativa Indica Group]
Length=1030

 Score =   127 bits (320),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 4/134 (3%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV +KSD+YSFGVVLMEL++G++PIE EYGE+ DIV W+  +L+S   +  
Sbjct  891   IAPEYGYTLKVDQKSDIYSFGVVLMELLTGRRPIEPEYGESQDIVGWIRERLRSNTGVEE  950

Query  447   MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVS  280
             ++D+++    +  +E+ + VLR+A+LCTA  P  RPTMR VV ML +A+P  K  S  V+
Sbjct  951   LLDASVGGRVDHVREEMLLVLRVAVLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVA  1010

Query  279   KDAAKLDNPSDNTS  238
                   D P   TS
Sbjct  1011  ATVVDKDKPVFTTS  1024


 Score = 65.5 bits (158),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  P+IHRDVKSSN+LLD     +IADFGLA+++   +   +T  V+ G++GYIAP
Sbjct  841  CRPPVIHRDVKSSNVLLDANMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAP  893



>ref|XP_004250411.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=961

 Score =   128 bits (322),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  E  YT +V EKSDVYSFGVVL+ELV+G+KPIE  YGE  D+V W ST L  K S+L+
Sbjct  854  LAPELAYTSRVTEKSDVYSFGVVLLELVTGRKPIEEAYGEGKDLVYWASTHLNDKGSVLN  913

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D   + E  ++D IKVLRI+ LCT  LPN RP+M+ VV+ML D EP
Sbjct  914  ILDQKVVSELVQDDMIKVLRISALCTTKLPNLRPSMKEVVKMLVDVEP  961


 Score = 64.3 bits (155),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE ++ +++DFG+AK+ + +S   + +    GTHGY+AP
Sbjct  802  CVPPIIHRDIKSTNILLDEEYEAKVSDFGVAKVSEISSRGSEFS-CFAGTHGYLAP  856



>ref|XP_002465865.1| hypothetical protein SORBIDRAFT_01g047250 [Sorghum bicolor]
 gb|EER92863.1| hypothetical protein SORBIDRAFT_01g047250 [Sorghum bicolor]
Length=1039

 Score =   127 bits (319),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 4/134 (3%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV +KSD+YSFGVVLMEL++G++P+E EYGE+ DIV W+  +L+S   +  
Sbjct  900   IAPEYGYTLKVDQKSDIYSFGVVLMELLTGRRPVEPEYGESQDIVGWIRERLRSNSGVEE  959

Query  447   MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVS  280
             ++D+++    +  +E+ + VLRIA+LCTA  P  RPTMR VV ML +A+P  K  S  V+
Sbjct  960   LLDASVGGCVDHVREEMLLVLRIAVLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVA  1019

Query  279   KDAAKLDNPSDNTS  238
                   D P   TS
Sbjct  1020  ATVVDKDKPVFTTS  1033


 Score = 65.5 bits (158),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  P+IHRDVKSSN+LLD     +IADFGLA+++   +   +T  V+ G++GYIAP
Sbjct  850  CRPPVIHRDVKSSNVLLDTNMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAP  902



>ref|XP_011031514.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
 ref|XP_011031515.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=977

 Score =   124 bits (310),  Expect(2) = 6e-40, Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y+ KV EKSDVYSFGVVL+ELV+GK+PI+  YGE  DI  WV + L  +E+IL 
Sbjct  852  IAPEMAYSLKVTEKSDVYSFGVVLLELVTGKRPIDEAYGEGKDIAYWVLSNLNDRENILK  911

Query  447  MVDSAIQE-PFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            ++D  +     +E+ IKVL+I +LCT  LPN RPTMR VV+ML DA+ C   S   S D
Sbjct  912  VLDEEVASGSAQEEMIKVLKIGVLCTTKLPNLRPTMREVVKMLVDADSCAYRSPDYSSD  970


