BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12523

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230770.1|  PREDICTED: U-box domain-containing protein 2...    344   2e-113   Solanum lycopersicum
ref|XP_006346399.1|  PREDICTED: U-box domain-containing protein 2...    340   6e-112   Solanum tuberosum [potatoes]
ref|XP_011000686.1|  PREDICTED: U-box domain-containing protein 2...    334   2e-109   Populus euphratica
ref|XP_012078957.1|  PREDICTED: U-box domain-containing protein 2...    332   2e-108   Jatropha curcas
ref|XP_002313124.2|  U-box domain-containing family protein             331   3e-108   Populus trichocarpa [western balsam poplar]
ref|XP_010107920.1|  U-box domain-containing protein 26                 331   3e-108   Morus notabilis
gb|ABK93469.1|  unknown                                                 331   3e-108   Populus trichocarpa [western balsam poplar]
ref|XP_009627648.1|  PREDICTED: U-box domain-containing protein 2...    327   1e-106   Nicotiana tomentosiformis
emb|CDO97189.1|  unnamed protein product                                327   1e-106   Coffea canephora [robusta coffee]
ref|XP_011005992.1|  PREDICTED: U-box domain-containing protein 2...    324   1e-105   Populus euphratica
ref|XP_002306161.2|  hypothetical protein POPTR_0004s14720g             322   6e-105   Populus trichocarpa [western balsam poplar]
ref|XP_010270217.1|  PREDICTED: U-box domain-containing protein 2...    323   6e-105   Nelumbo nucifera [Indian lotus]
ref|XP_004309747.1|  PREDICTED: U-box domain-containing protein 26      320   5e-104   Fragaria vesca subsp. vesca
ref|XP_011092561.1|  PREDICTED: U-box domain-containing protein 2...    320   6e-104   Sesamum indicum [beniseed]
ref|XP_002285110.1|  PREDICTED: U-box domain-containing protein 26      319   1e-103   Vitis vinifera
ref|XP_011088242.1|  PREDICTED: U-box domain-containing protein 2...    318   2e-103   Sesamum indicum [beniseed]
ref|XP_009792112.1|  PREDICTED: U-box domain-containing protein 2...    318   4e-103   Nicotiana sylvestris
emb|CAN74163.1|  hypothetical protein VITISV_026443                     319   8e-103   Vitis vinifera
ref|XP_007042451.1|  Plant U-box 26                                     316   3e-102   
gb|EPS57772.1|  hypothetical protein M569_17045                         316   3e-102   Genlisea aurea
gb|KJB79347.1|  hypothetical protein B456_013G045000                    315   7e-102   Gossypium raimondii
ref|XP_008456137.1|  PREDICTED: U-box domain-containing protein 2...    314   2e-101   Cucumis melo [Oriental melon]
ref|XP_004140703.1|  PREDICTED: U-box domain-containing protein 2...    311   1e-100   Cucumis sativus [cucumbers]
ref|XP_010263503.1|  PREDICTED: U-box domain-containing protein 2...    309   1e-99    Nelumbo nucifera [Indian lotus]
ref|XP_007153588.1|  hypothetical protein PHAVU_003G048200g             306   1e-98    Phaseolus vulgaris [French bean]
ref|XP_008236490.1|  PREDICTED: U-box domain-containing protein 2...    307   1e-98    
ref|XP_007199948.1|  hypothetical protein PRUPE_ppa006352mg             306   1e-98    Prunus persica
ref|XP_009341339.1|  PREDICTED: U-box domain-containing protein 26      305   2e-98    
ref|XP_003529402.1|  PREDICTED: U-box domain-containing protein 2...    298   2e-95    
gb|AES90137.2|  plant U-box protein                                     298   2e-95    Medicago truncatula
ref|XP_008373128.1|  PREDICTED: U-box domain-containing protein 2...    298   2e-95    
ref|XP_004505237.1|  PREDICTED: U-box domain-containing protein 2...    298   3e-95    Cicer arietinum [garbanzo]
gb|KJB32363.1|  hypothetical protein B456_005G237200                    297   4e-95    Gossypium raimondii
ref|XP_006583889.1|  PREDICTED: U-box domain-containing protein 2...    297   1e-94    
ref|XP_003518699.1|  PREDICTED: U-box domain-containing protein 2...    295   2e-94    Glycine max [soybeans]
ref|XP_003607940.1|  U-box domain-containing protein                    295   9e-94    
gb|EPS67592.1|  hypothetical protein M569_07183                         293   2e-93    Genlisea aurea
ref|XP_006422990.1|  hypothetical protein CICLE_v10028522mg             290   2e-92    Citrus clementina [clementine]
ref|XP_006487052.1|  PREDICTED: U-box domain-containing protein 2...    288   2e-91    Citrus sinensis [apfelsine]
ref|XP_010690605.1|  PREDICTED: U-box domain-containing protein 26      285   3e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010538612.1|  PREDICTED: U-box domain-containing protein 2...    280   2e-88    Tarenaya hassleriana [spider flower]
ref|NP_175400.1|  U-box domain-containing protein 26                    275   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894216.1|  U-box domain-containing protein                    275   3e-86    Arabidopsis lyrata subsp. lyrata
dbj|BAC42960.1|  unknown protein                                        273   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500528.1|  PREDICTED: U-box domain-containing protein 2...    271   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010461826.1|  PREDICTED: U-box domain-containing protein 26      270   4e-84    Camelina sativa [gold-of-pleasure]
ref|XP_006306175.1|  hypothetical protein CARUB_v10011740mg             269   4e-84    Capsella rubella
ref|XP_009145797.1|  PREDICTED: U-box domain-containing protein 25      268   2e-83    Brassica rapa
ref|XP_006393215.1|  hypothetical protein EUTSA_v10011515mg             266   6e-83    Eutrema salsugineum [saltwater cress]
emb|CDY16513.1|  BnaA08g02540D                                          263   2e-81    Brassica napus [oilseed rape]
emb|CDY59286.1|  BnaCnng34640D                                          261   4e-81    Brassica napus [oilseed rape]
ref|XP_009107285.1|  PREDICTED: U-box domain-containing protein 26      263   6e-81    Brassica rapa
emb|CDX92328.1|  BnaA05g20790D                                          261   7e-81    
emb|CDX99233.1|  BnaC05g33480D                                          259   2e-80    
ref|XP_002518745.1|  Spotted leaf protein, putative                     258   6e-80    
ref|XP_009111906.1|  PREDICTED: U-box domain-containing protein 2...    258   8e-80    Brassica rapa
gb|ABV89622.1|  U-box domain-containing protein                         258   9e-80    Brassica rapa
emb|CDY50158.1|  BnaA01g26180D                                          257   2e-79    Brassica napus [oilseed rape]
ref|XP_006299353.1|  hypothetical protein CARUB_v10015518mg             257   3e-79    Capsella rubella
emb|CDX95458.1|  BnaC01g33500D                                          255   1e-78    
ref|XP_006406505.1|  hypothetical protein EUTSA_v10022190mg             254   3e-78    Eutrema salsugineum [saltwater cress]
gb|KFK35978.1|  hypothetical protein AALP_AA4G062500                    254   5e-78    Arabis alpina [alpine rockcress]
ref|XP_010468287.1|  PREDICTED: U-box domain-containing protein 2...    253   6e-78    
ref|XP_010466083.1|  PREDICTED: U-box domain-containing protein 25      253   9e-78    
dbj|BAF01749.1|  hypothetical protein                                   253   9e-78    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566632.1|  U-box domain-containing protein 25                    253   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885309.1|  hypothetical protein ARALYDRAFT_479456             251   4e-77    
ref|XP_010507691.1|  PREDICTED: U-box domain-containing protein 2...    251   7e-77    Camelina sativa [gold-of-pleasure]
gb|KFK39278.1|  hypothetical protein AALP_AA3G223600                    250   7e-77    Arabis alpina [alpine rockcress]
ref|XP_006847114.1|  PREDICTED: U-box domain-containing protein 26      249   1e-76    Amborella trichopoda
gb|EYU37659.1|  hypothetical protein MIMGU_mgv1a019070mg                221   2e-66    Erythranthe guttata [common monkey flower]
emb|CBI32390.3|  unnamed protein product                                189   2e-53    Vitis vinifera
ref|XP_009416906.1|  PREDICTED: U-box domain-containing protein 26      156   7e-41    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010481065.1|  PREDICTED: U-box domain-containing protein 2...    145   2e-37    Camelina sativa [gold-of-pleasure]
ref|XP_008784183.1|  PREDICTED: U-box domain-containing protein 2...    141   2e-35    Phoenix dactylifera
gb|ABK24171.1|  unknown                                                 134   2e-33    Picea sitchensis
ref|XP_001778934.1|  predicted protein                                  130   4e-33    
gb|ABK25582.1|  unknown                                                 135   4e-33    Picea sitchensis
ref|XP_004952703.1|  PREDICTED: U-box domain-containing protein 2...    130   1e-31    Setaria italica
dbj|BAJ97989.1|  predicted protein                                      130   2e-31    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009403520.1|  PREDICTED: U-box domain-containing protein 2...    129   3e-31    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS66308.1|  U-box domain-containing protein 25                      129   7e-31    Triticum urartu
gb|EMT28323.1|  U-box domain-containing protein 25                      128   1e-30    
ref|XP_010489938.1|  PREDICTED: U-box domain-containing protein 2...    125   2e-30    Camelina sativa [gold-of-pleasure]
ref|XP_009406118.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    126   4e-30    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001752821.1|  predicted protein                                  124   9e-29    
ref|XP_003575105.1|  PREDICTED: U-box domain-containing protein 2...    117   8e-27    Brachypodium distachyon [annual false brome]
ref|XP_001762017.1|  predicted protein                                  118   2e-26    
ref|XP_010912457.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    115   2e-26    
ref|XP_002974135.1|  ubiquitin-protein ligase, PUB26                    115   3e-26    
ref|XP_002968838.1|  ubiquitin-protein ligase, PUB26                    115   4e-26    
