BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12525

Length=852
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004232810.1|  PREDICTED: ATP-dependent zinc metalloproteas...    288   5e-86   Solanum lycopersicum
ref|XP_009774520.1|  PREDICTED: ATP-dependent zinc metalloproteas...    287   1e-85   Nicotiana sylvestris
ref|XP_006347120.1|  PREDICTED: ATP-dependent zinc metalloproteas...    286   4e-85   Solanum tuberosum [potatoes]
ref|XP_009593960.1|  PREDICTED: ATP-dependent zinc metalloproteas...    285   1e-84   Nicotiana tomentosiformis
emb|CBI24177.3|  unnamed protein product                                283   5e-84   Vitis vinifera
ref|XP_002263178.1|  PREDICTED: ATP-dependent zinc metalloproteas...    283   5e-84   Vitis vinifera
ref|XP_008226136.1|  PREDICTED: ATP-dependent zinc metalloproteas...    280   6e-83   Prunus mume [ume]
ref|XP_007213697.1|  hypothetical protein PRUPE_ppa000789mg             279   1e-82   Prunus persica
ref|XP_007022616.1|  FTSH protease 12 isoform 2                         271   3e-81   
ref|XP_008372001.1|  PREDICTED: ATP-dependent zinc metalloproteas...    274   9e-81   
gb|KJB81418.1|  hypothetical protein B456_013G144900                    273   2e-80   Gossypium raimondii
ref|XP_007022615.1|  FTSH protease 12 isoform 1                         271   8e-80   
gb|EYU27570.1|  hypothetical protein MIMGU_mgv1a000728mg                270   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_011095724.1|  PREDICTED: ATP-dependent zinc metalloproteas...    270   2e-79   Sesamum indicum [beniseed]
gb|KDO61549.1|  hypothetical protein CISIN_1g005284mg                   265   3e-79   Citrus sinensis [apfelsine]
gb|KDO61551.1|  hypothetical protein CISIN_1g005284mg                   265   3e-79   Citrus sinensis [apfelsine]
ref|XP_010260593.1|  PREDICTED: ATP-dependent zinc metalloproteas...    270   4e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004306570.1|  PREDICTED: ATP-dependent zinc metalloproteas...    269   6e-79   Fragaria vesca subsp. vesca
ref|XP_011013846.1|  PREDICTED: ATP-dependent zinc metalloproteas...    267   3e-78   Populus euphratica
ref|XP_012087358.1|  PREDICTED: ATP-dependent zinc metalloproteas...    266   7e-78   Jatropha curcas
ref|XP_002513356.1|  Cell division protein ftsH, putative               264   3e-77   Ricinus communis
ref|XP_006422287.1|  hypothetical protein CICLE_v10004242mg             264   3e-77   Citrus clementina [clementine]
emb|CDP18086.1|  unnamed protein product                                258   4e-76   Coffea canephora [robusta coffee]
ref|XP_003530406.1|  PREDICTED: ATP-dependent zinc metalloproteas...    259   2e-75   Glycine max [soybeans]
ref|XP_008805979.1|  PREDICTED: ATP-dependent zinc metalloproteas...    259   3e-75   Phoenix dactylifera
emb|CDP16393.1|  unnamed protein product                                238   4e-75   Coffea canephora [robusta coffee]
gb|EPS74203.1|  hypothetical protein M569_00544                         256   9e-75   Genlisea aurea
ref|XP_010936478.1|  PREDICTED: ATP-dependent zinc metalloproteas...    257   9e-75   Elaeis guineensis
ref|XP_006389875.1|  hypothetical protein EUTSA_v100180711mg            237   1e-74   
ref|XP_010537801.1|  PREDICTED: ATP-dependent zinc metalloproteas...    256   2e-74   Tarenaya hassleriana [spider flower]
ref|XP_010693321.1|  PREDICTED: ATP-dependent zinc metalloproteas...    255   5e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010064082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    253   2e-73   Eucalyptus grandis [rose gum]
ref|XP_007133424.1|  hypothetical protein PHAVU_011G177500g             251   2e-72   Phaseolus vulgaris [French bean]
ref|XP_008456301.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    248   1e-71   
ref|XP_010429850.1|  PREDICTED: ATP-dependent zinc metalloproteas...    248   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009104519.1|  PREDICTED: ATP-dependent zinc metalloproteas...    247   3e-71   Brassica rapa
ref|XP_010417622.1|  PREDICTED: ATP-dependent zinc metalloproteas...    247   3e-71   Camelina sativa [gold-of-pleasure]
emb|CDX79327.1|  BnaC06g19760D                                          246   9e-71   
ref|XP_009397211.1|  PREDICTED: ATP-dependent zinc metalloproteas...    245   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK59670.2|  putative FtsH protease                                  241   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42356.1|  hypothetical protein AALP_AA2G245500                    245   2e-70   Arabis alpina [alpine rockcress]
emb|CDX67988.1|  BnaA07g20280D                                          244   3e-70   
ref|XP_004516247.1|  PREDICTED: ATP-dependent zinc metalloproteas...    243   1e-69   Cicer arietinum [garbanzo]
ref|XP_004516246.1|  PREDICTED: ATP-dependent zinc metalloproteas...    242   1e-69   Cicer arietinum [garbanzo]
ref|XP_011628477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    241   4e-69   Amborella trichopoda
ref|NP_565212.1|  cell division protease ftsH-12                        240   9e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAD30220.1|AC007202_2  Is a member of PF|00004 ATPases associa...    240   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472815.1|  PREDICTED: ATP-dependent zinc metalloproteas...    239   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002887790.1|  EMB1047/FTSH12                                     239   2e-68   
ref|XP_004139903.1|  PREDICTED: ATP-dependent zinc metalloproteas...    239   2e-68   Cucumis sativus [cucumbers]
ref|XP_003628399.1|  Cell division protease ftsH-like protein           238   5e-68   Medicago truncatula
ref|XP_010474496.1|  PREDICTED: ATP-dependent zinc metalloproteas...    214   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006303096.1|  hypothetical protein CARUB_v100197241mg            213   6e-59   
gb|ERN19706.1|  hypothetical protein AMTR_s00062p00195710               196   4e-53   Amborella trichopoda
gb|KDP25069.1|  hypothetical protein JCGZ_22604                         195   8e-53   Jatropha curcas
emb|CBI17675.3|  unnamed protein product                                166   4e-47   Vitis vinifera
ref|XP_006378601.1|  hypothetical protein POPTR_0010s17840g             154   4e-41   
ref|XP_009341724.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    159   1e-40   Pyrus x bretschneideri [bai li]
emb|CDP18092.1|  unnamed protein product                                147   2e-40   Coffea canephora [robusta coffee]
gb|KJB81419.1|  hypothetical protein B456_013G144900                    153   5e-38   Gossypium raimondii
gb|ABR16425.1|  unknown                                                 145   4e-35   Picea sitchensis
ref|XP_010654992.1|  PREDICTED: ATP-dependent zinc metalloproteas...    130   6e-34   
ref|XP_010497541.1|  PREDICTED: ATP-dependent zinc metalloproteas...    122   3e-31   Camelina sativa [gold-of-pleasure]
emb|CDP21508.1|  unnamed protein product                                119   2e-26   Coffea canephora [robusta coffee]
gb|KDO61552.1|  hypothetical protein CISIN_1g005284mg                   118   3e-26   Citrus sinensis [apfelsine]
ref|XP_001760369.1|  predicted protein                                  110   2e-23   
emb|CDP21523.1|  unnamed protein product                              97.8    4e-20   Coffea canephora [robusta coffee]
emb|CDP18093.1|  unnamed protein product                              92.8    5e-20   Coffea canephora [robusta coffee]
emb|CBI39361.3|  unnamed protein product                              79.7    2e-15   Vitis vinifera
ref|XP_002992029.1|  hypothetical protein SELMODRAFT_430300           79.3    5e-13   
ref|XP_002964495.1|  hypothetical protein SELMODRAFT_81522            66.6    6e-09   



>ref|XP_004232810.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Solanum lycopersicum]
Length=997