 Score = 68.9 bits (167),  Expect(2) = 6e-40, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYN-SSCKDTTHVIPGTHGYIAP  729
            C  PI+HRD+KSSNILLDE  +P+IADFG+AK+ + +   C +++    GTHGYIAP
Sbjct  800  CSPPILHRDIKSSNILLDEDNEPKIADFGVAKLAEMSLKGCDNSS--FTGTHGYIAP  854



>gb|EYU22821.1| hypothetical protein MIMGU_mgv1a000956mg [Erythranthe guttata]
Length=934

 Score =   131 bits (329),  Expect(2) = 6e-40, Method: Composition-based stats.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y+ K+ EKSDVYSFGVVL+ELV+GK+P+E  YGE  DIV WVST L  +E+++ 
Sbjct  808  IAPEMAYSLKITEKSDVYSFGVVLLELVTGKRPVEDGYGEGKDIVYWVSTHLNERENVIK  867

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D   + +  ++D IKVL+IA LC A LPN RP+M+ VV+ML DAEPC   S
Sbjct  868  VLDQKVVTDLIRDDMIKVLKIATLCAAKLPNLRPSMKEVVKMLVDAEPCSYKS  920


 Score = 61.2 bits (147),  Expect(2) = 6e-40, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLDE ++ +IADFG+AK+    S          GTHGYIAP
Sbjct  755  CCPVIIHRDIKSTNILLDEDYEAKIADFGVAKMADQVSPRGSEFSSFAGTHGYIAP  810



>gb|EPS61889.1| hypothetical protein M569_12898, partial [Genlisea aurea]
Length=937

 Score =   122 bits (305),  Expect(2) = 6e-40, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  E  Y+ +V EK+D+YSFGVVL+ELV+G+ PIE  YG+  DIV WV + L ++E++  
Sbjct  821  LAPEMAYSVQVTEKNDIYSFGVVLLELVTGRLPIEEAYGDGKDIVYWVFSHLNNRENVER  880

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D   + E  ++D IKVL+IA +C   LPN RPTM++VV+M+ DA+PC L S
Sbjct  881  ILDEKVVSELVQQDMIKVLKIATICCCKLPNLRPTMKQVVKMIVDADPCALRS  933


 Score = 70.9 bits (172),  Expect(2) = 6e-40, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C+ PIIHRD+KSSNILLDE ++P++ADFG+AK+    S     +    GTHGY+AP
Sbjct  772  CNPPIIHRDIKSSNILLDEDYEPKVADFGVAKLTDQTSE----SSFFAGTHGYLAP  823



>ref|XP_006353616.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=977

 Score =   125 bits (315),  Expect(2) = 7e-40, Method: Composition-based stats.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT +V EK+D+YSFGVVL+ELV+G+KPIE  YGE  D++ W ST L  KESI  
Sbjct  851  MAPEMAYTLRVTEKNDIYSFGVVLLELVTGRKPIEEAYGEGKDLIYWTSTHLNDKESINK  910

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D   + E  +++ IKVLRIA LCT  LPN RP+M+ VV ML DAEP
Sbjct  911  VLDQKVVSELVQDEMIKVLRIATLCTTKLPNLRPSMKEVVNMLVDAEP  958


 Score = 66.6 bits (161),  Expect(2) = 7e-40, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE+++ +++DFG+AK+ + +S   + +    GTHGY+AP
Sbjct  799  CYPPIIHRDIKSTNILLDEYYEAKVSDFGVAKVSEISSRGSEFS-CFAGTHGYMAP  853



>ref|XP_002325963.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 ref|XP_006371455.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
 ref|XP_006371456.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
 gb|EEF00345.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP49252.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
 gb|ERP49253.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
Length=977

 Score =   123 bits (309),  Expect(2) = 7e-40, Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  Y+ KV EKSDVYSFGVVL+ELV+GK+PIE  YGE  DI  WV + L  +E++L 
Sbjct  852  IAPEMAYSLKVTEKSDVYSFGVVLLELVTGKRPIEEAYGEGKDIAYWVLSHLNDRENLLK  911