ref|XP_002453962.1|  hypothetical protein SORBIDRAFT_04g022280          110   1e-24    Sorghum bicolor [broomcorn]
ref|XP_002991371.1|  hypothetical protein SELMODRAFT_133552             110   1e-24    Selaginella moellendorffii
ref|XP_001776109.1|  predicted protein                                  107   2e-23    
ref|XP_002988236.1|  hypothetical protein SELMODRAFT_44944              107   2e-23    
ref|NP_001148065.1|  ubiquitin-protein ligase                           102   8e-22    
gb|AFW71736.1|  ubiquitin-protein ligase                                102   1e-21    
ref|NP_001047085.2|  Os02g0548700                                       101   2e-21    
dbj|BAD16187.1|  putative immediate-early fungal elicitor protein...    101   2e-21    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751378.1|  predicted protein                                95.1    2e-20    
ref|XP_004501176.1|  PREDICTED: uncharacterized protein LOC101503409  97.1    5e-20    Cicer arietinum [garbanzo]
ref|XP_003636449.1|  U-box domain-containing protein                  96.3    8e-20    
gb|KEH36040.1|  hypothetical protein MTR_3g110138                     95.1    2e-19    Medicago truncatula
ref|XP_003523734.1|  PREDICTED: U-box domain-containing protein 2...  94.0    5e-19    Glycine max [soybeans]
ref|XP_006476069.1|  PREDICTED: U-box domain-containing protein 2...  93.6    9e-19    Citrus sinensis [apfelsine]
ref|XP_002885649.1|  hypothetical protein ARALYDRAFT_899024           88.6    1e-18    
ref|XP_002976345.1|  hypothetical protein SELMODRAFT_416243           93.2    3e-18    Selaginella moellendorffii
ref|XP_002987240.1|  hypothetical protein SELMODRAFT_125560           92.8    4e-18    
ref|XP_002976407.1|  hypothetical protein SELMODRAFT_104879           92.8    4e-18    Selaginella moellendorffii
gb|EYU29273.1|  hypothetical protein MIMGU_mgv1a021565mg              91.7    4e-18    Erythranthe guttata [common monkey flower]
ref|XP_007137194.1|  hypothetical protein PHAVU_009G107700g           91.3    4e-18    Phaseolus vulgaris [French bean]
ref|XP_001764309.1|  predicted protein                                92.4    6e-18    
ref|XP_006826592.1|  PREDICTED: U-box domain-containing protein 21    90.9    1e-17    Amborella trichopoda
ref|XP_002308611.2|  hypothetical protein POPTR_0006s25710g           90.1    2e-17    Populus trichocarpa [western balsam poplar]
ref|XP_008466051.1|  PREDICTED: U-box domain-containing protein 26    89.4    2e-17    Cucumis melo [Oriental melon]
ref|XP_011019811.1|  PREDICTED: uncharacterized protein LOC105122418  90.1    5e-17    Populus euphratica
ref|XP_004136217.1|  PREDICTED: U-box domain-containing protein 26    88.2    6e-17    Cucumis sativus [cucumbers]
ref|XP_003527831.1|  PREDICTED: uncharacterized protein LOC100814020  87.8    6e-17    Glycine max [soybeans]
ref|XP_002962287.1|  hypothetical protein SELMODRAFT_403954           89.7    9e-17    
ref|XP_012077427.1|  PREDICTED: putative proline-rich receptor-li...  86.7    2e-16    Jatropha curcas
ref|XP_010668167.1|  PREDICTED: U-box domain-containing protein 26    86.3    3e-16    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010028074.1|  PREDICTED: U-box domain-containing protein 30    86.7    5e-16    Eucalyptus grandis [rose gum]
ref|XP_003517356.1|  PREDICTED: U-box domain-containing protein 3...  86.3    8e-16    Glycine max [soybeans]
ref|XP_002987189.1|  hypothetical protein SELMODRAFT_46743            82.0    8e-16    
ref|XP_002281453.1|  PREDICTED: U-box domain-containing protein 25    84.3    1e-15    Vitis vinifera
ref|XP_011090755.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     84.0    1e-15    Sesamum indicum [beniseed]
ref|XP_003522485.1|  PREDICTED: U-box domain-containing protein 2...  84.7    2e-15    Glycine max [soybeans]
ref|XP_003636401.1|  U-box domain-containing protein                  83.2    2e-15    
gb|KHN31155.1|  U-box domain-containing protein 26                    81.6    4e-15    Glycine soja [wild soybean]
gb|KJB48752.1|  hypothetical protein B456_008G084500                  84.0    5e-15    Gossypium raimondii
ref|XP_006450657.1|  hypothetical protein CICLE_v10008902mg           82.0    7e-15    Citrus clementina [clementine]
ref|XP_007137800.1|  hypothetical protein PHAVU_009G156600g           82.8    7e-15    Phaseolus vulgaris [French bean]
ref|XP_004511816.1|  PREDICTED: U-box domain-containing protein 3...  83.2    8e-15    Cicer arietinum [garbanzo]
ref|XP_009403145.1|  PREDICTED: U-box domain-containing protein 2...  82.8    1e-14    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN13011.1|  U-box domain-containing protein 30                    82.8    1e-14    Glycine soja [wild soybean]
emb|CDP16178.1|  unnamed protein product                              82.0    1e-14    Coffea canephora [robusta coffee]
gb|KDP34438.1|  hypothetical protein JCGZ_12798                       82.0    1e-14    Jatropha curcas
ref|XP_006340423.1|  PREDICTED: U-box domain-containing protein 2...  80.9    2e-14    
ref|XP_012076112.1|  PREDICTED: U-box domain-containing protein 2...  82.0    2e-14    Jatropha curcas
ref|XP_003539260.2|  PREDICTED: U-box domain-containing protein 3...  82.8    2e-14    Glycine max [soybeans]
ref|XP_002862799.1|  hypothetical protein ARALYDRAFT_920258           79.7    2e-14    
ref|XP_011078792.1|  PREDICTED: U-box domain-containing protein 2...  81.3    2e-14    Sesamum indicum [beniseed]
ref|XP_006847226.1|  PREDICTED: U-box domain-containing protein 26    81.6    2e-14    Amborella trichopoda
gb|AES94509.2|  E3 ubiquitin ligase PUB14                             81.6    3e-14    Medicago truncatula
ref|XP_003611551.1|  U-box domain-containing protein                  81.6    3e-14    
ref|XP_001783217.1|  predicted protein                                80.9    4e-14    
ref|XP_010273225.1|  PREDICTED: U-box domain-containing protein 30    81.3    4e-14    Nelumbo nucifera [Indian lotus]
ref|XP_007047580.1|  ARM repeat superfamily protein isoform 2         79.7    4e-14    
ref|XP_002452587.1|  hypothetical protein SORBIDRAFT_04g028560        80.5    6e-14    Sorghum bicolor [broomcorn]
ref|XP_008680442.1|  PREDICTED: U-box domain-containing protein 2...  79.7    7e-14    
ref|XP_007047579.1|  ARM repeat superfamily protein isoform 1         80.5    7e-14    Theobroma cacao [chocolate]
ref|XP_004251181.1|  PREDICTED: U-box domain-containing protein 26    79.3    8e-14    Solanum lycopersicum
ref|XP_009801169.1|  PREDICTED: uncharacterized protein LOC104246952  79.3    9e-14    Nicotiana sylvestris
ref|XP_011022933.1|  PREDICTED: U-box domain-containing protein 2...  79.7    1e-13    Populus euphratica
ref|XP_010249635.1|  PREDICTED: U-box domain-containing protein 26    79.0    1e-13    Nelumbo nucifera [Indian lotus]
ref|XP_003526867.1|  PREDICTED: U-box domain-containing protein 2...  79.3    1e-13    Glycine max [soybeans]
ref|NP_196716.1|  uncharacterized protein                             78.6    1e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267145.2|  PREDICTED: U-box domain-containing protein 30    79.7    1e-13    Vitis vinifera
ref|XP_010456493.1|  PREDICTED: uncharacterized protein LOC104737947  77.8    1e-13    
ref|XP_008237598.1|  PREDICTED: U-box domain-containing protein 30    79.0    2e-13    Prunus mume [ume]
ref|XP_006289615.1|  hypothetical protein CARUB_v10003173mg           77.4    2e-13    Capsella rubella
ref|XP_006466465.1|  PREDICTED: U-box domain-containing protein 3...  79.0    3e-13    Citrus sinensis [apfelsine]
ref|XP_006410763.1|  hypothetical protein EUTSA_v10016730mg           78.6    3e-13    Eutrema salsugineum [saltwater cress]
ref|XP_006426094.1|  hypothetical protein CICLE_v10025589mg           78.6    3e-13    Citrus clementina [clementine]
gb|KDO78935.1|  hypothetical protein CISIN_1g041252mg                 78.6    3e-13    Citrus sinensis [apfelsine]
ref|XP_007207456.1|  hypothetical protein PRUPE_ppa005655mg           78.6    3e-13    Prunus persica
ref|XP_010491888.1|  PREDICTED: uncharacterized protein LOC104769387  77.0    3e-13    Camelina sativa [gold-of-pleasure]
gb|AFW73318.1|  immediate-early fungal elicitor protein CMPG1         78.6    3e-13    
ref|XP_006399662.1|  hypothetical protein EUTSA_v10014169mg           77.0    4e-13    Eutrema salsugineum [saltwater cress]
ref|XP_010106916.1|  U-box domain-containing protein 30               78.2    4e-13    Morus notabilis
ref|XP_006380377.1|  hypothetical protein POPTR_0007s04220g           77.8    4e-13    Populus trichocarpa [western balsam poplar]
ref|XP_010453204.1|  PREDICTED: uncharacterized protein LOC104735168  76.6    4e-13    Camelina sativa [gold-of-pleasure]
ref|XP_010419728.1|  PREDICTED: uncharacterized protein LOC104705421  76.6    5e-13    Camelina sativa [gold-of-pleasure]
ref|XP_009141534.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  77.4    6e-13    Brassica rapa
ref|XP_002526642.1|  Spotted leaf protein, putative                   77.4    6e-13    Ricinus communis
ref|XP_009603741.1|  PREDICTED: uncharacterized protein LOC104098657  76.6    7e-13    Nicotiana tomentosiformis
gb|AGT17408.1|  hypothetical protein SHCRBa_230_N09_R_300             77.4    8e-13    Saccharum hybrid cultivar R570
ref|XP_007155812.1|  hypothetical protein PHAVU_003G233800g           77.4    8e-13    Phaseolus vulgaris [French bean]
ref|XP_003524698.1|  PREDICTED: U-box domain-containing protein 3...  77.4    8e-13    
gb|KDO51673.1|  hypothetical protein CISIN_1g015728mg                 77.0    8e-13    Citrus sinensis [apfelsine]
ref|XP_006432191.1|  hypothetical protein CICLE_v10001406mg           77.0    8e-13    
ref|XP_006465012.1|  PREDICTED: U-box domain-containing protein 2...  77.0    8e-13    Citrus sinensis [apfelsine]
ref|XP_009133058.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     77.0    9e-13    Brassica rapa