 Score =   288 bits (737),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISPRNSRLGLT+LTKK+GLGDRPD+PDGEIIKYKWDDP+++PA+MTVE
Sbjct  839  LEKITKIAREMVISPRNSRLGLTSLTKKIGLGDRPDNPDGEIIKYKWDDPHIVPADMTVE  898

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            V+ELFTRELTRYI+ETEELAM+GL+ANRH LD+I NELLE SRITGL+VE+KM+GL P M
Sbjct  899  VAELFTRELTRYIDETEELAMRGLLANRHILDLISNELLEHSRITGLEVEDKMRGLQPAM  958

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN+EEEGPLPHN+RL Y+PLD+YPAPLHR
Sbjct  959  FEDFVKPFQINMEEEGPLPHNDRLSYQPLDIYPAPLHR  996



>ref|XP_009774520.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Nicotiana sylvestris]
Length=1008

 Score =   287 bits (735),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISPRNSRLGLTALTK++GLGDRPD PDGEIIKYKWDDP++IPANMTVE
Sbjct  850   LEKITKIAREMVISPRNSRLGLTALTKRLGLGDRPDSPDGEIIKYKWDDPHIIPANMTVE  909

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYI+ETEELAM+GLMANRH LD+I NELLE SRITGL+VE+K++GLSP M
Sbjct  910   VSELFTRELTRYIDETEELAMRGLMANRHILDLISNELLEHSRITGLEVEDKIRGLSPTM  969

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP QIN+EEEGPLPHN+RL Y+PLD+Y APLHR
Sbjct  970   FEDFVKPLQINMEEEGPLPHNDRLSYQPLDIYAAPLHR  1007



>ref|XP_006347120.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Solanum tuberosum]
Length=997

 Score =   286 bits (731),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISPRNSRLGLT+LTKK+GLGDRPD PDGEIIKYKWDDP++IPA+MTVE
Sbjct  839  LEKITKIAREMVISPRNSRLGLTSLTKKIGLGDRPDSPDGEIIKYKWDDPHIIPADMTVE  898

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            V+ELFTRELTRYI+ETEELAM+GL+ANRH LD+I NELLE SRITGL+VE+KM+GL P M
Sbjct  899  VAELFTRELTRYIDETEELAMRGLLANRHILDLISNELLEHSRITGLEVEDKMRGLRPAM  958

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN+EEEGPLPHN+ L Y+PLD+YPAPLHR
Sbjct  959  FEDFVKPFQINMEEEGPLPHNDHLSYQPLDIYPAPLHR  996



>ref|XP_009593960.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Nicotiana tomentosiformis]
Length=1002

 Score =   285 bits (728),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISPRNSRLGLTALTK++GLGDRPD PDGEIIKYKWDDP++IPANMTVE
Sbjct  844   LEKITKIAREMVISPRNSRLGLTALTKRLGLGDRPDSPDGEIIKYKWDDPHIIPANMTVE  903

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYI+ETEELAM+GLMANRH LD+I NELLE SRITGL+VE+K++GL P M
Sbjct  904   VSELFTRELTRYIDETEELAMRGLMANRHILDLISNELLEHSRITGLEVEDKIRGLCPTM  963

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP QIN+EEEGPLPHN+RL Y+PLD+Y AP HR
Sbjct  964   FEDFVKPLQINMEEEGPLPHNDRLSYQPLDIYAAPFHR  1001



>emb|CBI24177.3| unnamed protein product [Vitis vinifera]
Length=1014

 Score =   283 bits (724),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP NSRLGLTALTK+VGL DRPD PDGE+IKY+WDDP+VIPANMT+E
Sbjct  856   LEKITKIAREMVISPANSRLGLTALTKRVGLMDRPDSPDGELIKYRWDDPFVIPANMTLE  915

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELF+RELTRYIEETEE+AM GL  NRH LD+I NELLE SRITGL+V+EKMKGLSP+M
Sbjct  916   VSELFSRELTRYIEETEEIAMSGLKVNRHILDMITNELLENSRITGLEVDEKMKGLSPIM  975

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QINLEEEGPLPHN+R+RY+PLD+YPAPLHR
Sbjct  976   FEDFVKPFQINLEEEGPLPHNDRVRYQPLDIYPAPLHR  1013



>ref|XP_002263178.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Vitis vinifera]
Length=1010

 Score =   283 bits (723),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP NSRLGLTALTK+VGL DRPD PDGE+IKY+WDDP+VIPANMT+E
Sbjct  852   LEKITKIAREMVISPANSRLGLTALTKRVGLMDRPDSPDGELIKYRWDDPFVIPANMTLE  911

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELF+RELTRYIEETEE+AM GL  NRH LD+I NELLE SRITGL+V+EKMKGLSP+M
Sbjct  912   VSELFSRELTRYIEETEEIAMSGLKVNRHILDMITNELLENSRITGLEVDEKMKGLSPIM  971

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QINLEEEGPLPHN+R+RY+PLD+YPAPLHR
Sbjct  972   FEDFVKPFQINLEEEGPLPHNDRVRYQPLDIYPAPLHR  1009



>ref|XP_008226136.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Prunus mume]
Length=1003

 Score =   280 bits (716),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+NSRLGLTALTK+VGL DRPD PDGE+I+Y+WDDP+VIPANMT+E
Sbjct  845   LEKITKIAREMVISPQNSRLGLTALTKRVGLVDRPDSPDGELIRYRWDDPHVIPANMTLE  904

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAM GL  NRH LD+I  ELLE+SRITGL+VEEKMK LSPVM
Sbjct  905   VSELFTRELTRYIEETEELAMNGLKNNRHILDLITEELLEKSRITGLEVEEKMKDLSPVM  964

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QINLEE+GPLPHN++LRY+PLD+YPAPLHR
Sbjct  965   FEDFVKPFQINLEEDGPLPHNDQLRYQPLDIYPAPLHR  1002



>ref|XP_007213697.1| hypothetical protein PRUPE_ppa000789mg [Prunus persica]
 gb|EMJ14896.1| hypothetical protein PRUPE_ppa000789mg [Prunus persica]
Length=1003

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+NSRLGLTALTK+VGL DRPD+PDGE+I+Y+WDDP+VIPANMT+E
Sbjct  845   LEKITKIAREMVISPQNSRLGLTALTKRVGLVDRPDNPDGELIRYRWDDPHVIPANMTLE  904

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAM GL  NRH LD+I  ELLE+SRITGL+V EKMK LSPVM
Sbjct  905   VSELFTRELTRYIEETEELAMNGLKNNRHILDLITEELLEKSRITGLEVVEKMKDLSPVM  964

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QINLEE+GPLPHN+RLRY+PLD+YPAPLHR
Sbjct  965   FEDFVKPFQINLEEDGPLPHNDRLRYQPLDIYPAPLHR  1002



>ref|XP_007022616.1| FTSH protease 12 isoform 2 [Theobroma cacao]
 ref|XP_007022617.1| FTSH protease 12 isoform 2 [Theobroma cacao]
 gb|EOY14141.1| FTSH protease 12 isoform 2 [Theobroma cacao]
 gb|EOY14142.1| FTSH protease 12 isoform 2 [Theobroma cacao]
Length=778

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT LTK+VGL DRPD PDGE+IKY+WDDP+VIPANMT+E
Sbjct  620  LEKITKIAREMVISPQNARLGLTQLTKRVGLLDRPDSPDGELIKYRWDDPHVIPANMTLE  679

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELA+  L  NRH LD+I  ELLE+SRITGL+VEEKMKGLSPVM
Sbjct  680  VSELFTRELTRYIEETEELAINALKDNRHILDMIAKELLEESRITGLEVEEKMKGLSPVM  739

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL+EEGPLP N+ LRY+P+D+YPAPLHR
Sbjct  740  FEDFVKPFQINLDEEGPLPRNDHLRYQPVDIYPAPLHR  777



>ref|XP_008372001.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Malus domestica]
Length=1003

 Score =   274 bits (700),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+NSRLGLT+LTK+VGL DRPD PDGE+I+Y+WDDP+VIPANMT+E
Sbjct  845   LEKITKIAREMVISPQNSRLGLTSLTKRVGLVDRPDSPDGELIRYRWDDPHVIPANMTLE  904