Query  447  MVDSAIQE-PFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            ++D  +     +E+ IKVL+I +LCT  LPN RPTMR VV+ML DA+ C   S   S D
Sbjct  912  VLDEEVASGSAQEEMIKVLKIGVLCTTKLPNLRPTMREVVKMLVDADSCAYRSPDYSSD  970


 Score = 68.9 bits (167),  Expect(2) = 7e-40, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYN-SSCKDTTHVIPGTHGYIAP  729
            C  PI+HRD+KSSNILLDE  +P+IADFG+AK+ + +   C +++    GTHGYIAP
Sbjct  800  CSPPILHRDIKSSNILLDEDNEPKIADFGVAKLAEMSLKGCDNSS--FTGTHGYIAP  854



>ref|XP_006279955.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
 gb|EOA12853.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
Length=968

 Score =   121 bits (304),  Expect(2) = 8e-40, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  831  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  890

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + +  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  891  TLDKRLADSSKGDMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  937


 Score = 70.5 bits (171),  Expect(2) = 8e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  782  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  833



>ref|XP_006279956.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
 gb|EOA12854.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
Length=945

 Score =   121 bits (304),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  808  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE  867

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D  + +  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct  868  TLDKRLADSSKGDMINALRVAIRCTSRTPTIRPTMNEVVQLLIDAAP  914


 Score = 70.5 bits (171),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct  759  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP  810



>ref|XP_004985730.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like 
[Setaria italica]
Length=1040

 Score =   126 bits (317),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 63/134 (47%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV +KSD+YSFGVVLMEL++G++PIE EYG++ DIV W+  +L+S   +  
Sbjct  901   IAPEYGYTLKVDQKSDIYSFGVVLMELLTGRRPIEPEYGDSTDIVGWIRERLRSNSGVED  960

Query  447   MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVS  280
             ++D+ +    +  +E+ + VLRIA+LCTA  P  RPTMR VV ML +A+P  K  S  V+
Sbjct  961   LLDAGVGGRVDHVREEMLLVLRIAVLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVA  1020

Query  279   KDAAKLDNPSDNTS  238
                   D P   TS
Sbjct  1021  ATVVDKDKPVFTTS  1034


 Score = 65.5 bits (158),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  P+IHRDVKSSN+LLD     +IADFGLA+++   +   +T  V+ G++GYIAP
Sbjct  851  CRPPVIHRDVKSSNVLLDTNMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAP  903



>ref|XP_006664773.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HAIKU2-like [Oryza brachyantha]
Length=883

 Score =   115 bits (289),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 84/117 (72%), Gaps = 12/117 (10%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEY-GENNDIV----------SWVS  481
            +  EY YT KV EKSDVYSFGVVL+ELV+G+ PI AE  GE+ DIV           WV+
Sbjct  749  MAPEYAYTWKVTEKSDVYSFGVVLLELVTGRTPIMAERGGESIDIVDWVARRLDVGGWVA  808

Query  480  TKLKSKESILSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA  313
             +L S++ ++S++D+ I E + +E+A++VLR+A+LCT+  P+ RP+MR VVQMLE A
Sbjct  809  RRLDSRDKVVSLLDAGIGEEWAREEAVRVLRVAVLCTSRTPSMRPSMRSVVQMLEAA  865


 Score = 76.3 bits (186),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            + I+HRDVKSSNILLDE FKPRIADFGLAKIL   ++   T  V+ GT GY+AP
Sbjct  698  QAIVHRDVKSSNILLDESFKPRIADFGLAKILDGAATADTTPGVVAGTLGYMAP  751



>ref|XP_010271555.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=952

 Score =   121 bits (303),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 56/112 (50%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY Y+ K   K DVYSFGVVLMEL++GKKP+E E+GE+ +I+ WVS K+++KE  + 
Sbjct  827  IAPEYAYSSKATVKCDVYSFGVVLMELITGKKPVEPEFGESKNIIYWVSCKVETKEGAME  886

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +   F E+ I+VLRIAI CT  +P  RPTM  VVQ+L +A+P +  S
Sbjct  887  VLDKRLVGLFMEEMIQVLRIAIRCTCRVPALRPTMNEVVQLLIEADPYRFDS  938