ref|XP_002873519.1|  hypothetical protein ARALYDRAFT_487992           75.9    9e-13    
ref|XP_006403803.1|  hypothetical protein EUTSA_v10010389mg           77.0    9e-13    Eutrema salsugineum [saltwater cress]
gb|KHN20357.1|  U-box domain-containing protein 30                    77.0    9e-13    Glycine soja [wild soybean]
emb|CDX84587.1|  BnaA03g16430D                                        77.0    9e-13    
emb|CDY32070.1|  BnaC04g44960D                                        77.0    1e-12    Brassica napus [oilseed rape]
ref|XP_006382863.1|  hypothetical protein POPTR_0005s06470g           76.6    1e-12    Populus trichocarpa [western balsam poplar]
ref|XP_009367895.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  75.9    1e-12    Pyrus x bretschneideri [bai li]
ref|XP_002965206.1|  hypothetical protein SELMODRAFT_439085           77.4    1e-12    
emb|CDP20283.1|  unnamed protein product                              76.6    1e-12    Coffea canephora [robusta coffee]
emb|CDX85708.1|  BnaA02g01050D                                        75.5    1e-12    
ref|XP_009419493.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  76.3    1e-12    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125812.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  75.1    2e-12    Brassica rapa
ref|XP_002465578.1|  hypothetical protein SORBIDRAFT_01g041450        76.6    2e-12    Sorghum bicolor [broomcorn]
emb|CDY68531.1|  BnaCnng59400D                                        75.1    2e-12    Brassica napus [oilseed rape]
ref|XP_009136678.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  75.9    2e-12    Brassica rapa
emb|CAN66286.1|  hypothetical protein VITISV_011184                   75.5    3e-12    Vitis vinifera
ref|XP_010526330.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     75.5    3e-12    Tarenaya hassleriana [spider flower]
ref|XP_002262704.2|  PREDICTED: U-box domain-containing protein 2...  75.1    3e-12    Vitis vinifera
gb|KFK34491.1|  hypothetical protein AALP_AA5G152500                  75.5    4e-12    Arabis alpina [alpine rockcress]
ref|XP_010463781.1|  PREDICTED: U-box domain-containing protein 31    75.1    4e-12    Camelina sativa [gold-of-pleasure]
gb|ERN02753.1|  hypothetical protein AMTR_s00086p00031680             74.7    4e-12    Amborella trichopoda
ref|XP_008220387.1|  PREDICTED: U-box domain-containing protein 3...  75.1    4e-12    Prunus mume [ume]
ref|XP_006295808.1|  hypothetical protein CARUB_v10024934mg           75.1    5e-12    Capsella rubella
emb|CDX91209.1|  BnaC02g03880D                                        73.9    5e-12    
ref|NP_001147860.1|  immediate-early fungal elicitor protein CMPG1    75.1    5e-12    
gb|KDO79762.1|  hypothetical protein CISIN_1g044095mg                 73.9    5e-12    Citrus sinensis [apfelsine]
ref|XP_008393879.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.9    5e-12    
ref|XP_006841078.2|  PREDICTED: U-box domain-containing protein 4     74.7    6e-12    
ref|XP_003564002.1|  PREDICTED: U-box domain-containing protein 21    74.7    6e-12    Brachypodium distachyon [annual false brome]
emb|CDX78096.1|  BnaA09g32910D                                        74.7    6e-12    
emb|CDX95337.1|  BnaC04g28210D                                        74.7    6e-12    
emb|CDY59599.1|  BnaCnng35300D                                        74.7    6e-12    Brassica napus [oilseed rape]
ref|XP_004502944.1|  PREDICTED: U-box domain-containing protein 2...  74.3    6e-12    Cicer arietinum [garbanzo]
ref|XP_011031181.1|  PREDICTED: U-box domain-containing protein 2...  73.9    6e-12    Populus euphratica
ref|XP_009115945.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     74.7    7e-12    Brassica rapa
ref|XP_009395651.1|  PREDICTED: U-box domain-containing protein 3...  74.3    8e-12    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010505120.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     74.3    8e-12    Camelina sativa [gold-of-pleasure]
ref|XP_011031180.1|  PREDICTED: U-box domain-containing protein 2...  73.9    8e-12    Populus euphratica
ref|XP_010516800.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.9    9e-12    Camelina sativa [gold-of-pleasure]
ref|XP_010509533.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.9    9e-12    Camelina sativa [gold-of-pleasure]
gb|KFK36486.1|  hypothetical protein AALP_AA4G130900                  73.9    1e-11    Arabis alpina [alpine rockcress]
ref|XP_010444614.1|  PREDICTED: U-box domain-containing protein 3...  73.9    1e-11    Camelina sativa [gold-of-pleasure]
ref|XP_009125026.1|  PREDICTED: U-box domain-containing protein 4     73.6    1e-11    Brassica rapa
ref|XP_007225763.1|  hypothetical protein PRUPE_ppa005536mg           73.9    1e-11    Prunus persica
ref|XP_010541260.1|  PREDICTED: formin-binding protein 4              72.8    1e-11    Tarenaya hassleriana [spider flower]
ref|XP_010271201.1|  PREDICTED: U-box domain-containing protein 2...  73.9    1e-11    Nelumbo nucifera [Indian lotus]
ref|XP_009390871.1|  PREDICTED: U-box domain-containing protein 2...  73.9    1e-11    
ref|XP_009375140.1|  PREDICTED: U-box domain-containing protein 3...  73.9    1e-11    Pyrus x bretschneideri [bai li]
ref|XP_009396054.1|  PREDICTED: U-box domain-containing protein 4...  73.6    1e-11    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002524056.1|  Spotted leaf protein, putative                   73.6    1e-11    Ricinus communis
ref|XP_010541793.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  73.6    1e-11    Tarenaya hassleriana [spider flower]
ref|XP_004503116.1|  PREDICTED: U-box domain-containing protein 2...  73.6    1e-11    Cicer arietinum [garbanzo]
gb|ACF88418.1|  unknown                                               73.6    1e-11    Zea mays [maize]
ref|XP_009139452.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  73.6    1e-11    Brassica rapa
ref|XP_008784119.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.6    1e-11    
gb|EPS58757.1|  hypothetical protein M569_16054                       72.8    1e-11    Genlisea aurea
ref|XP_008393710.1|  PREDICTED: U-box domain-containing protein 3...  73.6    1e-11    
emb|CDY28679.1|  BnaCnng05650D                                        71.6    2e-11    Brassica napus [oilseed rape]
ref|XP_008345702.1|  PREDICTED: U-box domain-containing protein 3...  73.6    2e-11    
ref|XP_010503987.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  71.6    2e-11    
gb|AEW09062.1|  hypothetical protein CL3508Contig1_02                 69.3    2e-11    Pinus radiata
emb|CDX84168.1|  BnaC04g09300D                                        73.2    2e-11    
ref|XP_010279125.1|  PREDICTED: U-box domain-containing protein 2...  73.2    2e-11    Nelumbo nucifera [Indian lotus]
ref|XP_012074309.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     72.8    2e-11    Jatropha curcas
ref|XP_010547560.1|  PREDICTED: U-box domain-containing protein 30    73.2    2e-11    Tarenaya hassleriana [spider flower]
gb|AAM61258.1|  unknown                                               73.2    2e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004953855.1|  PREDICTED: U-box domain-containing protein 2...  73.2    2e-11    Setaria italica
emb|CDP04681.1|  unnamed protein product                              72.8    2e-11    Coffea canephora [robusta coffee]
emb|CDX79645.1|  BnaC03g19810D                                        72.8    2e-11    
gb|AEW09063.1|  hypothetical protein CL3508Contig1_02                 68.6    3e-11    Pinus lambertiana
gb|EYU30497.1|  hypothetical protein MIMGU_mgv1a007556mg              72.4    3e-11    Erythranthe guttata [common monkey flower]
ref|XP_002510072.1|  E3 ubiquitin ligase PUB14, putative              72.8    3e-11    
ref|XP_010932523.1|  PREDICTED: U-box domain-containing protein 2...  72.4    3e-11    Elaeis guineensis
ref|XP_006293176.1|  hypothetical protein CARUB_v10019493mg           72.4    3e-11    Capsella rubella
ref|NP_181137.2|  E3 ubiquitin-protein ligase PUB23                   72.4    4e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877862.1|  U-box domain-containing protein                  72.4    4e-11    
ref|XP_008452670.1|  PREDICTED: U-box domain-containing protein 3...  72.4    4e-11    Cucumis melo [Oriental melon]
gb|AAD21464.1|  unknown protein                                       72.0    4e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090837.1|  U-box domain-containing protein 25               72.0    4e-11    
ref|XP_004251095.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  72.0    4e-11    Solanum lycopersicum
ref|XP_002298264.1|  hypothetical protein POPTR_0001s22370g           72.0    4e-11    Populus trichocarpa [western balsam poplar]
ref|XP_008790249.1|  PREDICTED: U-box domain-containing protein 3...  72.0    4e-11    Phoenix dactylifera
ref|XP_010426860.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     72.0    4e-11    Camelina sativa [gold-of-pleasure]
ref|XP_010515711.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  72.0    5e-11    Camelina sativa [gold-of-pleasure]
ref|XP_008357389.1|  PREDICTED: U-box domain-containing protein 1...  71.2    5e-11    Malus domestica [apple tree]
gb|ADI46214.1|  CMPG1b                                                72.0    5e-11    Nicotiana benthamiana
ref|NP_001152389.1|  immediate-early fungal elicitor protein CMPG1    72.0    5e-11    
gb|ABK25393.1|  unknown                                               72.0    5e-11    Picea sitchensis
ref|XP_006279535.1|  hypothetical protein CARUB_v10028289mg           72.0    5e-11    Capsella rubella
ref|XP_008357382.1|  PREDICTED: U-box domain-containing protein 1...  71.2    5e-11    Malus domestica [apple tree]
ref|XP_004147364.1|  PREDICTED: U-box domain-containing protein 2...  71.6    5e-11    Cucumis sativus [cucumbers]
gb|KEH35601.1|  E3 ubiquitin ligase PUB14                             70.9    5e-11    Medicago truncatula