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAM GL  NRH LD+I+ ELLE+SRITGL+VEEK+K LSPVM
Sbjct  905   VSELFTRELTRYIEETEELAMNGLRNNRHILDMIIKELLEKSRITGLEVEEKIKDLSPVM  964

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QI+LE++GPLPHN++LRY+PLD+YPAPLHR
Sbjct  965   FEDFVKPFQIDLEKDGPLPHNDQLRYKPLDIYPAPLHR  1002



>gb|KJB81418.1| hypothetical protein B456_013G144900 [Gossypium raimondii]
Length=990

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT LTK+VGL DRPD PDGE+IKY+WDDP+VIPANMT+E
Sbjct  832  LEKITKIAREMVISPQNARLGLTQLTKRVGLLDRPDSPDGELIKYRWDDPHVIPANMTLE  891

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELF+RELTRYIEETEELA+  L  NRH LD+I  ELLE+SRITGL+VEEK+KGL PVM
Sbjct  892  VSELFSRELTRYIEETEELAINALKDNRHILDMIAKELLEKSRITGLEVEEKIKGLYPVM  951

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL+EEGPLPHN+RLRY+PLD+YPAPLHR
Sbjct  952  FEDFVKPFQINLDEEGPLPHNDRLRYQPLDIYPAPLHR  989



>ref|XP_007022615.1| FTSH protease 12 isoform 1 [Theobroma cacao]
 gb|EOY14140.1| FTSH protease 12 isoform 1 [Theobroma cacao]
Length=998

 Score =   271 bits (693),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT LTK+VGL DRPD PDGE+IKY+WDDP+VIPANMT+E
Sbjct  840  LEKITKIAREMVISPQNARLGLTQLTKRVGLLDRPDSPDGELIKYRWDDPHVIPANMTLE  899

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELA+  L  NRH LD+I  ELLE+SRITGL+VEEKMKGLSPVM
Sbjct  900  VSELFTRELTRYIEETEELAINALKDNRHILDMIAKELLEESRITGLEVEEKMKGLSPVM  959

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL+EEGPLP N+ LRY+P+D+YPAPLHR
Sbjct  960  FEDFVKPFQINLDEEGPLPRNDHLRYQPVDIYPAPLHR  997



>gb|EYU27570.1| hypothetical protein MIMGU_mgv1a000728mg [Erythranthe guttata]
Length=1001

 Score =   270 bits (691),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISPRN RLGLTALTK++GL DRPD+PDGE I+YKWDDP+VIPANMTVE
Sbjct  843  LEKITKIAREMVISPRNPRLGLTALTKRIGLVDRPDNPDGERIRYKWDDPHVIPANMTVE  902

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELF RELTRYI+ETEELAMKGL  N+H LD I  +LL+ SRITGL+VEE+MKGLSP+M
Sbjct  903  VSELFMRELTRYIDETEELAMKGLRDNKHILDAIAQQLLDNSRITGLEVEERMKGLSPIM  962

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINLEEEGP+PHN+RLRY+  D+YPAPLHR
Sbjct  963  FEDFVKPFQINLEEEGPMPHNDRLRYQAPDIYPAPLHR  1000



>ref|XP_011095724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Sesamum indicum]
Length=1005

 Score =   270 bits (690),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISPRN RLGLTALTK++GL DRPD+PDGE+I+YKWDDP+VIPANMT+E
Sbjct  847   LEKITKIAREMVISPRNPRLGLTALTKRIGLVDRPDNPDGEVIRYKWDDPHVIPANMTLE  906

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTREL RYI+E EELAMKGL  NRH LD+I  ELLE SRITGL+V+E+M+ LSP+M
Sbjct  907   VSELFTRELARYIDEAEELAMKGLKDNRHILDMIARELLEHSRITGLEVQERMRELSPIM  966

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QINL+E+GPLPHN+ LR++PLD+YPAPLHR
Sbjct  967   FEDFVKPFQINLDEDGPLPHNDHLRFKPLDIYPAPLHR  1004



>gb|KDO61549.1| hypothetical protein CISIN_1g005284mg [Citrus sinensis]
 gb|KDO61550.1| hypothetical protein CISIN_1g005284mg [Citrus sinensis]
Length=704

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGL  LT++VGL DRPD  DG++IKY+WDDP VIP +MT+E
Sbjct  528  LEKITKIAREMVISPQNARLGLAGLTRRVGLLDRPDSSDGDLIKYRWDDPQVIPTDMTLE  587

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEELAM GL  N+H L+II  ELLE SRITGL+VEEK++GLSPVM
Sbjct  588  LSELFTRELTRYIEETEELAMNGLRDNKHILEIIAKELLENSRITGLEVEEKLQGLSPVM  647

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL+EEGPLPHN+RLRY+PLD+YPAPLHR
Sbjct  648  FEDFVKPFQINLQEEGPLPHNDRLRYKPLDIYPAPLHR  685



>gb|KDO61551.1| hypothetical protein CISIN_1g005284mg [Citrus sinensis]
Length=686

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGL  LT++VGL DRPD  DG++IKY+WDDP VIP +MT+E
Sbjct  528  LEKITKIAREMVISPQNARLGLAGLTRRVGLLDRPDSSDGDLIKYRWDDPQVIPTDMTLE  587

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEELAM GL  N+H L+II  ELLE SRITGL+VEEK++GLSPVM
Sbjct  588  LSELFTRELTRYIEETEELAMNGLRDNKHILEIIAKELLENSRITGLEVEEKLQGLSPVM  647

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL+EEGPLPHN+RLRY+PLD+YPAPLHR
Sbjct  648  FEDFVKPFQINLQEEGPLPHNDRLRYKPLDIYPAPLHR  685



>ref|XP_010260593.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Nelumbo nucifera]
Length=1007

 Score =   270 bits (689),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISPRNSRLGLT LTK+VGL DRPD PDGE+IKYKWDDP VIPA+MTVE
Sbjct  849   LEKITKIAREMVISPRNSRLGLTTLTKRVGLMDRPDSPDGEMIKYKWDDPDVIPADMTVE  908

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEE AM GL  NRH LD+I  EL+E+SRITGL+VEE+MK +SP M
Sbjct  909   VSELFTRELTRYIEETEEFAMNGLKQNRHILDMIARELVEKSRITGLEVEERMKEMSPTM  968

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFV+P+QINLEE+G LPHN+RLRY+PLD+YPAPLHR
Sbjct  969   FEDFVQPFQINLEEDGRLPHNDRLRYQPLDIYPAPLHR  1006



>ref|XP_004306570.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=993

 Score =   269 bits (687),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EK+TKIAREMVISP+NSRLGLTALTK++GL DRPD PDGE+I+Y+W+DP VIPANMT+E
Sbjct  835  LEKLTKIAREMVISPQNSRLGLTALTKRIGLMDRPDSPDGELIRYRWEDPNVIPANMTLE  894

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM GL  NRH LD+I  EL+E+SRITGL+V EKMK LSPVM
Sbjct  895  VSELFTRELTRYIEETEELAMNGLRNNRHILDMITEELMEKSRITGLEVIEKMKDLSPVM  954

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            F+DFVKP+QINLEE+GPLPHN++LRY+PLD+YPAPLHR
Sbjct  955  FDDFVKPFQINLEEDGPLPHNDQLRYKPLDIYPAPLHR  992



>ref|XP_011013846.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Populus euphratica]
Length=1003

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREM ISP+N++LGLTALTK+VGL DRPD+PDGE+IKY+WDDP+VIPANMT+E
Sbjct  846   LEKITKIAREMAISPQNAKLGLTALTKRVGLMDRPDNPDGELIKYRWDDPHVIPANMTLE  905

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRE+ RY+EETEELAM+GL  NRH LD+I  ELLE+SRITGL VE+ MK LSP M
Sbjct  906   VSELFTREMARYVEETEELAMEGLRNNRHVLDVITKELLEKSRITGLDVEDLMKELSPTM  965