 Score = 70.5 bits (171),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            IIHRD+KS+NILL   ++P++ADFG+AK+LQ       TT VI GT+GYIAP
Sbjct  778  IIHRDIKSTNILLSADYQPKVADFGVAKVLQARGGKDSTTTVIAGTYGYIAP  829



>ref|XP_009379270.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=990

 Score =   128 bits (322),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 58/113 (51%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EK DVYSFGVVL+ELV+G++P+E +YGE  DIV WVS  L  +E+++ 
Sbjct  851  IAPELAYTAKVNEKCDVYSFGVVLLELVTGRRPVEEDYGEGKDIVYWVSKHLSDREAVVK  910

Query  447  MVDSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +  E  ++D IKVL++A+LCT  LP+ RPTMR V++ML  A+PC   S
Sbjct  911  ILDDKVAHECVEDDMIKVLKVAVLCTTKLPSLRPTMRDVIKMLTAADPCTFRS  963


 Score = 63.2 bits (152),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLD+ ++ ++ADFG+AKI + +    D +    GTHGYIAP
Sbjct  799  CSPAIIHRDIKSTNILLDDDYEAKVADFGVAKIAESSQKGCDYSS-FAGTHGYIAP  853



>ref|XP_010556500.1| PREDICTED: receptor-like protein kinase HSL1 [Tarenaya hassleriana]
Length=956

 Score =   119 bits (298),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 60/131 (46%), Positives = 86/131 (66%), Gaps = 5/131 (4%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  E+ Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct  824  LAPEFAYSSKATVKCDVYSFGVVLMELITGKKPVDSAFGENKNIVNWVSTKIDTKEGLME  883

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             +D  + +  KE  I  LR+AI CT+  P  RPTM  VVQ+L DA P +      ++DA+
Sbjct  884  TLDKRLSDLSKEFMINALRVAIRCTSRSPTIRPTMNEVVQLLIDAAPHRFEPSNKARDAS  943

Query  267  KLDNPSDNTSK  235
                 SD+ +K
Sbjct  944  -----SDHVAK  949


 Score = 71.6 bits (174),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT VI GT+GY+AP
Sbjct  775  PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVIAGTYGYLAP  826



>ref|XP_010322765.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=977

 Score =   124 bits (310),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 85/128 (66%), Gaps = 3/128 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT +V EK+D+YSFGVVL+ELV+G+KPIE  YGE  D+V W ST L  KESI  
Sbjct  851  MAPEIAYTLRVTEKNDIYSFGVVLLELVTGRKPIEEAYGEGKDLVYWTSTHLNDKESINK  910

Query  447  MVDS-AIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            ++D   + +  +++ IKVLRIA LCT  LPN RP+M+ VV ML DAEP    S   SK  
Sbjct  911  VLDQKVVSDLVQDEMIKVLRIATLCTTKLPNLRPSMKEVVNMLVDAEPLTFRS--SSKSE  968

Query  270  AKLDNPSD  247
             K +N S+
Sbjct  969  KKGNNFSE  976


 Score = 66.6 bits (161),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLDE+++ +++DFG+AK+ + +S   + +    GTHGY+AP
Sbjct  799  CCPPIIHRDIKSTNILLDEYYEAKVSDFGVAKVSEISSRGSEFS-CFAGTHGYMAP  853



>ref|XP_010684496.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010684551.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=975

 Score =   127 bits (318),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  E  YT KV E+SDVYSFGVVL+E+++GK PIE +YGE  DIV WV   L+ K+S L+
Sbjct  850  LAPELAYTCKVTERSDVYSFGVVLLEMLTGKGPIEEQYGEGRDIVHWVLCALQDKKSELN  909

Query  447  MVD-SAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSI  289
            ++D   + E  KED +KVL+IA LCT  LP+ RPTMR VV+ML D +PC   S+
Sbjct  910  VLDPKVVLECNKEDMMKVLKIATLCTTKLPSLRPTMRDVVKMLVDVDPCAFKSL  963