ref|XP_008460887.1|  PREDICTED: U-box domain-containing protein 2...  71.6    5e-11    Cucumis melo [Oriental melon]
ref|XP_004985053.1|  PREDICTED: U-box domain-containing protein 2...  72.0    5e-11    Setaria italica
emb|CDY23218.1|  BnaA04g05410D                                        71.6    5e-11    Brassica napus [oilseed rape]
gb|AFG69255.1|  hypothetical protein 0_14991_01                       66.2    5e-11    Pinus taeda
gb|KHN34082.1|  U-box domain-containing protein 25                    71.2    5e-11    
ref|XP_009380073.1|  PREDICTED: U-box domain-containing protein 2...  71.6    6e-11    
ref|NP_190813.1|  E3 ubiquitin-protein ligase PUB22                   71.6    6e-11    
ref|XP_009410070.1|  PREDICTED: U-box domain-containing protein 2...  71.6    6e-11    
ref|XP_004498998.1|  PREDICTED: U-box domain-containing protein 4...  71.2    6e-11    
ref|XP_004141293.1|  PREDICTED: U-box domain-containing protein 3...  71.6    7e-11    
ref|XP_006362850.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  71.2    7e-11    
ref|XP_002866695.1|  U-box domain-containing protein                  71.2    8e-11    
ref|XP_008357448.1|  PREDICTED: U-box domain-containing protein 1...  71.6    8e-11    
ref|XP_009343842.1|  PREDICTED: U-box domain-containing protein 1...  70.1    8e-11    
ref|XP_011021423.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  71.2    8e-11    
ref|XP_012065019.1|  PREDICTED: U-box domain-containing protein 1...  71.6    8e-11    
ref|XP_006404100.1|  hypothetical protein EUTSA_v10010374mg           71.2    9e-11    
ref|XP_003537115.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  71.2    9e-11    
gb|ADI46216.1|  CMPG1a                                                71.2    9e-11    
gb|KFK28450.1|  hypothetical protein AALP_AA8G515900                  70.9    1e-10    
gb|KHN48421.1|  E3 ubiquitin-protein ligase PUB23                     70.9    1e-10    
ref|XP_009379827.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  70.9    1e-10    
ref|XP_003602626.1|  U-box domain-containing protein                  70.9    1e-10    
ref|XP_010936891.1|  PREDICTED: U-box domain-containing protein 2...  70.9    1e-10    
ref|XP_011094237.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  70.5    1e-10    
ref|XP_004292853.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     70.1    1e-10    
ref|XP_002974352.1|  hypothetical protein SELMODRAFT_414754           70.9    1e-10    
ref|XP_006494889.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  70.5    2e-10    
ref|XP_009592688.1|  PREDICTED: U-box domain-containing protein 2...  70.5    2e-10    
gb|KDO46582.1|  hypothetical protein CISIN_1g040073mg                 70.5    2e-10    
ref|XP_006424086.1|  hypothetical protein CICLE_v10028557mg           70.5    2e-10    
ref|XP_010278617.1|  PREDICTED: U-box domain-containing protein 2...  67.4    2e-10    
ref|XP_004288267.1|  PREDICTED: U-box domain-containing protein 30    70.5    2e-10    
ref|XP_007224929.1|  hypothetical protein PRUPE_ppa021688mg           69.3    2e-10    
ref|NP_566927.1|  U-box domain-containing protein 30                  70.5    2e-10    
ref|XP_002877705.1|  U-box domain-containing protein                  70.5    2e-10    
ref|XP_002881419.1|  hypothetical protein ARALYDRAFT_482563           70.1    2e-10    
ref|XP_010906325.1|  PREDICTED: U-box domain-containing protein 2...  70.1    2e-10    
ref|XP_007204993.1|  hypothetical protein PRUPE_ppa003509mg           70.5    2e-10    
ref|XP_002323382.1|  U-box domain-containing family protein           70.1    2e-10    
ref|XP_003518177.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  70.1    2e-10    
ref|XP_008385130.1|  PREDICTED: U-box domain-containing protein 1...  70.5    2e-10    
gb|EAZ00358.1|  hypothetical protein OsI_22374                        70.1    2e-10    
ref|XP_012068185.1|  PREDICTED: U-box domain-containing protein 3...  70.1    2e-10    
gb|EEE65449.1|  hypothetical protein OsJ_20813                        69.7    2e-10    
ref|XP_010936162.1|  PREDICTED: U-box domain-containing protein 3...  70.1    2e-10    
ref|XP_006356848.1|  PREDICTED: U-box domain-containing protein 3...  70.1    2e-10    
emb|CDX69749.1|  BnaA10g20980D                                        69.3    2e-10    
ref|XP_010688093.1|  PREDICTED: U-box domain-containing protein 4...  69.7    2e-10    
ref|XP_009803459.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  70.1    2e-10    
gb|KHG16185.1|  U-box domain-containing 4 -like protein               69.7    2e-10    
ref|NP_001057289.1|  Os06g0248500                                     70.1    2e-10    
ref|XP_010260460.1|  PREDICTED: U-box domain-containing protein 2...  69.7    2e-10    
ref|XP_010515345.1|  PREDICTED: U-box domain-containing protein 30    70.1    2e-10    
gb|EYU38686.1|  hypothetical protein MIMGU_mgv1a020011mg              69.7    2e-10    
ref|NP_201393.1|  U-box domain-containing protein 31                  69.7    2e-10    
ref|XP_009382986.1|  PREDICTED: U-box domain-containing protein 2...  69.7    2e-10    
ref|XP_009395597.1|  PREDICTED: U-box domain-containing protein 4...  69.7    2e-10    
ref|XP_009599897.1|  PREDICTED: U-box domain-containing protein 1...  70.1    2e-10    
ref|XP_009121936.1|  PREDICTED: uncharacterized protein LOC103846711  69.7    3e-10    
ref|XP_006857112.1|  PREDICTED: U-box domain-containing protein 30    69.7    3e-10    
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 13    70.1    3e-10    
ref|XP_011042586.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     69.7    3e-10    
gb|AAL32554.1|  Unknown protein                                       69.7    3e-10    
ref|XP_002976406.1|  hypothetical protein SELMODRAFT_416356           69.7    3e-10    
ref|XP_007152651.1|  hypothetical protein PHAVU_004G147500g           69.7    3e-10    
ref|XP_008223401.1|  PREDICTED: U-box domain-containing protein 13    70.1    3e-10    
gb|KJB75292.1|  hypothetical protein B456_012G035600                  69.3    3e-10    
ref|XP_004142305.1|  PREDICTED: U-box domain-containing protein 2...  69.7    3e-10    
ref|XP_011085170.1|  PREDICTED: U-box domain-containing protein 3...  69.7    3e-10    
ref|XP_002987239.1|  hypothetical protein SELMODRAFT_426053           69.7    3e-10    
ref|XP_002990839.1|  hypothetical protein SELMODRAFT_429186           69.7    3e-10    
ref|XP_011000261.1|  PREDICTED: U-box domain-containing protein 1...  69.7    3e-10    
emb|CDP09042.1|  unnamed protein product                              69.7    4e-10    
ref|XP_002510071.1|  E3 ubiquitin ligase PUB14, putative              69.3    4e-10    
ref|XP_009353692.1|  PREDICTED: U-box domain-containing protein 1...  69.7    4e-10    
ref|XP_002516555.1|  conserved hypothetical protein                   69.3    4e-10    
ref|XP_011089810.1|  PREDICTED: U-box domain-containing protein 13    69.7    4e-10    
ref|XP_008350837.1|  PREDICTED: U-box domain-containing protein 2...  69.3    4e-10    
ref|XP_009348934.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  69.3    4e-10    
gb|KJB63943.1|  hypothetical protein B456_010G025700                  68.9    4e-10    
ref|XP_009341425.1|  PREDICTED: U-box domain-containing protein 1...  68.2    4e-10    
ref|XP_002298363.1|  armadillo/beta-catenin repeat family protein     69.7    4e-10    
gb|KEH30143.1|  armadillo/beta-catenin repeat protein                 69.7    4e-10    
ref|XP_009395652.1|  PREDICTED: U-box domain-containing protein 3...  69.3    4e-10    
ref|XP_002320032.2|  hypothetical protein POPTR_0014s01670g           68.9    4e-10    
ref|XP_011096757.1|  PREDICTED: U-box domain-containing protein 3...  68.9    4e-10    
gb|EYU43705.1|  hypothetical protein MIMGU_mgv1a006344mg              68.9    5e-10    
ref|XP_007145787.1|  hypothetical protein PHAVU_007G267700g           68.9    5e-10    
gb|KGN57521.1|  hypothetical protein Csa_3G203520                     65.1    5e-10    
gb|KJB35467.1|  hypothetical protein B456_006G116400                  68.9    5e-10    
ref|XP_006292265.1|  hypothetical protein CARUB_v10018474mg           68.9    5e-10    
ref|XP_010247286.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  68.9    5e-10    
ref|XP_010999871.1|  PREDICTED: U-box domain-containing protein 4...  68.6    5e-10    
ref|XP_009353694.1|  PREDICTED: U-box domain-containing protein 1...  68.9    6e-10    
ref|XP_006387887.1|  hypothetical protein POPTR_0497s00200g           68.6    7e-10    
gb|AES59330.2|  armadillo/beta-catenin-like repeat protein            68.2    7e-10    
ref|XP_003589079.1|  U-box domain-containing protein                  68.2    7e-10    
ref|XP_007160909.1|  hypothetical protein PHAVU_001G027300g           68.2    7e-10    
ref|XP_008812108.1|  PREDICTED: U-box domain-containing protein 3...  68.6    7e-10    
gb|AAP03884.1|  Avr9/Cf-9 rapidly elicited protein 74                 68.6    7e-10    
emb|CAA16672.1|  predicted protein                                    68.9    8e-10    
ref|XP_006424806.1|  hypothetical protein CICLE_v10027966mg           68.6    8e-10    
ref|XP_009781197.1|  PREDICTED: U-box domain-containing protein 2...  68.2    8e-10    
ref|XP_009404142.1|  PREDICTED: U-box domain-containing protein 2...  68.2    1e-09    
dbj|BAJ91241.1|  predicted protein                                    68.2    1e-09    
ref|XP_008812599.1|  PREDICTED: U-box domain-containing protein 2...  68.2    1e-09    
ref|XP_009593988.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.8    1e-09    
gb|EMT15255.1|  U-box domain-containing protein 22                    67.8    1e-09    
ref|XP_001775881.1|  predicted protein                                67.8    1e-09    
gb|KJB53072.1|  hypothetical protein B456_008G291900                  67.8    1e-09    
ref|XP_003531998.1|  PREDICTED: U-box domain-containing protein 2...  67.8    1e-09    