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QIN++EEGPLPHN++LRY+PLD+YPAPLHR
Sbjct  966   FEDFVKPFQINIDEEGPLPHNDKLRYQPLDIYPAPLHR  1003



>ref|XP_012087358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Jatropha curcas]
Length=999

 Score =   266 bits (679),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT+LTK+VGL DRPD PD  +IKYKWDDP+VIPANMT+E
Sbjct  842  LEKITKIAREMVISPQNARLGLTSLTKRVGLMDRPDSPDSGLIKYKWDDPHVIPANMTLE  901

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELA+KGL  N H LD+I  ELLE+SRITGL+VEE MKGLSP M
Sbjct  902  VSELFTRELTRYIEETEELALKGLRNNMHILDVITKELLEKSRITGLEVEEIMKGLSPTM  961

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL+EE PLPHN++LRY+PLDV+PAPLHR
Sbjct  962  FEDFVKPFQINLKEEEPLPHNDKLRYQPLDVHPAPLHR  999



>ref|XP_002513356.1| Cell division protein ftsH, putative [Ricinus communis]
 gb|EEF48759.1| Cell division protein ftsH, putative [Ricinus communis]
Length=993

 Score =   264 bits (675),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT+LTK+VGL DRPD  DG +IKY+WDDP+VIP+NMT+E
Sbjct  835  LEKITKIAREMVISPQNARLGLTSLTKRVGLMDRPDSSDGGLIKYRWDDPHVIPSNMTLE  894

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM GL  N H LD++  ELL++SRITGL+VEE MKGLSP M
Sbjct  895  VSELFTRELTRYIEETEELAMIGLRDNMHILDVLAKELLDKSRITGLEVEEIMKGLSPTM  954

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN++EEGPLPHN++LRY+PLD+YPAPLHR
Sbjct  955  FEDFVKPFQINIDEEGPLPHNDKLRYQPLDIYPAPLHR  992



>ref|XP_006422287.1| hypothetical protein CICLE_v10004242mg [Citrus clementina]
 ref|XP_006493752.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Citrus sinensis]
 gb|ESR35527.1| hypothetical protein CICLE_v10004242mg [Citrus clementina]
Length=1000

 Score =   264 bits (675),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGL  LT++VGL DRPD  DG++IKY+WDDP VIP +MT+E
Sbjct  842  LEKITKIAREMVISPQNARLGLAGLTRRVGLLDRPDSSDGDLIKYRWDDPQVIPTDMTLE  901

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEELAM GL  N+H L+II  ELLE SRITGL+VEEK++GLSPVM
Sbjct  902  LSELFTRELTRYIEETEELAMNGLRDNKHILEIIAKELLENSRITGLEVEEKLQGLSPVM  961

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL+EEGPLPHN+RLRY+PLD+YPAPLHR
Sbjct  962  FEDFVKPFQINLQEEGPLPHNDRLRYKPLDIYPAPLHR  999



>emb|CDP18086.1| unnamed protein product [Coffea canephora]
Length=782

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP N RLGLTALT+++GL +RPD+PD E+I YKWDDP+VIPA+MTVE
Sbjct  624  LEKITKIAREMVISPGNPRLGLTALTRRLGLVERPDNPDRELITYKWDDPHVIPADMTVE  683

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTREL RYIEETEE AMK LM NRH LD+I  ELLE SRITGL+VEEK++G SP M
Sbjct  684  VSELFTRELARYIEETEEFAMKKLMENRHILDMIAKELLEHSRITGLEVEEKIRGQSPCM  743

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QINL E+GPLPHN+ +RY+PLD+YPAPLHR
Sbjct  744  FEDFVKPFQINLAEDGPLPHNDGVRYQPLDIYPAPLHR  781



>ref|XP_003530406.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Glycine max]
Length=982

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N +LGL ALTK+VGL DRPD PDGE+I+Y+WDDP VIPANMT+E
Sbjct  824  LEKITKIAREMVISPQNKKLGLIALTKRVGLNDRPDSPDGELIRYRWDDPQVIPANMTLE  883

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L  NRH LD+IV ELLE+SRITGL+VEEK+K +SPVM
Sbjct  884  VSELFTRELTRYIEETEELAMNALRNNRHILDLIVRELLERSRITGLEVEEKLKEMSPVM  943

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN +E+GPLPHN+RLRY+  D+YPAPLHR
Sbjct  944  FEDFVKPFQINPDEKGPLPHNDRLRYQLPDLYPAPLHR  981



>ref|XP_008805979.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Phoenix dactylifera]
Length=1014

 Score =   259 bits (661),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKIT+IAREMVISPRNSRLGL  L K+VG+ DRPD PDGE+IKYKWDDPYVIPA MT E
Sbjct  856   LEKITRIAREMVISPRNSRLGLATLVKRVGMMDRPDSPDGELIKYKWDDPYVIPAEMTPE  915

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYI ETEELAM GL+ NRH LD+I  ELLE+SRITGL+VEEKMK + PVM
Sbjct  916   VSELFTRELTRYIGETEELAMNGLLQNRHILDMIARELLEKSRITGLEVEEKMKQMFPVM  975

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
              +D  +P+QINL+EEGPLP N+RLRY+PLDVYPAPLHR
Sbjct  976   LQDLAEPFQINLDEEGPLPVNSRLRYQPLDVYPAPLHR  1013



>emb|CDP16393.1| unnamed protein product [Coffea canephora]
Length=149

 Score =   238 bits (607),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  749  MVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVEVSELFTRELT  570
            MVISP N RLGLTALT+++GL +RPD+PD E+I YKWDDP+VIPA+MTVEVSELFTREL 
Sbjct  1    MVISPGNPRLGLTALTRRLGLVERPDNPDRELITYKWDDPHVIPADMTVEVSELFTRELA  60

Query  569  RYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVMFEDFVKPYQI  390
            RYIEETEE AMK LM NRH LD++  ELLE SRITGL+VEEKM+G SP MFEDFVKP+QI
Sbjct  61   RYIEETEEFAMKKLMENRHILDMVAKELLEHSRITGLEVEEKMRGQSPRMFEDFVKPFQI  120

Query  389  NLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            NL E+ PLP+N+R+RY+PLD+YPAPLHR
Sbjct  121  NLAEDAPLPNNDRVRYQPLDIYPAPLHR  148



>gb|EPS74203.1| hypothetical protein M569_00544, partial [Genlisea aurea]
Length=926

 Score =   256 bits (655),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +E+ITKIAREMVISP+N RLGLTALT+++GL DRPD PDGEII+YKWDDP+VIP NM++E
Sbjct  769  LERITKIAREMVISPQNPRLGLTALTRRIGLADRPDSPDGEIIRYKWDDPHVIPENMSLE  828

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELF RELTRYI+ETEELAMKGL  NRH LD I  +LLEQSRITGL+VEEKMKGLS +M
Sbjct  829  VSELFVRELTRYIDETEELAMKGLRDNRHILDTIATQLLEQSRITGLEVEEKMKGLSAIM  888

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN +++ PL  N+R+RY PLD++PAPLHR
Sbjct  889  FEDFVKPFQINPQQDEPLACNDRVRYRPLDIFPAPLHR  926



>ref|XP_010936478.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=1013

 Score =   257 bits (657),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKIT+IAREMVISPRNSRLGL  L K+VG+ DRPD PDGE+IKYKWDDPYVIPA+MT E
Sbjct  855   LEKITRIAREMVISPRNSRLGLATLVKRVGMMDRPDSPDGELIKYKWDDPYVIPADMTPE  914

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYI+ETEELAM GL+ NR+ LD+I  ELLE+SRITGL+V+EKMK + PVM
Sbjct  915   VSELFTRELTRYIDETEELAMNGLLQNRYILDVIARELLEKSRITGLEVKEKMKQMFPVM  974

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
              +D  +P+QINL+EEGPLP N+RLRY+PLDVYPAPLHR
Sbjct  975   LQDLAEPFQINLDEEGPLPVNSRLRYQPLDVYPAPLHR  1012



>ref|XP_006389875.1| hypothetical protein EUTSA_v100180711mg, partial [Eutrema salsugineum]
 gb|ESQ27161.1| hypothetical protein EUTSA_v100180711mg, partial [Eutrema salsugineum]
Length=159