 Score = 63.5 bits (153),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLD+ ++P+IADFG+A+  + NS          GT+GY+AP
Sbjct  798  CSPPIIHRDIKSTNILLDQNYEPKIADFGVARDTE-NSPEGSEFSCFAGTYGYLAP  852



>gb|KHG27799.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=976

 Score =   123 bits (309),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYSFGVVL+ELV+ +  IE EYGE  D+V WV T     E++L 
Sbjct  853  IAPELAYTLKVTEKSDVYSFGVVLLELVTRRAAIEEEYGEGKDLVYWVLTHFNHHENVLK  912

Query  447  MVDSAI---QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++DS +       ++D IKVL+I ILCTA LPN RPTMR VV+ML +AEP
Sbjct  913  VLDSKVATGTATVRDDMIKVLKIGILCTAKLPNLRPTMREVVRMLVNAEP  962


 Score = 67.0 bits (162),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 3/57 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTT-HVIPGTHGYIAP  729
            C  PIIHRD+KS NILLD+ ++P+IADFG+AK+ +   S K +  +   GTHGYIAP
Sbjct  801  CSPPIIHRDIKSCNILLDKDYEPKIADFGVAKVAE--KSLKGSEWNCFAGTHGYIAP  855



>ref|XP_004292067.1| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=979

 Score =   157 bits (397),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 74/119 (62%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSDVYSFGVVLMELV+GK+P+E E+GEN DIVSWV +K+  K++ L 
Sbjct  849  IAPEYAYTYKVNEKSDVYSFGVVLMELVTGKRPVEPEFGENKDIVSWVCSKITCKDTELE  908

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
             VDS+I+E  KEDA+ VL IAI CTA +P  RP+MR VVQMLE+A+PC+L SI ++K+ 
Sbjct  909  SVDSSIEEALKEDALNVLSIAIRCTARVPVLRPSMRMVVQMLEEAQPCQLTSISITKEG  967


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -1

Query  890  RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKHFK  711
            RP+IHRDVKSSNILLD  +KPRIADFGLAKI+Q      + THVI GTHGYIAP    + 
Sbjct  801  RPVIHRDVKSSNILLDGDWKPRIADFGLAKIVQAGG---EMTHVIAGTHGYIAP---EYA  854

Query  710  FYYKL  696
            + YK+
Sbjct  855  YTYKV  859



>ref|XP_006651034.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like 
[Oryza brachyantha]
Length=1037

 Score =   124 bits (311),  Expect(2) = 4e-39, Method: Composition-based stats.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 4/134 (3%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV +KSD+YSFGVVLMEL++G++PIE EYG++ DIV W+  +L+S   +  
Sbjct  898   IAPEYGYTLKVDQKSDIYSFGVVLMELLTGRRPIEPEYGDSQDIVGWIRERLRSNTGVEE  957

Query  447   MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVS  280
             ++D+++    +  +E+ + VLR+A+LCTA  P  RP+MR VV ML +A+P  K  S  V+
Sbjct  958   LLDASVGGRVDHVREEMLLVLRVAVLCTAKSPKDRPSMRDVVTMLGEAKPRRKSSSATVA  1017

Query  279   KDAAKLDNPSDNTS  238
                   D P   TS
Sbjct  1018  ATVVDKDKPVFTTS  1031


 Score = 65.5 bits (158),  Expect(2) = 4e-39, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  P+IHRDVKSSN+LLD     +IADFGLA+++   +   +T  V+ G++GYIAP
Sbjct  848  CRPPVIHRDVKSSNVLLDANMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAP  900



>emb|CDP03798.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   124 bits (310),  Expect(2) = 7e-39, Method: Composition-based stats.
 Identities = 62/132 (47%), Positives = 92/132 (70%), Gaps = 5/132 (4%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGY+ KV EKSD+YS+GVVLMEL++GK+P++ E+GE+ DIV W+  K++  +S+ +
Sbjct  883   IAPEYGYSLKVDEKSDIYSYGVVLMELLTGKRPLDPEFGESVDIVEWIRIKIRDHKSLET  942