ref|XP_010925800.1|  PREDICTED: U-box domain-containing protein 2...  67.8    1e-09    
ref|XP_006424807.1|  hypothetical protein CICLE_v10027966mg           68.2    1e-09    
ref|XP_010942967.1|  PREDICTED: U-box domain-containing protein 4...  68.2    1e-09    
ref|XP_008793948.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.4    1e-09    
gb|KJB55896.1|  hypothetical protein B456_009G100000                  67.8    1e-09    
ref|XP_010471108.1|  PREDICTED: U-box domain-containing protein 1...  67.8    1e-09    
ref|XP_010322360.1|  PREDICTED: U-box domain-containing protein 1...  67.8    2e-09    
ref|XP_007207682.1|  hypothetical protein PRUPE_ppa023672mg           67.4    2e-09    
ref|XP_010911942.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.4    2e-09    
ref|XP_003533316.1|  PREDICTED: U-box domain-containing protein 2...  67.4    2e-09    
ref|XP_008379758.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.4    2e-09    
gb|KHG14011.1|  U-box domain-containing 13 -like protein              67.8    2e-09    
ref|XP_010106453.1|  U-box domain-containing protein 13               67.4    2e-09    
ref|XP_007204425.1|  hypothetical protein PRUPE_ppa1027169mg          67.0    2e-09    
ref|XP_010912070.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.4    2e-09    
ref|XP_003575089.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     67.4    2e-09    
ref|XP_006381941.1|  U-box domain-containing family protein           67.0    2e-09    
ref|XP_004241233.1|  PREDICTED: U-box domain-containing protein 1...  67.4    2e-09    
gb|EMS67443.1|  E3 ubiquitin-protein ligase PUB22                     67.0    2e-09    
ref|XP_007018507.1|  ARM repeat superfamily protein                   67.0    2e-09    
ref|XP_008230336.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.0    2e-09    
gb|KJB55894.1|  hypothetical protein B456_009G100000                  67.4    2e-09    
ref|XP_004505870.1|  PREDICTED: U-box domain-containing protein 1...  67.4    2e-09    
gb|KHN43695.1|  E3 ubiquitin-protein ligase PUB22                     67.0    2e-09    
ref|XP_006364055.1|  PREDICTED: U-box domain-containing protein 2...  67.0    2e-09    
ref|XP_002513723.1|  ubiquitin-protein ligase, putative               67.0    2e-09    
ref|XP_011042684.1|  PREDICTED: U-box domain-containing protein 1...  67.4    2e-09    
ref|XP_009380658.1|  PREDICTED: protein spotted leaf 11-like          67.4    2e-09    
ref|XP_010043987.1|  PREDICTED: U-box domain-containing protein 2...  67.0    2e-09    
gb|AFK46109.1|  unknown                                               66.6    2e-09    
dbj|BAJ90807.1|  predicted protein                                    67.0    2e-09    
ref|XP_004238092.1|  PREDICTED: U-box domain-containing protein 4...  66.6    2e-09    
ref|XP_010102878.1|  U-box domain-containing protein 20               67.0    2e-09    
ref|XP_010685786.1|  PREDICTED: U-box domain-containing protein 13    67.0    2e-09    
ref|XP_007016448.1|  Plant U-box 13 isoform 2                         67.0    2e-09    
ref|XP_002990179.1|  ubiquitin-protein ligase, PUB2                   67.0    3e-09    
ref|XP_009337706.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  66.6    3e-09    
ref|XP_007016447.1|  U-box domain-containing protein 13 isoform 1     67.0    3e-09    
gb|ADI46213.1|  CMPG1a                                                66.6    3e-09    
ref|XP_002992508.1|  ubiquitin-protein ligase, PUB2                   67.0    3e-09    
ref|XP_008391980.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  66.6    3e-09    
ref|XP_011006317.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  66.6    3e-09    
ref|XP_004145841.1|  PREDICTED: U-box domain-containing protein 21    66.6    3e-09    
ref|XP_009777581.1|  PREDICTED: U-box domain-containing protein 1...  67.0    3e-09    
ref|XP_009368334.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  66.6    3e-09    
ref|XP_009370082.1|  PREDICTED: U-box domain-containing protein 21    66.6    3e-09    
ref|XP_009360997.1|  PREDICTED: U-box domain-containing protein 3...  66.6    3e-09    
ref|XP_011046430.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  66.2    3e-09    
gb|KJB55893.1|  hypothetical protein B456_009G100000                  66.6    3e-09    
ref|XP_009600234.1|  PREDICTED: U-box domain-containing protein 2...  66.2    4e-09    
ref|XP_002534105.1|  Spotted leaf protein, putative                   66.6    4e-09    
ref|XP_006350763.1|  PREDICTED: U-box domain-containing protein 1...  66.6    4e-09    
gb|KHN43656.1|  U-box domain-containing protein 20                    66.2    4e-09    
ref|XP_003558390.1|  PREDICTED: U-box domain-containing protein 2...  66.2    4e-09    
ref|XP_009406135.1|  PREDICTED: U-box domain-containing protein 2...  66.2    4e-09    
ref|XP_003550308.1|  PREDICTED: U-box domain-containing protein 4     65.9    4e-09    
emb|CAB66919.1|  putative protein                                     66.2    4e-09    
ref|XP_010503648.1|  PREDICTED: U-box domain-containing protein 3...  66.2    4e-09    
ref|XP_002991626.1|  hypothetical protein SELMODRAFT_133879           66.2    4e-09    
emb|CDX74298.1|  BnaA03g27490D                                        65.9    4e-09    
ref|XP_008780992.1|  PREDICTED: U-box domain-containing protein 2...  65.9    5e-09    
gb|KJB58632.1|  hypothetical protein B456_009G219600                  65.9    5e-09    
ref|XP_010270371.1|  PREDICTED: U-box domain-containing protein 2...  65.9    5e-09    
ref|XP_008365622.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.9    5e-09    
gb|KHG00011.1|  U-box domain-containing 4 -like protein               65.9    5e-09    
ref|XP_008381777.1|  PREDICTED: U-box domain-containing protein 2...  65.9    5e-09    
ref|XP_009415651.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.9    5e-09    
gb|KJB71373.1|  hypothetical protein B456_011G119300                  65.9    5e-09    
ref|XP_006350762.1|  PREDICTED: U-box domain-containing protein 1...  66.2    5e-09    
ref|XP_010485548.1|  PREDICTED: U-box domain-containing protein 4...  65.5    5e-09    
ref|XP_007132072.1|  hypothetical protein PHAVU_011G064700g           66.2    6e-09    
ref|XP_004236923.1|  PREDICTED: U-box domain-containing protein 2...  65.9    6e-09    
ref|XP_002526006.1|  E3 ubiquitin ligase PUB14, putative              65.9    6e-09    
ref|XP_006656843.1|  PREDICTED: U-box domain-containing protein 2...  64.7    6e-09    
ref|XP_010463527.1|  PREDICTED: U-box domain-containing protein 4...  65.5    6e-09    
gb|ERN18764.1|  hypothetical protein AMTR_s00067p00049340             66.2    6e-09    
ref|XP_007215376.1|  hypothetical protein PRUPE_ppa005711mg           65.9    6e-09    
ref|XP_010431524.1|  PREDICTED: U-box domain-containing protein 4...  65.5    6e-09    
emb|CDP01660.1|  unnamed protein product                              65.5    7e-09    
emb|CDY53333.1|  BnaCnng24910D                                        65.5    7e-09    
dbj|BAK07065.1|  predicted protein                                    65.5    7e-09    
ref|XP_007036951.1|  ARM repeat superfamily protein                   65.5    7e-09    
ref|XP_006854597.1|  PREDICTED: U-box domain-containing protein 27    65.5    7e-09    
ref|XP_004238073.1|  PREDICTED: U-box domain-containing protein 3...  65.5    7e-09    
ref|XP_004513351.1|  PREDICTED: U-box domain-containing protein 2...  65.5    8e-09    
ref|XP_009343828.1|  PREDICTED: U-box domain-containing protein 1...  65.5    8e-09    
ref|XP_002527537.1|  Spotted leaf protein, putative                   65.1    8e-09    
ref|NP_001234240.1|  Avr9/Cf-9 rapidly elicited protein               65.5    8e-09    
emb|CDY18670.1|  BnaA09g07250D                                        65.5    8e-09    
ref|XP_006651208.1|  PREDICTED: U-box domain-containing protein 2...  65.1    8e-09    
ref|XP_002285420.1|  PREDICTED: U-box domain-containing protein 30    65.5    8e-09    
ref|XP_002283992.1|  PREDICTED: U-box domain-containing protein 13    65.5    9e-09    
ref|XP_008444561.1|  PREDICTED: U-box domain-containing protein 4     65.1    9e-09    
ref|XP_006300236.1|  hypothetical protein CARUB_v10016476mg           65.1    9e-09    
ref|XP_002510099.1|  E3 ubiquitin ligase PUB14, putative              65.1    9e-09    
ref|XP_003537996.1|  PREDICTED: U-box domain-containing protein 1...  65.5    9e-09    
ref|NP_566136.1|  armadillo/beta-catenin-like repeat-containing p...  65.1    9e-09    
ref|XP_004290984.1|  PREDICTED: U-box domain-containing protein 3...  65.1    1e-08    
ref|XP_010427916.1|  PREDICTED: U-box domain-containing protein 10    65.5    1e-08    
ref|XP_008238495.1|  PREDICTED: U-box domain-containing protein 4     65.5    1e-08    
gb|AAM64910.1|  unknown                                               64.7    1e-08    
ref|XP_006408499.1|  hypothetical protein EUTSA_v10021975mg           64.7    1e-08    
emb|CDY69247.1|  BnaCnng62640D                                        65.1    1e-08    
ref|XP_006355051.1|  PREDICTED: U-box domain-containing protein 2...  65.1    1e-08    
ref|XP_010485321.1|  PREDICTED: U-box domain-containing protein 3...  65.1    1e-08    
ref|XP_009101448.1|  PREDICTED: U-box domain-containing protein 30    65.1    1e-08    
ref|XP_010912561.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  64.7    1e-08    
gb|EPS70404.1|  hypothetical protein M569_04358                       64.7    1e-08    
ref|XP_008795339.1|  PREDICTED: U-box domain-containing protein 21    65.1    1e-08    
ref|NP_001147892.1|  ubiquitin-protein ligase                         65.1    1e-08    
ref|XP_010042637.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  62.4    1e-08    
gb|AAL16172.1|AF428404_1  AT3g01400/T13O15_4                          64.7    1e-08    
ref|XP_010415797.1|  PREDICTED: U-box domain-containing protein 1...  65.1    1e-08    