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  761  IAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVEVSELFT  582
            IAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VEVSELFT
Sbjct  7    IAREMVISPQNARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSVEVSELFT  66

Query  581  RELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVMFEDFVK  402
            RELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VE KMK LSP+MFEDFVK
Sbjct  67   RELTRYIEETEELAMNALRANRHILDLITRELLERSRITGLEVEGKMKDLSPLMFEDFVK  126

Query  401  PYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            P+QI+ +EE PLPH +R+ Y+P+D+ PAPLHR
Sbjct  127  PFQIDADEEEPLPHKDRVSYQPIDLRPAPLHR  158



>ref|XP_010537801.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Tarenaya hassleriana]
Length=1007

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKI REMVISP+N+RLGLT LTKK+GL +RPD+PDGE++K++WDDP+VIPA+M++E
Sbjct  849   LEKITKIGREMVISPQNARLGLTQLTKKLGLVNRPDNPDGELMKFRWDDPHVIPADMSIE  908

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELA+  L ANRH LD+I  ELLE+SRITGL+VEEKMKGLSPVM
Sbjct  909   VSELFTRELTRYIEETEELAVNALRANRHILDLIAGELLEKSRITGLEVEEKMKGLSPVM  968

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QIN +E  PLPH +R+RY+PLD+ PAPLHR
Sbjct  969   FEDFVKPFQINPDEGEPLPHKDRVRYQPLDLRPAPLHR  1006



>ref|XP_010693321.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=985

 Score =   255 bits (651),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIARE+VISP N+RLGLTALT+K GL D+PD PDGE+IKYKWDDP VIPA MT+E
Sbjct  827  LEKITKIAREIVISPNNARLGLTALTRKNGLLDQPDSPDGELIKYKWDDPNVIPAEMTLE  886

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEE+EELAMKGL  NRH LD I  ELLE+SRITGL V E++K LSP M
Sbjct  887  VSELFTRELTRYIEESEELAMKGLKENRHILDAISKELLEKSRITGLDVGERVKRLSPKM  946

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             EDFVKPYQI+++E+GPLPHN R+RY+PLD+YPAPLHR
Sbjct  947  MEDFVKPYQIDIDEDGPLPHNERIRYQPLDIYPAPLHR  984



>ref|XP_010064082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Eucalyptus grandis]
 gb|KCW71389.1| hypothetical protein EUGRSUZ_F04462 [Eucalyptus grandis]
Length=995

 Score =   253 bits (647),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKIT+IAREMVISP+N+RLGL  LTK+VGL DRPD PDGE+IKY+WDDP V+PA+M++E
Sbjct  837  LEKITRIAREMVISPQNARLGLAFLTKRVGLLDRPDSPDGELIKYRWDDPNVVPADMSLE  896

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEELAMKGLM NRH LDII ++LLE SRITGL+VEE M+ +   M
Sbjct  897  LSELFTRELTRYIEETEELAMKGLMENRHILDIIADKLLEDSRITGLEVEELMRHVPVSM  956

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FED VKP+QINL+E+GPLPH ++LRY+PLDVYPAPLHR
Sbjct  957  FEDLVKPFQINLDEDGPLPHKDKLRYKPLDVYPAPLHR  994



>ref|XP_007133424.1| hypothetical protein PHAVU_011G177500g [Phaseolus vulgaris]
 gb|ESW05418.1| hypothetical protein PHAVU_011G177500g [Phaseolus vulgaris]
Length=975

 Score =   251 bits (640),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N +LGL  LTK+VGL DRPD PDGE+I+Y+WDDP+VIPA+MT+E
Sbjct  817  LEKITKIAREMVISPQNKKLGLIGLTKRVGLIDRPDSPDGELIRYRWDDPHVIPADMTLE  876

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELF+REL+RYIEETEELAM  L  NRH LD+I  ELLE+SR+TGL+VEEK+K  SPVM
Sbjct  877  VSELFSRELSRYIEETEELAMNALRNNRHILDLITKELLERSRVTGLEVEEKLKEHSPVM  936

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN +EEGPLPHN+RLRY   D+YPAPLHR
Sbjct  937  FEDFVKPFQINPDEEGPLPHNDRLRYHLPDLYPAPLHR  974



>ref|XP_008456301.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 12, chloroplastic [Cucumis melo]
Length=1001

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+NSRLGL ALTK++G+ D+ D+PDGE+I+Y+WDDP VIPANMT+E
Sbjct  843  LEKITKIAREMVISPQNSRLGLAALTKRIGMPDQTDNPDGELIRYRWDDPRVIPANMTLE  902

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELF+RELTRYIEETEELAM GL  NRH LD+I  ELL ++RITGL+V EKMK LSP M
Sbjct  903  LSELFSRELTRYIEETEELAMNGLRENRHILDMIAEELLFKTRITGLEVIEKMKDLSPSM  962

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QI+L+ EG LPH ++LR++PLD+YPAPLHR
Sbjct  963  FEDFVKPFQIDLDVEGALPHKDKLRFQPLDIYPAPLHR  1000



>ref|XP_010429850.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Camelina sativa]
Length=1009

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VE
Sbjct  851   LEKITKIAREMVISPQNARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSVE  910

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEK+KGLSP+M
Sbjct  911   VSELFTRELTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKIKGLSPLM  970

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QIN ++E  LPH +R+ Y+P+D+ PAPLHR
Sbjct  971   FEDFVKPFQINADDEELLPHKDRVSYQPVDLRPAPLHR  1008



>ref|XP_009104519.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Brassica rapa]
Length=1008

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+N++LGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M++E
Sbjct  850   LEKITKIAREMVISPQNTKLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSIE  909

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEE MK LSP+M
Sbjct  910   VSELFTRELTRYIEETEELAMNALRANRHILDLITGELLERSRITGLEVEEIMKSLSPLM  969

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QIN +EE PLPH +R+ Y+P+D+ PAPLHR
Sbjct  970   FEDFVKPFQINADEEEPLPHKDRVSYQPIDLRPAPLHR  1007



>ref|XP_010417622.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Camelina sativa]
Length=1009

 Score =   247 bits (631),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VE
Sbjct  851   LEKITKIAREMVISPQNARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSVE  910

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEK+KGLSP+M
Sbjct  911   VSELFTRELTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKIKGLSPLM  970

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QIN + E  LPH +R+ Y+P+D+ PAPLHR
Sbjct  971   FEDFVKPFQINADNEELLPHKDRVSYQPVDLRPAPLHR  1008



>emb|CDX79327.1| BnaC06g19760D [Brassica napus]
Length=950

 Score =   246 bits (627),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N++LGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M++E
Sbjct  792  LEKITKIAREMVISPQNTKLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSIE  851

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEKMK LSP+M
Sbjct  852  VSELFTRELTRYIEETEELAMNALRANRHILDLITGELLERSRITGLEVEEKMKSLSPLM  911

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN +EE PLP  +R+ Y+P+D+ PAPLHR
Sbjct  912  FEDFVKPFQINADEEEPLPPKDRVSYQPIDLRPAPLHR  949



>ref|XP_009397211.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=1018

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             ++K+TKIAREMVISPRNSRLGLT L K+V   DRPD+PDGE+IK+KWDDP VIPA+MT E
Sbjct  860   LKKLTKIAREMVISPRNSRLGLTTLVKRVRRMDRPDNPDGELIKFKWDDPNVIPADMTPE  919

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAMKGL+ NRH LD I  ELLE+SRITGL+ +E++K +SPVM
Sbjct  920   VSELFTRELTRYIEETEELAMKGLLQNRHILDAIAIELLEKSRITGLEADERVKQMSPVM  979

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
              ED  +P+Q+NL+E+GPLP N  L+Y+PLD+YPAPLHR
Sbjct  980   LEDLAQPFQVNLDEDGPLPVNKHLQYQPLDIYPAPLHR  1017



>gb|AAK59670.2| putative FtsH protease [Arabidopsis thaliana]
Length=646

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+++RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA M+VE
Sbjct  488  LEKITKIAREMVISPQSARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPAEMSVE  547