Query  447   MVDSA--IQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
              +D +  I +  +E+ + VLRIAILCTA LP  RP+MR V+ ML +A+P +  S   S  
Sbjct  943   ALDPSVGITKHVQEEMLLVLRIAILCTAKLPKDRPSMRDVLTMLGEAKPRRKGS---SNH  999

Query  273   AAKLDNPSDNTS  238
              A  DNP  +T+
Sbjct  1000  GADKDNPVFSTT  1011


 Score = 65.1 bits (157),  Expect(2) = 7e-39, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  P+IHRDVKS+NILLD   + RIADFGLAK++   +   +T  ++ G++GYIAP
Sbjct  833  CHPPVIHRDVKSNNILLDANLEARIADFGLAKLMLKKN---ETVSMVAGSYGYIAP  885



>ref|NP_001067348.1| Os12g0632900 [Oryza sativa Japonica Group]
 gb|ABA99942.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30367.1| Os12g0632900 [Oryza sativa Japonica Group]
 gb|EAZ21324.1| hypothetical protein OsJ_36978 [Oryza sativa Japonica Group]
Length=977

 Score =   115 bits (288),  Expect(2) = 8e-39, Method: Composition-based stats.
 Identities = 59/126 (47%), Positives = 78/126 (62%), Gaps = 3/126 (2%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  EY Y+ K   K DVYSFGVVLMEL +GKKPIE E+G+  DIV WVS K+ +     +
Sbjct  850  LAPEYAYSSKATTKCDVYSFGVVLMELATGKKPIEPEFGDTRDIVQWVSGKVAAGGEGEA  909

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            +       PFKE+ ++ LR+A+ CT ++P  RPTM  VVQML +A P    +   +KDAA
Sbjct  910  LDKRLEWSPFKEEMVQALRVAVRCTCSIPGLRPTMADVVQMLAEAGP---AAGRTAKDAA  966

Query  267  KLDNPS  250
               + S
Sbjct  967  NKKDSS  972


 Score = 73.6 bits (179),  Expect(2) = 8e-39, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            PI+HRD+KSSNILLD  F+P++ADFG+AK+LQ       +T  I GT+GY+AP
Sbjct  800  PIVHRDIKSSNILLDADFEPKVADFGIAKVLQARGDRDASTTTIAGTYGYLAP  852



>ref|XP_010918931.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Elaeis guineensis]
Length=1021

 Score =   123 bits (308),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 64/134 (48%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -3

Query  627   LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
             +  EYGYT KV +KSD+YSFGVVLMEL++GK+PIE E+G+  DIV WV  +L+S   +  
Sbjct  882   IAPEYGYTLKVDQKSDIYSFGVVLMELLTGKRPIEPEFGDCLDIVGWVRERLRSNRGVDE  941

Query  447   MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVS  280
             ++D++I    E  +E+ + VLRIA+LCTA  P  RP+MR V+ ML +A+P  K  S  V 
Sbjct  942   LLDASIGGQCEHVREEMLLVLRIAVLCTARSPKDRPSMRDVLTMLGEAKPRRKSSSTGVG  1001

Query  279   KDAAKLDNPSDNTS  238
              +    D P   TS
Sbjct  1002  SNGVAKDKPVFTTS  1015


 Score = 65.9 bits (159),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  P+IHRDVKSSN+LLD   + RIADFGLA+I+   +   +T   + G++GYIAP
Sbjct  832  CHPPVIHRDVKSSNVLLDANLEARIADFGLARIMVRKN---ETVSTVAGSYGYIAP  884



>gb|KJB59645.1| hypothetical protein B456_009G265300 [Gossypium raimondii]
Length=976

 Score =   121 bits (304),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  E  YT KV EKSDVYSFGVVL+ELV+ +  IE EYGE  D+V WV + L   E++L 
Sbjct  853  IAPELAYTLKVTEKSDVYSFGVVLLELVTRRAAIEEEYGEGKDLVYWVLSHLNHHENVLK  912