>ref|XP_004230770.1| PREDICTED: U-box domain-containing protein 26-like [Solanum lycopersicum]
Length=415

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 213/238 (89%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E E V V SDP RVGYLV++L +PS+DVR+NSAALIE+V++G RSPE RAQISNAD+
Sbjct  178  PLSEPECVFVASDPGRVGYLVAMLFHPSIDVRVNSAALIETVVAGMRSPEFRAQISNADD  237

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            +FEG+VGILN PL+Y RALK+G+KALFALCL KQ+R +AV+AGAVEALIDRLQDF+KCDA
Sbjct  238  VFEGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQRAVSAGAVEALIDRLQDFEKCDA  297

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELL RIPSGCAA A+HALTVPLLVKIILKIS RATEYAAGALLS+CSASEQAQ
Sbjct  298  ERALATIELLSRIPSGCAALASHALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQ  357

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +EA AAGV+ QLLLLVQSDCTERAKRKAQMLLK LRDCWPED    +DD+ CS VVPF
Sbjct  358  KEAVAAGVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANTDDFACSDVVPF  415



>ref|XP_006346399.1| PREDICTED: U-box domain-containing protein 26-like [Solanum tuberosum]
Length=415

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 211/238 (89%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E E V V SDP RV YLV++L +PS+DVR+NSAALIE V++G RS ELRAQISNAD+
Sbjct  178  PLSEPECVFVASDPERVSYLVAMLFHPSIDVRVNSAALIEIVVAGMRSSELRAQISNADD  237

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            +FEG+VGILN PL+Y RALK+G+KALFALCL KQ+R +AVTAGAVEALIDRLQDF+KCDA
Sbjct  238  VFEGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQRAVTAGAVEALIDRLQDFEKCDA  297

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELL RIPSGCAA A+HALTVPLLVKIILKIS RATEYAAGALLS+CSASEQAQ
Sbjct  298  ERALATIELLSRIPSGCAALASHALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQ  357

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +EA AAGV+ QLLLLVQSDCTERAKRKAQMLLK LRDCWPED    SDD+ CS VVPF
Sbjct  358  KEAVAAGVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANSDDFACSDVVPF  415



>ref|XP_011000686.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Populus euphratica]
 ref|XP_011000695.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Populus euphratica]
Length=413

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 203/238 (85%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E + V + S+P R+GYL +LL + S++VR+NSAALIE+V++GTRSP+LR QISN + 
Sbjct  176  PLTEFDCVGISSEPERIGYLANLLFHSSIEVRVNSAALIENVIAGTRSPDLRLQISNTEI  235

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IF+G++ IL  PLS  RALK+G+KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDA
Sbjct  236  IFQGVIEILKNPLSSPRALKVGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDA  295

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q
Sbjct  296  ERALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQ  355

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +EA  AG++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  356  KEAVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSDVVPF  413



>ref|XP_012078957.1| PREDICTED: U-box domain-containing protein 26-like [Jatropha 
curcas]
 gb|KDP32265.1| hypothetical protein JCGZ_14786 [Jatropha curcas]
Length=416

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 206/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E++ V + SD  R+ YLV+LL + S++VR+NSAALIE V++GT+S +LRAQIS+ DE
Sbjct  179  PLSESDCVCIASDSGRINYLVNLLFHISIEVRVNSAALIEIVVAGTKSSDLRAQISSVDE  238

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ +L  P+SY RALKIG+KALFALCL KQ RHKAV+AGA + LIDRL DFDKCDA
Sbjct  239  IFEGVIEMLKNPISYPRALKIGIKALFALCLVKQTRHKAVSAGAADILIDRLADFDKCDA  298

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCR+P+GC AFA HALTVPLLVK ILKIS RATEYAAGALL++C++SEQ+Q
Sbjct  299  ERALATIELLCRVPTGCTAFAGHALTVPLLVKKILKISDRATEYAAGALLALCTSSEQSQ  358

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            REA +AG++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED +  SDD+ CS VVPF
Sbjct  359  REAVSAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSSANSDDFICSEVVPF  416



>ref|XP_002313124.2| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEE87079.2| U-box domain-containing family protein [Populus trichocarpa]
Length=413

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 201/238 (84%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E + V + S+P R+ YL +LL + S++VR+NSAALIE+V++GTRS +LR QISN + 
Sbjct  176  PLTEFDCVGISSEPERISYLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEI  235

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ IL  PLS  RALKIG+KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDA
Sbjct  236  IFEGVIEILKNPLSSPRALKIGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDA  295

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q
Sbjct  296  ERALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQ  355

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +EA  AG++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  356  KEAVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>ref|XP_010107920.1| U-box domain-containing protein 26 [Morus notabilis]
 gb|EXC17320.1| U-box domain-containing protein 26 [Morus notabilis]
Length=416

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/239 (73%), Positives = 203/239 (85%), Gaps = 1/239 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            P  E E   V S+P RV YL  LL + S+DVR+NSAA+IE V++GTR+PELR+QISN DE
Sbjct  178  PFSEIECAAVASEPDRVAYLTRLLFHSSIDVRVNSAAMIEIVVAGTRTPELRSQISNVDE  237

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ IL  P++Y RALK+G+KALFA+CL KQ RHKA+ AGA E LIDRL DF+KCDA
Sbjct  238  IFEGVIEILRSPIAYPRALKVGIKALFAMCLVKQTRHKAIAAGAAEILIDRLADFEKCDA  297

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+GC+A AAHALTVPLLVKIILKIS RATEYAAGAL+S+CSASEQ+Q
Sbjct  298  ERALATVELLCRIPAGCSALAAHALTVPLLVKIILKISDRATEYAAGALVSLCSASEQSQ  357

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  50
            REA AAG++TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED    SDD+ CS  VVPF
Sbjct  358  REAVAAGILTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSIRNSDDFACSEVVVPF  416



>gb|ABK93469.1| unknown [Populus trichocarpa]
Length=413

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/238 (74%), Positives = 201/238 (84%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E + V + S+P R+ YL +LL + S++VR+NSAALIE+V++GTRS +LR QISN + 
Sbjct  176  PLTEFDCVGISSEPERISYLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEI  235

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ IL  PLS  RALKIG+KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDA
Sbjct  236  IFEGVIEILKNPLSSPRALKIGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDA  295

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q
Sbjct  296  ERALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQ  355

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +EA  AG++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  356  KEAVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>ref|XP_009627648.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
tomentosiformis]
Length=417

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 207/239 (87%), Gaps = 1/239 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E E   V SDP RV YLVSLL +PS+DVR+NSAALIE V++G RS ELRAQISN D+
Sbjct  179  PLSEGECFFVASDPDRVSYLVSLLFHPSIDVRVNSAALIEVVVAGIRSSELRAQISNIDD  238

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            +FEG+VGILN PL+Y RALK+G+KALFALCL KQ+R KAV AGAVEALIDRLQDF+KCDA
Sbjct  239  VFEGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDA  298

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELL RIPSGCAA A+HALTVPLLVK ILK+S RATEYAAGALLS+C ASEQAQ
Sbjct  299  ERALATIELLARIPSGCAALASHALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQ  358

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNC-SYVVPF  50
            +EA AAGV+TQLLLLVQSDCT+RAKRKAQMLLK LRDCWPE+ T  SDDY   S VVPF
Sbjct  359  KEAVAAGVLTQLLLLVQSDCTDRAKRKAQMLLKQLRDCWPEESTANSDDYFAYSDVVPF  417



>emb|CDO97189.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E +  +V SDP RV YLVSLLS+ SVDVR+NSAA+IE  +SGTRSPELR+Q+SNA+ I
Sbjct  176  LSEPQCALVASDPDRVSYLVSLLSHSSVDVRVNSAAVIEMAVSGTRSPELRSQVSNAEGI  235

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            FEG++GILN PL+Y RA KIGVKALFALCL KQ+R +AVTAGAV+AL+D L DF+KCDAE
Sbjct  236  FEGVIGILNYPLAYPRASKIGVKALFALCLVKQHRQRAVTAGAVDALVDGLADFEKCDAE  295

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            RALATVELLCRIPSGC AF+AHALTVPLLVKIILKIS RATEYAAGALLS+CSAS+QAQR
Sbjct  296  RALATVELLCRIPSGCEAFSAHALTVPLLVKIILKISDRATEYAAGALLSLCSASDQAQR  355

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +A  AGV+TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED  G SDD+ CS VV F
Sbjct  356  DAVVAGVLTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSIGNSDDFGCSDVVAF  412



>ref|XP_011005992.1| PREDICTED: U-box domain-containing protein 26-like [Populus euphratica]
Length=413

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 199/238 (84%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E + V + SDP R+  L +LL + S++VR+NSAALIE+V++GTRS +LR QISN + 
Sbjct  176  PLTEFDCVAIASDPERISCLANLLFHSSIEVRVNSAALIENVVAGTRSSDLRLQISNREI  235

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ IL  PLS  RALKIG+K LFALCL KQ RHKAV+AGA E LIDRL D DKCDA
Sbjct  236  IFEGVIDILKNPLSSPRALKIGIKGLFALCLGKQTRHKAVSAGAAETLIDRLADLDKCDA  295

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASEQ+Q
Sbjct  296  ERALATIELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQ  355

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +EA  AG++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  356  KEAVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSVGNSDDFVCSEVVPF  413



>ref|XP_002306161.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
 gb|EEE86672.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
Length=413

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 198/238 (83%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E + V + SDP R+  L +LL + S++VR+NSAALIE+V++GTRS +LR QISN + 
Sbjct  176  PLTEFDCVAIASDPERISCLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNMEI  235

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ IL  PLS  RALKIG+K LFALCL KQ RHKAV+AGA E LIDRL D DKCDA
Sbjct  236  IFEGVIDILKNPLSSPRALKIGIKGLFALCLVKQTRHKAVSAGAAETLIDRLADLDKCDA  295

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCRI  GCAAF AHALTVPLLVK ILKIS RATEYAAGALL++CSASEQ+Q
Sbjct  296  ERALATIELLCRIQVGCAAFVAHALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQ  355

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +EA  AG++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  356  KEAVCAGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSAGNSDDFVCSEVVPF  413



>ref|XP_010270217.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=428

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 201/241 (83%), Gaps = 0/241 (0%)
 Frame = -1

Query  772  VDVPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V +PL E++   V S P RV +L SLLS+ S++VR+N+AALIE V +GTRS E R  I N
Sbjct  188  VMLPLVESQCESVASQPDRVTFLASLLSHSSIEVRVNAAALIEIVAAGTRSVEHRILIGN  247

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
            AD + EGI  IL+ PL+Y RALK+G+KALFALCL KQ RHKAV+AGAV+ALIDRL DF+K
Sbjct  248  ADGVMEGITRILSNPLAYPRALKVGIKALFALCLVKQSRHKAVSAGAVDALIDRLADFEK  307

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
            CDAERALATVELLCRIP GCAAFA HALTVPLLVKIILKIS RATEYAAGALLS+CSAS+
Sbjct  308  CDAERALATVELLCRIPEGCAAFAEHALTVPLLVKIILKISDRATEYAAGALLSLCSASK  367

Query  232  qaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVP  53
            Q QR+A AAGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WP+D    SDD+ CS V P
Sbjct  368  QLQRDAVAAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPDDSIANSDDFGCSDVSP  427

Query  52   F  50
            F
Sbjct  428  F  428



>ref|XP_004309747.1| PREDICTED: U-box domain-containing protein 26 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 170/239 (71%), Positives = 201/239 (84%), Gaps = 0/239 (0%)
 Frame = -1