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEKMK LSP+M
Sbjct  548  VSELFTRELTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKMKDLSPLM  607

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN ++E  LPH +R+ Y+P+D+  APLHR
Sbjct  608  FEDFVKPFQINPDDEELLPHKDRVSYQPVDLRAAPLHR  645



>gb|KFK42356.1| hypothetical protein AALP_AA2G245500 [Arabis alpina]
Length=1000

 Score =   245 bits (625),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VE
Sbjct  842  LEKITKIAREMVISPQNARLGLTQLVKKLGMVDLPDNPDGELIKYRWDHPHVMPADMSVE  901

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VE KMK LSP+M
Sbjct  902  VSELFTRELTRYIEETEELAMNALRANRHILDLITRELLERSRITGLEVEGKMKDLSPLM  961

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QI+ +EE PLPH +++ Y+P+D+ PAPLHR
Sbjct  962  FEDFVKPFQIDADEEEPLPHKDQVSYQPIDLRPAPLHR  999



>emb|CDX67988.1| BnaA07g20280D [Brassica napus]
Length=950

 Score =   244 bits (623),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N++LGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M++E
Sbjct  792  LEKITKIAREMVISPQNTKLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSIE  851

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L ANR+ LD+I  ELLE+SRITGL+VEE MK LSP+M
Sbjct  852  VSELFTRELTRYIEETEELAMNALRANRNILDLITGELLERSRITGLEVEEIMKSLSPLM  911

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN +EE PLPH +R+ Y+P+D+ PAPLHR
Sbjct  912  FEDFVKPFQINADEEEPLPHKDRVSYQPIDLRPAPLHR  949



>ref|XP_004516247.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=989

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+NSRLGL ALT++VGL +RPD  D ++I+Y+WDDP VIP+ M+VE
Sbjct  831  LEKITKIAREMVISPQNSRLGLIALTERVGLAERPDVSDDDLIRYRWDDPQVIPSKMSVE  890

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEELAM  L  N+H LD++  ELLE+SRITGL+VEEK+K LSPVM
Sbjct  891  LSELFTRELTRYIEETEELAMNALRDNKHILDLVARELLEKSRITGLEVEEKVKRLSPVM  950

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+Q+N+EEEGPL HN+R+RY   D+Y APLHR
Sbjct  951  FEDFVKPFQVNVEEEGPLKHNDRVRYRAPDLYAAPLHR  988



>ref|XP_004516246.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=990

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+NSRLGL ALT++VGL +RPD  D ++I+Y+WDDP VIP+ M+VE
Sbjct  832  LEKITKIAREMVISPQNSRLGLIALTERVGLAERPDVSDDDLIRYRWDDPQVIPSKMSVE  891

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEELAM  L  N+H LD++  ELLE+SRITGL+VEEK+K LSPVM
Sbjct  892  LSELFTRELTRYIEETEELAMNALRDNKHILDLVARELLEKSRITGLEVEEKVKRLSPVM  951

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+Q+N+EEEGPL HN+R+RY   D+Y APLHR
Sbjct  952  FEDFVKPFQVNVEEEGPLKHNDRVRYRAPDLYAAPLHR  989



>ref|XP_011628477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Amborella trichopoda]
Length=1012

 Score =   241 bits (615),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKI+KI REMVISPRN+RLGLTAL K+ G+ + PD PDGE+IKYKW+DP+VIP +MT E
Sbjct  854   LEKISKIGREMVISPRNARLGLTALIKRYGVTESPDSPDGELIKYKWEDPHVIPVDMTPE  913

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             +SELFTRELTRYIEETEE AM GLM NRH LD IV+ LLE+SR+TGL+V+E ++ ++P M
Sbjct  914   LSELFTRELTRYIEETEEYAMDGLMRNRHILDRIVDVLLERSRLTGLEVQEIVRQMNPSM  973

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             F+DFV+P+QINL+EEGP+P NN+LRY PLDVYPAPLHR
Sbjct  974   FDDFVEPFQINLDEEGPMPVNNKLRYRPLDVYPAPLHR  1011



>ref|NP_565212.1| cell division protease ftsH-12 [Arabidopsis thaliana]
 sp|Q9SAJ3.2|FTSHC_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 12, chloroplastic; 
Short=AtFTSH12; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAH20273.1| AT1G79560 [Arabidopsis thaliana]
 gb|AEE36264.1| cell division protease ftsH-12 [Arabidopsis thaliana]
Length=1008

 Score =   240 bits (613),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+++RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA M+VE
Sbjct  850   LEKITKIAREMVISPQSARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPAEMSVE  909

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEKMK LSP+M
Sbjct  910   VSELFTRELTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKMKDLSPLM  969

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QIN ++E  LPH +R+ Y+P+D+  APLHR
Sbjct  970   FEDFVKPFQINPDDEELLPHKDRVSYQPVDLRAAPLHR  1007



>gb|AAD30220.1|AC007202_2 Is a member of PF|00004 ATPases associated with various cellular 
activities (AAA) family. ESTs gb|T43031, gb|R64750, gb|AA394742 
and gb|AI100347 come from this gene [Arabidopsis thaliana]
Length=998

 Score =   240 bits (612),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+++RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA M+VE
Sbjct  840  LEKITKIAREMVISPQSARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPAEMSVE  899

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEKMK LSP+M
Sbjct  900  VSELFTRELTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKMKDLSPLM  959

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN ++E  LPH +R+ Y+P+D+  APLHR
Sbjct  960  FEDFVKPFQINPDDEELLPHKDRVSYQPVDLRAAPLHR  997



>ref|XP_010472815.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Camelina sativa]
Length=1008

 Score =   239 bits (611),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VE
Sbjct  850   LEKITKIAREMVISPQNARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSVE  909

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             VSELFTRE TRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEK+KGL+P+M
Sbjct  910   VSELFTREFTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKIKGLAPLM  969

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDFVKP+QIN ++E  LP  +R+ Y+ +D+ PAPLHR
Sbjct  970   FEDFVKPFQINADDEELLPRKDRVSYQSVDLRPAPLHR  1007



>ref|XP_002887790.1| EMB1047/FTSH12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64049.1| EMB1047/FTSH12 [Arabidopsis lyrata subsp. lyrata]
Length=994

 Score =   239 bits (610),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VE
Sbjct  836  LEKITKIAREMVISPQNARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVLPADMSVE  895

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEKMK LS +M
Sbjct  896  VSELFTRELTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKMKDLSLLM  955

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            FEDFVKP+QIN ++E  LPH +R+ Y+P+D+  APLHR
Sbjct  956  FEDFVKPFQINPDDEELLPHKDRVSYQPVDLRAAPLHR  993



>ref|XP_004139903.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Cucumis sativus]
 gb|KGN46798.1| hypothetical protein Csa_6G136520 [Cucumis sativus]
Length=1003

 Score =   239 bits (610),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  779   MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
             +EKITKIAREMVISP+NSRLGL ALTKK G+ D+PD+PDGE+I+Y WDDP V P NMT+E
Sbjct  845   LEKITKIAREMVISPQNSRLGLAALTKKFGMTDQPDNPDGELIRYTWDDPRVTPVNMTLE  904

Query  599   VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
             +SELF+REL RYIEETEELAM GL  N+H LD+I  ELL +SR+TGL+V EKMK L+P M
Sbjct  905   LSELFSRELARYIEETEELAMNGLRENKHILDMITEELLNKSRMTGLEVIEKMKDLAPSM  964

Query  419   FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
             FEDF+KP QI+L+ EG LPH ++LRY+PL +YPAPLHR
Sbjct  965   FEDFIKPIQIDLDVEGALPHKDKLRYQPLVIYPAPLHR  1002



>ref|XP_003628399.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AET02875.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=988

 Score =   238 bits (607),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N RLGL  LTK+VGL D+PD  D ++IKY+WDDP V+P  M+VE
Sbjct  830  LEKITKIAREMVISPQNKRLGLIGLTKRVGLADQPDASDDDLIKYRWDDPQVVPTKMSVE  889