Query  447  MVDSAI---QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            ++D  +       ++D +KVL+I ILCTA LPN RPTMR VV+ML +AEP +  S
Sbjct  913  VLDGKVATGTATVRDDMMKVLKIGILCTAELPNLRPTMREVVRMLVNAEPARSTS  967


 Score = 67.0 bits (162),  Expect(2) = 9e-39, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 3/57 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTT-HVIPGTHGYIAP  729
            C  PIIHRD+KS NILLD+ ++P+IADFG+AK+ +   S K +  +   GTHGYIAP
Sbjct  801  CSPPIIHRDIKSCNILLDKDYEPKIADFGVAKVAE--KSLKGSEWNCFAGTHGYIAP  855



>ref|XP_002966807.1| hypothetical protein SELMODRAFT_168561 [Selaginella moellendorffii]
 gb|EFJ31406.1| hypothetical protein SELMODRAFT_168561 [Selaginella moellendorffii]
Length=992

 Score =   130 bits (327),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EY YT KV EKSD+YSFGVVL+ELV+GK+PIEAE+G+  DIV WV  K++++ S+  
Sbjct  876  IAPEYAYTLKVTEKSDIYSFGVVLLELVTGKRPIEAEFGDGVDIVRWVCDKIQARNSLAE  935

Query  447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            + DS I   F ED + +LR+ +LCT+ALP  RP M+ VVQML +A P
Sbjct  936  IFDSRIPSYFHEDMMLMLRVGLLCTSALPVQRPGMKEVVQMLVEARP  982


 Score = 58.2 bits (139),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -1

Query  884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            ++H DVKS+NILLD   +P +ADFGLA+I+Q + +    T  I GT+GYIAP
Sbjct  828  VLHCDVKSNNILLDAELEPHVADFGLARIIQQHGNGVSMTS-IAGTYGYIAP  878



>emb|CDP16506.1| unnamed protein product [Coffea canephora]
Length=952

 Score =   127 bits (320),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            L  E  YT KV EKSDVYSFGVVL+ELV+G+KPIE  YGE  +IV WV+T L  +E++L 
Sbjct  828  LAPEMAYTLKVTEKSDVYSFGVVLLELVTGRKPIEDAYGEGKNIVYWVATHLSDRENVLR  887

Query  447  MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++D  I  +  ++D IKVL+ A LCT  LPN RP+MR VV+ML DAEP
Sbjct  888  VLDPKIVCDLVQDDMIKVLKTATLCTDKLPNLRPSMREVVKMLIDAEP  935


 Score = 60.8 bits (146),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C   IIHRD+KS+NILLDE ++ +IADFG+AK    ++S         GTHGY+AP
Sbjct  777  CSPSIIHRDIKSTNILLDEDYEAKIADFGVAK--TSDASQASEFSCFAGTHGYLAP  830



>gb|KCW85317.1| hypothetical protein EUGRSUZ_B02157, partial [Eucalyptus grandis]
Length=977

 Score =   123 bits (309),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 82/110 (75%), Gaps = 3/110 (3%)
 Frame = -3

Query  627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS  448
            +  EYGYT KV EKSD+YS+GVVL+EL++GK P++  +GE+ DIV WV TK+K  +++  
Sbjct  839  IAPEYGYTLKVDEKSDIYSYGVVLLELLTGKTPLDPSFGESIDIVQWVRTKIKDNKTVEE  898

Query  447  MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP  307
             +D++I    +P +E+ + VLR+A+LCTA LP  RP+MR V+ ML +A+P
Sbjct  899  ALDASIAGQCKPVQEEMLLVLRVALLCTAKLPKERPSMRDVLMMLGEAKP  948


 Score = 64.7 bits (156),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 3/56 (5%)
 Frame = -1

Query  896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP  729
            C  PIIHRD+KS+NILLD+  + +IADFGLA+++ + +   +T  ++ G++GYIAP
Sbjct  789  CHPPIIHRDIKSNNILLDKNLEAKIADFGLARMMIHKN---ETVSMVAGSYGYIAP  841



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2059730854950