Query  772  VDVPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V +PL E++ V V SDP RVG+L  LL + S++VR+NSAALIE++L+G+R+ ELRAQISN
Sbjct  176  VMLPLAESDCVAVASDPDRVGFLARLLFHNSMEVRVNSAALIENLLAGSRTAELRAQISN  235

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
             DEI  G++ IL  P+++ RALKIG+KALFALCL KQ R KAV AGA E LI+ L DF+K
Sbjct  236  VDEIHHGVIEILRNPIAHPRALKIGIKALFALCLVKQTRDKAVAAGAPETLINTLADFEK  295

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
            CD+ERALAT+ELLCR+P GCAAFAAHALTVPLLVK ILKIS RATEYAAGALLS+CS SE
Sbjct  296  CDSERALATIELLCRVPEGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSESE  355

Query  232  qaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            Q+Q +A AAG+MTQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED  G SDD+ CS VV
Sbjct  356  QSQNDAVAAGIMTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSDVV  414



>ref|XP_011092561.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   320 bits (820),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 205/237 (86%), Gaps = 0/237 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E E + V S+  RVGYLV LL + SVD+R+NSAA+IE+V++G RS ELRAQIS+AD +
Sbjct  179  LSEPECLFVASESERVGYLVKLLFHSSVDIRVNSAAVIETVVAGIRSSELRAQISSADGV  238

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            FEGIVGILN PL Y RALKIG+KALFALCL KQ+RHKAV AGAVEALIDRL +F+KCD+E
Sbjct  239  FEGIVGILNYPLVYPRALKIGIKALFALCLVKQHRHKAVAAGAVEALIDRLPEFEKCDSE  298

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            RALATVELLCRIPSGCAAF +HALTVPLLVKIILKIS RATEYAAGALLS+CSASE+AQ 
Sbjct  299  RALATVELLCRIPSGCAAFESHALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQA  358

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +A AAGV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP D    SDD+  S VVPF
Sbjct  359  DAVAAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPRDSIARSDDFAGSDVVPF  415



>ref|XP_002285110.1| PREDICTED: U-box domain-containing protein 26 [Vitis vinifera]
Length=415

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   V S P RV +LVSLL + S++VR+NSAALIE V++GTRS +LRAQISN DE
Sbjct  178  PLSESECAFVASQPDRVAHLVSLLFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDE  237

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEGI GILN PL+Y RALK+G+KALFALCLAKQ RHKAV AGAV ALIDRL DF+KCD 
Sbjct  238  IFEGITGILNYPLAYPRALKVGIKALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDV  297

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCR+P+GCAAFAAHALTVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+Q
Sbjct  298  ERALATVELLCRVPAGCAAFAAHALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQ  357

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            REA +AGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED    SDD+ CS VVPF
Sbjct  358  REAVSAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  415



>ref|XP_011088242.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 206/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E E + V SD  RV YLV+LL + S+DVR+NSAA+IE V++G RSPELR QIS+AD +
Sbjct  179  LSEPECLYVASDADRVRYLVNLLFHSSIDVRVNSAAMIEIVVAGIRSPELRVQISSADGV  238

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            FEGIVGILN PL YSRALKIG+KALFALCL KQ+R KAV AGAVEALID+L +F+KCDAE
Sbjct  239  FEGIVGILNYPLLYSRALKIGIKALFALCLVKQHRQKAVAAGAVEALIDKLAEFEKCDAE  298

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            RALATVELLCRIPSGCAAFA+HALTVPLLVKIILKIS RATEYAAGALLS+CSASE+AQ+
Sbjct  299  RALATVELLCRIPSGCAAFASHALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQQ  358

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            EA AAGV+TQLLLLVQSDCTERAKRKAQMLLKLLR+ WP D    SDDY  S VVPF
Sbjct  359  EAVAAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRNSWPHDSLANSDDYAGSDVVPF  415



>ref|XP_009792112.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
sylvestris]
Length=415

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 207/239 (87%), Gaps = 2/239 (1%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E E   V SDP RV YLVSLL +PS+DVR+NSAALIE V++G RS ELRAQIS+ D+
Sbjct  178  PLSEGECFFVASDPDRVSYLVSLLFHPSIDVRVNSAALIEVVVAGIRS-ELRAQISSIDD  236

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            +FEG+VGILN PL+Y RALK+G+KALFALCL KQ+R KAV AGAVEALIDRLQDF+KCDA
Sbjct  237  VFEGVVGILNYPLAYPRALKVGIKALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDA  296

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELL RIPSGCAA A+HALTVPLLVK ILK+S RATEYAAGALLS+C ASEQAQ
Sbjct  297  ERALATIELLSRIPSGCAALASHALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQ  356

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNC-SYVVPF  50
            +EAAAAGV+TQLLLLVQSDCTERAKRKAQ+LLK LRDCWPED    SDDY   S VVPF
Sbjct  357  KEAAAAGVLTQLLLLVQSDCTERAKRKAQLLLKQLRDCWPEDSIANSDDYFAYSDVVPF  415



>emb|CAN74163.1| hypothetical protein VITISV_026443 [Vitis vinifera]
Length=476

 Score =   319 bits (818),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   V S P RV +LVSLL + S++VR+NSAALIE V++GTRS +LRAQISN DE
Sbjct  239  PLSESECAFVASQPDRVAHLVSLLFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDE  298

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEGI GILN PL+Y RALK+G+KALFALCLAKQ RHKAV AGAV ALIDRL DF+KCD 
Sbjct  299  IFEGITGILNYPLAYPRALKVGIKALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDV  358

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCR+P+GCAAFAAHALTVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+Q
Sbjct  359  ERALATVELLCRVPAGCAAFAAHALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQ  418

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            REA +AGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED    SDD+ CS VVPF
Sbjct  419  REAVSAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  476



>ref|XP_007042451.1| Plant U-box 26 [Theobroma cacao]
 gb|EOX98282.1| Plant U-box 26 [Theobroma cacao]
Length=416

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 167/237 (70%), Positives = 196/237 (83%), Gaps = 0/237 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E+E   + SD  +V YL  LL + S++VR+NSA+LIE V++GTRS +LRAQISN DEI
Sbjct  180  LTESECASIASDSNKVIYLSKLLFHSSIEVRVNSASLIEIVVAGTRSSDLRAQISNVDEI  239

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            FEG+  +L    SY RALKI ++ALFALCL KQ RHKAV AGA E LIDRL D DKCDAE
Sbjct  240  FEGVTDLLKNLNSYPRALKISIRALFALCLVKQTRHKAVQAGAAETLIDRLADLDKCDAE  299

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            RALAT+ELLCRIPSGC+AFAAHALTVPLLVK ILKIS RATE++AGAL+++CS SEQ+QR
Sbjct  300  RALATIELLCRIPSGCSAFAAHALTVPLLVKTILKISDRATEHSAGALVALCSESEQSQR  359

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +A +AG++TQLLLLVQSDCT+RAKRKAQ LLKLLRD WPED  G SDD+ CS VVPF
Sbjct  360  DAVSAGILTQLLLLVQSDCTDRAKRKAQTLLKLLRDSWPEDSIGNSDDFACSEVVPF  416



>gb|EPS57772.1| hypothetical protein M569_17045 [Genlisea aurea]
Length=414

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 202/235 (86%), Gaps = 0/235 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E E + + SD  RV YLV+LL + S+DVR+NSAA++E  ++G RSPELRA+IS+ D +
Sbjct  179  LLEQECLYIASDLDRVRYLVNLLFHSSIDVRVNSAAVVEVTVAGIRSPELRARISSLDGV  238

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            F GIVGILN PL+Y  ALKIG+KALFALCLAKQ+RH+AV+AGAVE+LIDRL +F+KCDAE
Sbjct  239  FRGIVGILNYPLAYPHALKIGIKALFALCLAKQHRHRAVSAGAVESLIDRLAEFEKCDAE  298

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            RALATVELLCR+P GCAAFA+HALTVPLLVKIILKIS RATEYAAGALLS+CSASEQ+Q 
Sbjct  299  RALATVELLCRVPDGCAAFASHALTVPLLVKIILKISDRATEYAAGALLSLCSASEQSQG  358

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            EA AAGV+TQL+LLVQSDCTERAKRKAQMLLKLLR+ WP +    SDD+  S VV
Sbjct  359  EAVAAGVLTQLILLVQSDCTERAKRKAQMLLKLLRNSWPLESMCNSDDFAGSDVV  413



>gb|KJB79347.1| hypothetical protein B456_013G045000 [Gossypium raimondii]
Length=416

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 178/237 (75%), Positives = 201/237 (85%), Gaps = 0/237 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E+E   + SDP RV YL  +L + S++VR+NSA+LIE+VLSGTRSP+LRAQISNADEI
Sbjct  180  LNESECESIGSDPNRVVYLSRMLFHSSIEVRINSASLIENVLSGTRSPDLRAQISNADEI  239

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            FEG+V IL    SY RAL+IGV+ALFALCL KQ RHKAV AGA   LIDRL D DKCDAE
Sbjct  240  FEGVVDILRNLNSYPRALRIGVRALFALCLVKQTRHKAVQAGAPATLIDRLADLDKCDAE  299

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            RALAT+ELLCRIPSGC+AFAAHALTVPLLVK ILKIS RATEYAAGAL+++CS SE +QR
Sbjct  300  RALATIELLCRIPSGCSAFAAHALTVPLLVKTILKISDRATEYAAGALMALCSESEGSQR  359

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            EA +AGV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WPED  G SDD+ CS +VPF
Sbjct  360  EAVSAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPEDSIGNSDDFACSEIVPF  416



>ref|XP_008456137.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis melo]
Length=425

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 201/242 (83%), Gaps = 1/242 (0%)
 Frame = -1

Query  772  VDVPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V +PL E+E V+V SDP R+GYL  LL + S++VR+N+AALIE+V++GTR+ ELR QI  
Sbjct  183  VMLPLTESECVLVASDPQRIGYLSHLLFDSSIEVRINAAALIETVIAGTRASELRTQICG  242

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
             DE+FEG+V IL  P +Y RALK+GVKALFALCL KQ RHKAV+AGA E +IDR  D +K
Sbjct  243  IDELFEGVVEILRDPTAYPRALKVGVKALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEK  302

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
             DAERALAT+EL+CR+P+GC AFAAHALTVPLLVK+ILKIS RATE A GAL+S+CSASE
Sbjct  303  YDAERALATIELICRVPTGCDAFAAHALTVPLLVKVILKISDRATESAVGALVSLCSASE  362