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEELAM  L  N+H +D++  ELLE+SRITG +VEEKMK LSPVM
Sbjct  890  LSELFTRELTRYIEETEELAMNALRDNKHIVDMVARELLEKSRITGFEVEEKMKQLSPVM  949

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            F+DFVKP+Q++ EE+GPLPHN+ + Y   D+YPAPLHR
Sbjct  950  FDDFVKPFQVDCEEDGPLPHNDDIHYRTADLYPAPLHR  987



>ref|XP_010474496.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Camelina sativa]
Length=250

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VE
Sbjct  109  LEKITKIAREMVISPQNARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVMPADMSVE  168

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRE TRYIEETEELAM  L ANRH LD+I  ELLE+SRITGL+VEEK+KGL+P+M
Sbjct  169  VSELFTREFTRYIEETEELAMNALRANRHILDLITRELLEKSRITGLEVEEKIKGLAPLM  228

Query  419  FEDFVKPYQINLEE  378
            FEDFVKP+QIN ++
Sbjct  229  FEDFVKPFQINADD  242



>ref|XP_006303096.1| hypothetical protein CARUB_v100197241mg [Capsella rubella]
 gb|EOA35994.1| hypothetical protein CARUB_v100197241mg [Capsella rubella]
Length=978

 Score =   213 bits (541),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGLT L KK+G+ D PD+PDGE+IKY+WD P+V+PA+M+VE
Sbjct  843  LEKITKIAREMVISPQNARLGLTQLVKKIGMVDLPDNPDGELIKYRWDHPHVLPADMSVE  902

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTRELTRYIEETEELAM  L  NRH LD+I  ELLE+SRITGL+VEEK+KGLSP+M
Sbjct  903  VSELFTRELTRYIEETEELAMNALRTNRHILDLITRELLEKSRITGLEVEEKIKGLSPLM  962

Query  419  FEDFVKPYQINLEE  378
            F+DFVKP+QIN ++
Sbjct  963  FDDFVKPFQINADD  976



>gb|ERN19706.1| hypothetical protein AMTR_s00062p00195710 [Amborella trichopoda]
Length=1013

 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKI+KI REMVISPRN+RLGLTAL K+ G+ + PD PDGE+IKYKW+DP+VIP +MT E
Sbjct  854  LEKISKIGREMVISPRNARLGLTALIKRYGVTESPDSPDGELIKYKWEDPHVIPVDMTPE  913

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            +SELFTRELTRYIEETEE AM GLM NRH LD IV+ LLE+SR+TGL+V+E ++ ++P M
Sbjct  914  LSELFTRELTRYIEETEEYAMDGLMRNRHILDRIVDVLLERSRLTGLEVQEIVRQMNPSM  973

Query  419  FEDFVKPYQINLEEE  375
            F+DFV+P+QINL+E+
Sbjct  974  FDDFVEPFQINLDED  988



>gb|KDP25069.1| hypothetical protein JCGZ_22604 [Jatropha curcas]
Length=959

 Score =   195 bits (496),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  644  KWDDPYVIPANMTVEVSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRIT  465
            KWDDP+VIPANMT+EVSELFTRELTRYIEETEELA+KGL  N H LD+I  ELLE+SRIT
Sbjct  847  KWDDPHVIPANMTLEVSELFTRELTRYIEETEELALKGLRNNMHILDVITKELLEKSRIT  906

Query  464  GLKVEEKMKGLSPVMFEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            GL+VEE MKGLSP MFEDFVKP+QINL+EE PLPHN++LRY+PLDV+PAPLHR
Sbjct  907  GLEVEEIMKGLSPTMFEDFVKPFQINLKEEEPLPHNDKLRYQPLDVHPAPLHR  959



>emb|CBI17675.3| unnamed protein product [Vitis vinifera]
Length=166

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  749  MVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVEVSELFTRELT  570
            MVISP NSRLGLTALTK+VGL DRPD PDGE+IKY WDDP++IPANMT+EVSELF+RELT
Sbjct  1    MVISPANSRLGLTALTKRVGLMDRPDSPDGELIKYMWDDPFMIPANMTLEVSELFSRELT  60

Query  569  RYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSP  426
            RYIEETEE+AM GL  NRH LD+I NELLE SRITGL  E      SP
Sbjct  61   RYIEETEEIAMSGLKVNRHILDMITNELLENSRITGLVNEYVFFSHSP  108



>ref|XP_006378601.1| hypothetical protein POPTR_0010s17840g, partial [Populus trichocarpa]
 gb|ERP56398.1| hypothetical protein POPTR_0010s17840g, partial [Populus trichocarpa]
Length=257

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 20/133 (15%)
 Frame = -2

Query  650  KYKWDDPYVIPANMTVEVSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSR  471
            ++KWDDP+VIPANMT+EVSELFTRE+TRY+EETEELAM+GL  NRH LD+I  ELLE+SR
Sbjct  89   RWKWDDPHVIPANMTLEVSELFTREMTRYVEETEELAMEGLRNNRHILDVITKELLEKSR  148

Query  470  ITGLKVEEKMKGLSPVMFEDFVKPYQINLEE----------EGPLPH----------NNR  351
            ITGL+VE+ MK LSP MFEDFVKP+QINL+E             + H          N+ 
Sbjct  149  ITGLEVEDLMKELSPTMFEDFVKPFQINLDEVLRDRCHTMTSCDINHWTYILHHSTDNDT  208

Query  350  LRYEPLDVYPAPL  312
            L+Y+PL+ +  PL
Sbjct  209  LQYQPLNTHRGPL  221



>ref|XP_009341724.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 12, chloroplastic [Pyrus x bretschneideri]
Length=754

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 108/158 (68%), Gaps = 30/158 (19%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+NSR GLT+LTK+VG  DRPD PDGE+I+Y+WDDP     N+T+E
Sbjct  626  LEKITKIAREMVISPQNSRXGLTSLTKRVGHVDRPDSPDGELIRYRWDDP-----NVTLE  680

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSELFTR+L +YIEETEELAM GL  NRH LD  +                       ++
Sbjct  681  VSELFTRDL-QYIEETEELAMNGLTNNRHILDYFL--------------------CYSIL  719

Query  419  FEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
               F+    +N   +GPLPHN++LRY+PLD+YPAPL R
Sbjct  720  MLTFI---WLNF-LDGPLPHNDKLRYKPLDIYPAPLRR  753



>emb|CDP18092.1| unnamed protein product [Coffea canephora]
Length=92

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -2

Query  749  MVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVEVSELFTRELT  570
            MVISP N RLGLTALT+++GL +RPD+PD E+IKYKWDDP+VIPA+MTVEVSELFTREL 
Sbjct  1    MVISPGNPRLGLTALTRRLGLVERPDNPDRELIKYKWDDPHVIPADMTVEVSELFTRELA  60

Query  569  RYIEETEELAMKGLMANRHFLDIIVNELLEQS  474
            RYIEETEE AMK LM NRH LD+I  ELLE S
Sbjct  61   RYIEETEEFAMKKLMENRHILDMIAKELLEHS  92



>gb|KJB81419.1| hypothetical protein B456_013G144900 [Gossypium raimondii]
Length=925

 Score =   153 bits (387),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  578  ELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVMFEDFVKP  399
            ++T+YIEETEELA+  L  NRH LD+I  ELLE+SRITGL+VEEK+KGL PVMFEDFVKP
Sbjct  834  KITKYIEETEELAINALKDNRHILDMIAKELLEKSRITGLEVEEKIKGLYPVMFEDFVKP  893

Query  398  YQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            +QINL+EEGPLPHN+RLRY+PLD+YPAPLHR
Sbjct  894  FQINLDEEGPLPHNDRLRYQPLDIYPAPLHR  924



>gb|ABR16425.1| unknown [Picea sitchensis]
Length=1036

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 124/180 (69%), Gaps = 3/180 (2%)
 Frame = -2

Query  839   GVVLNELYFgdditdggtdDMEKITKIAREMVISPRNSRLGLTALTKKVGLGDRP-DDPD  663
             G    EL FGDDITDGG DD+E+I+ IARE+VISP N RLGL  LT   G  + P  + +
Sbjct  857   GRCAEELIFGDDITDGGRDDLERISSIARELVISPANPRLGLLRLTWN-GTYEAPFPNQE  915

Query  662   GEIIKYKWDDPYVIPANMTVEVSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELL  483
             G +IK +W+ P  + A+M+VE+SELFTRE+TRYIEETE+ A   L  NRH LD +  ELL
Sbjct  916   GNLIKNEWEKPGTVIADMSVELSELFTREVTRYIEETEQDAKNALRRNRHILDRLTAELL  975

Query  482   EQSRITGLKVEEKMKGLSPVMFEDFVKPYQINLEE-EGPLPHNNRLRYEPLDVYPAPLHR  306
             E+  I+GL+V+E +K ++PVM  D ++   +NL   E   P N R RYE LD+YPAPLHR
Sbjct  976   ERITISGLEVQEIVKSMNPVMMSDLMQMPDLNLGNMEISAPPNFRGRYEDLDIYPAPLHR  1035



>ref|XP_010654992.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Vitis vinifera]
Length=111

 Score =   130 bits (327),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP NSRLGLTALTK+VGL DRPD PDGE+IKY+WDDP+VIPANMT+E
Sbjct  27   LEKITKIAREMVISPANSRLGLTALTKRVGLMDRPDSPDGELIKYRWDDPFVIPANMTLE  86

Query  599  VSELFTRELTR  567
            VSELF+RELTR
Sbjct  87   VSELFSRELTR  97



>ref|XP_010497541.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like, 
partial [Camelina sativa]
Length=77

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -2

Query  683  DRPDDPDGEIIKYKWDDPYVIPANMTVEVSELFTRELTRYIEETEELAMKGLMANRHFLD  504
            D PD+PDGE+IKY+WD P+V+PA+M+VEVSELFTRE TRYIEETEELAM  L ANRH LD
Sbjct  3    DLPDNPDGELIKYRWDHPHVMPADMSVEVSELFTREFTRYIEETEELAMNALRANRHILD  62

Query  503  IIVNELLEQSRITGL  459
            +I  ELLE+SRITGL
Sbjct  63   LITRELLEKSRITGL  77



>emb|CDP21508.1| unnamed protein product, partial [Coffea canephora]
Length=613

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP N RLGLTALT+++GL +RPD+PD E+I YKWDDP+VIPA+MTVE
Sbjct  528  LEKITKIAREMVISPGNPRLGLTALTRRLGLVERPDNPDRELITYKWDDPHVIPADMTVE  587

Query  599  VSELFTRELTRYIE  558
            VSELFTREL R  E
Sbjct  588  VSELFTRELARVSE  601



>gb|KDO61552.1| hypothetical protein CISIN_1g005284mg [Citrus sinensis]
Length=612

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKITKIAREMVISP+N+RLGL  LT++VGL DRPD  DG++IKY+WDDP VIP +MT+E
Sbjct  528  LEKITKIAREMVISPQNARLGLAGLTRRVGLLDRPDSSDGDLIKYRWDDPQVIPTDMTLE  587

Query  599  VSELFTRELTRYI  561
            +SELFTRELTR I
Sbjct  588  LSELFTRELTRVI  600



>ref|XP_001760369.1| predicted protein [Physcomitrella patens]
 gb|EDQ74760.1| predicted protein [Physcomitrella patens]
Length=637

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 97/161 (60%), Gaps = 14/161 (9%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLG--DRPDDPDGEIIKYKWDDPYVIPANMT  606
            ++KI+ IARE+ IS  NS  GL  +  +  L    RPD+ D  +I  +WD P     NM+
Sbjct  487  LQKISGIARELTISLSNSTFGLFPMKWQETLDPPKRPDETD--LIPNEWDKPGSQIVNMS  544

Query  605  VEVSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSP  426
             E SELFTRE+T+YI+ETEE AM+ L  N H L  +  ELL +++++G + E+ ++ + P
Sbjct  545  TEFSELFTREVTKYIDETEEKAMEALRKNEHILRRLSEELLAKTKLSGFEAEDIIRSMDP  604

Query  425  VMFED-FVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            +M +D  ++P   +          +R RY+ L +YPAPLHR
Sbjct  605  IMMDDPLLEPMDTD---------EDRGRYKELVIYPAPLHR  636



>emb|CDP21523.1| unnamed protein product, partial [Coffea canephora]
Length=586

 Score = 97.8 bits (242),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTV  603
            +EKITKIAREMVISP N RLGLTALT+++GL +RPD+PD E+I YKWDDP+VIPA+MTV
Sbjct  528  LEKITKIAREMVISPGNPRLGLTALTRRLGLVERPDNPDRELITYKWDDPHVIPADMTV  586


 Score = 28.1 bits (61),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 11/11 (100%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
 Frame = -1

Query  846  HGGRCAERIVF  814
            HGGRCAERIVF
Sbjct  506  HGGRCAERIVF  516



>emb|CDP18093.1| unnamed protein product [Coffea canephora]
Length=84

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  458  KVEEKMKGLSPVMFEDFVKPYQINLEEEGPLPHNNRLRYEPLDVYPAPLHR  306
            +VEEKM+G SP MFEDFV+P+QINL E+GP PHN+ +RY+PLD+YPAPLHR
Sbjct  33   EVEEKMRGQSPRMFEDFVRPFQINLAEDGPWPHNDHVRYQPLDIYPAPLHR  83



>emb|CBI39361.3| unnamed protein product [Vitis vinifera]
Length=80

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  611  MTVEVSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGL  459
            MT+EVSELF+RELTRYIEETEE+AM GL  NRH LD+I NELLE SRIT L
Sbjct  1    MTLEVSELFSRELTRYIEETEEIAMSGLKVNRHILDMITNELLENSRITRL  51



>ref|XP_002992029.1| hypothetical protein SELMODRAFT_430300 [Selaginella moellendorffii]
 gb|EFJ06878.1| hypothetical protein SELMODRAFT_430300 [Selaginella moellendorffii]
Length=984

 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 88/162 (54%), Gaps = 7/162 (4%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKI+ +ARE  + P N  LGL  + +K         P+ E+    W+ P  I   MT+E
Sbjct  825  LEKISALARECAVHPENRNLGLLQVARKPLPPRPRPRPE-ELYPMTWNHPRSIVIPMTLE  883

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITGLKVEEKMKGLSPVM  420
            VSEL  RE+  +I++TE++AMK L  NRH L+ +  EL    ++TG ++++ +  ++PV+
Sbjct  884  VSELVGREIQMFIDDTEKMAMKALQNNRHILERLARELELNIKMTGDEIKDIVHSMNPVL  943

Query  419  FEDFVKPYQINLEEEGPL-PHNNRLR---YEPLDVYPAPLHR  306
              D   P   +  +  P+ P    +R   Y  LDVY   LHR
Sbjct  944  LPDIGGP--PDFSKAVPIDPTPEEIRDGYYRDLDVYADRLHR  983



>ref|XP_002964495.1| hypothetical protein SELMODRAFT_81522, partial [Selaginella moellendorffii]
 gb|EFJ34828.1| hypothetical protein SELMODRAFT_81522, partial [Selaginella moellendorffii]
Length=616

 Score = 66.6 bits (161),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 61/106 (58%), Gaps = 1/106 (1%)
 Frame = -2

Query  779  MEKITKIAREMVISPRNSRLGLTALTKKVGLGDRPDDPDGEIIKYKWDDPYVIPANMTVE  600
            +EKI+ +ARE  + P N  LGL  + +K         P+ E+    W+ P  I   MT+E
Sbjct  485  LEKISALARECAVHPENRNLGLLQVARKPLPPRPRPRPE-ELYPMTWNHPRSIVIPMTLE  543

Query  599  VSELFTRELTRYIEETEELAMKGLMANRHFLDIIVNELLEQSRITG  462
            VSEL  RE+  +I++TE++AMK L  NRH L+ +  EL    ++TG
Sbjct  544  VSELVGREIQMFIDDTEKMAMKALQNNRHILERLARELELNIKMTG  589



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1867489308488