Query  232  qaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVV  56
            + +REA AAG++TQLLLLVQSDCTER KRK+Q+LLKLLRD WP++  G SDDY CS  VV
Sbjct  363  ENRREAVAAGILTQLLLLVQSDCTERVKRKSQVLLKLLRDSWPQESVGNSDDYGCSEIVV  422

Query  55   PF  50
            PF
Sbjct  423  PF  424



>ref|XP_004140703.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 gb|KGN57520.1| hypothetical protein Csa_3G203270 [Cucumis sativus]
Length=425

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/242 (69%), Positives = 200/242 (83%), Gaps = 1/242 (0%)
 Frame = -1

Query  772  VDVPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V +PL E+E V+V SDP R+GYL  LL + S++ R+N+AALIE+V++GTR+ ELR QI  
Sbjct  183  VMLPLTESECVLVASDPQRIGYLSHLLFDSSIEDRINAAALIETVIAGTRASELRTQICG  242

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
             DE+FEG+V IL  P +Y RALK+GVKALFALCL KQ RHKAV+AGA E +IDR  D +K
Sbjct  243  IDELFEGVVEILRDPTAYPRALKVGVKALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEK  302

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
             DAERALAT+EL+CRIP+GC AFAAHALTVPLLVK+ILKIS RATE A GAL+S+CSASE
Sbjct  303  YDAERALATIELICRIPTGCDAFAAHALTVPLLVKVILKISDRATESAVGALVSLCSASE  362

Query  232  qaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVV  56
            + +REA AAG++TQLLLLVQSDCTER KRK+Q+LLKLLRD WP++  G SDDY CS  VV
Sbjct  363  ENRREAVAAGILTQLLLLVQSDCTERVKRKSQVLLKLLRDSWPQESVGNSDDYACSEIVV  422

Query  55   PF  50
            PF
Sbjct  423  PF  424



>ref|XP_010263503.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=416

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 195/238 (82%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL EA    V S+  RV +L  LLS+  ++VR+N+AALIE V++GTRS E R  I NAD 
Sbjct  179  PLDEAHCEFVASETDRVAFLSFLLSHSCIEVRVNAAALIEMVVAGTRSLENRILIGNADG  238

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            + EGI  ILN PL+Y RALK+G+KALFALCL KQ RH AV+AGAVEALID+L DF+KCDA
Sbjct  239  VLEGITRILNHPLAYPRALKVGIKALFALCLVKQNRHMAVSAGAVEALIDKLADFEKCDA  298

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+G +AFA HALTVPLLVKIILKIS RATEYA GAL+S+CSASEQ Q
Sbjct  299  ERALATVELLCRIPAGRSAFAEHALTVPLLVKIILKISDRATEYATGALVSLCSASEQLQ  358

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            R+A AAGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED    SDD+ CS V PF
Sbjct  359  RDAVAAGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSIANSDDFACSDVAPF  416



>ref|XP_007153588.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
 gb|ESW25582.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
Length=413

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 199/240 (83%), Gaps = 2/240 (1%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   + SD  +V YL  LLS+ S+DVR+NSAALIE V++GT SPELRA +S  DE
Sbjct  174  PLGESECAALASDSEKVNYLSRLLSHNSLDVRVNSAALIEIVVAGTHSPELRACVSEVDE  233

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I++G+V +L  P+SY RALKIG+KALFALCL KQ RHKAV AGA   L+DRL DF+KCDA
Sbjct  234  IYDGVVDLLRSPISYPRALKIGIKALFALCLVKQTRHKAVAAGAPAVLVDRLADFEKCDA  293

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+GC AFA HALTVP+LVKIILKISHRATEYAAGALLS+CS SE+ Q
Sbjct  294  ERALATVELLCRIPAGCEAFAGHALTVPMLVKIILKISHRATEYAAGALLSLCSESERCQ  353

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSY--VVPF  50
            REA  AGV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D  G SDD+ CS   VVPF
Sbjct  354  REAVTAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPQDCIGNSDDFACSQVVVVPF  413



>ref|XP_008236490.1| PREDICTED: U-box domain-containing protein 26-like [Prunus mume]
Length=436

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 171/239 (72%), Positives = 203/239 (85%), Gaps = 1/239 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PLPE++   V SDP RV YL  L+ + S++VR+NSAALIE+VL+G+R+ ELRA+ISN DE
Sbjct  198  PLPESDCAAVASDPDRVAYLARLVQHSSMEVRVNSAALIENVLAGSRTAELRAEISNVDE  257

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I +G+V IL  P++Y RALKIG+KALFALCL KQ R+KAV+AGA E LI+ L DF+KCD+
Sbjct  258  IHQGVVSILRNPIAYPRALKIGIKALFALCLVKQTRNKAVSAGAPETLINTLADFEKCDS  317

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCR+P GC AFAAHALTVPLLVK ILKIS RATEYAAGALLS+CSASE++Q
Sbjct  318  ERALATIELLCRVPDGCTAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSASEKSQ  377

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  50
             +A AAGV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  378  NDAVAAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  436



>ref|XP_007199948.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
 gb|EMJ01147.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
Length=416

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 171/239 (72%), Positives = 203/239 (85%), Gaps = 1/239 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PLPE++   V SDP RV YL  L+ + S++VR+NSAALIE+VL+G+R+ ELRA+ISN DE
Sbjct  178  PLPESDCAAVASDPDRVAYLAQLVQHSSMEVRVNSAALIENVLAGSRTAELRAEISNVDE  237

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I +G+V IL  P++Y RALKIG+KALFALCL KQ R+KAV+AGA E LI+ L DF+KCD+
Sbjct  238  IHQGVVSILRNPIAYPRALKIGIKALFALCLVKQTRNKAVSAGAPETLINTLADFEKCDS  297

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCR+P GC AFAAHALTVPLLVK ILKIS RATEYAAGALLS+CSASE++Q
Sbjct  298  ERALATIELLCRVPDGCTAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSASEKSQ  357

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  50
             +A AAGV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  358  NDAVAAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  416



>ref|XP_009341339.1| PREDICTED: U-box domain-containing protein 26 [Pyrus x bretschneideri]
Length=395

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 203/239 (85%), Gaps = 1/239 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PLPE++   V SDP R+ YL  L+ +PS++V++NSAALIE+VL+G+R+ ELRAQ+SN DE
Sbjct  157  PLPESDCAAVASDPDRIAYLSHLVQHPSMEVQVNSAALIENVLAGSRTAELRAQVSNVDE  216

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I  G+V IL  P++Y RAL+IGVKA+FALCL K+ R+KAV+AGA E LI+ L DF+KCD+
Sbjct  217  IHHGVVSILRNPIAYPRALRIGVKAVFALCLVKETRNKAVSAGAPETLINVLADFEKCDS  276

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALAT+ELLCR+P GCAAFAAH LTVPLLVK ILKIS RATEYAAGALLS+CSASE+++
Sbjct  277  ERALATIELLCRVPEGCAAFAAHGLTVPLLVKTILKISDRATEYAAGALLSLCSASEKSK  336

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  50
             EA AAGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  337  NEAVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  395



>ref|XP_003529402.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Glycine max]
Length=414

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/240 (71%), Positives = 202/240 (84%), Gaps = 2/240 (1%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   + SD +++GYL  +L++ S DVR+NSAAL+E V+ GT SPELRA++S+ DE
Sbjct  175  PLGESECASLASDSMKIGYLSRMLAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDE  234

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I++G+V +L  P+S+ RALKIG+KALFALCL K  R KAV AGA   L+DRL DF+KCDA
Sbjct  235  IYDGVVDLLRSPISHPRALKIGIKALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDA  294

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+GCAAFAAHALTVP+LVKIILKIS+RATEYAAGALLS+CS SE+ Q
Sbjct  295  ERALATVELLCRIPAGCAAFAAHALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQ  354

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSY--VVPF  50
            REA AAGV+TQLLLL+QSDCTERAKRKAQMLLKLLRD WP+D  G SDD+ CS   VVPF
Sbjct  355  REAVAAGVLTQLLLLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVVVVPF  414



>gb|AES90137.2| plant U-box protein [Medicago truncatula]
Length=410

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 197/234 (84%), Gaps = 0/234 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   + SD  ++ YL SLLS+ S DVR+NSAALIE +++GT SPE+R Q+SN D 
Sbjct  175  PLSESECTSLASDSDKINYLTSLLSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDG  234

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I++G+V IL  P+SY RALKIG+KALFALCL KQ RH+AV+AGA   LIDRL DF+KCDA
Sbjct  235  IYDGVVEILKNPISYPRALKIGIKALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDA  294

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCR+P+GCA+FA HALTVP+LVKIILKIS RATEYAAGAL+++CS SE+ Q
Sbjct  295  ERALATVELLCRVPAGCASFAGHALTVPMLVKIILKISDRATEYAAGALMALCSESERCQ  354

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSY  62
            REA AAGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WP+D  G SDD+ C +
Sbjct  355  REAVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPQDSVGNSDDFACRH  408



>ref|XP_008373128.1| PREDICTED: U-box domain-containing protein 26-like [Malus domestica]
Length=416

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 197/236 (83%), Gaps = 1/236 (0%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            E++   V SDP RV YL  L+ +PS++VR+NSAALIE+VL+G+R+ ELRAQ+SN DEI  
Sbjct  181  ESDCAAVASDPDRVAYLSHLVQHPSMEVRVNSAALIENVLAGSRTAELRAQVSNVDEIHH  240

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G+V IL  P +Y RALKIGVKA+FALCL K+ R+KAV+AGA E LI+ L DF+K D+ERA
Sbjct  241  GVVSILRNPJAYPRALKIGVKAVFALCLVKETRNKAVSAGAPETLINVLADFEKYDSERA  300

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  215
            LAT+ELLCR+P GCAAFAAH LTVPLLVK ILKIS RATEYAAGALLS+CSASE+ Q EA
Sbjct  301  LATIELLCRVPEGCAAFAAHGLTVPLLVKTILKISDRATEYAAGALLSLCSASEKNQNEA  360

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  50
             AAGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  361  VAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  416



>ref|XP_004505237.1| PREDICTED: U-box domain-containing protein 26-like [Cicer arietinum]
Length=415

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 198/240 (83%), Gaps = 2/240 (1%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   + SD  ++ YL  LLS+ S DVR+NSAALIE V++GT SPE+RAQ+SN D 
Sbjct  176  PLSESECTSLASDSDKINYLTRLLSHSSFDVRVNSAALIEFVVAGTHSPEIRAQVSNVDG  235

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I++G+V IL  P+SY RALK+G+KALFALCL KQ RH+AV AGA   L+DRL DF+KCDA
Sbjct  236  IYDGVVEILKNPISYPRALKVGIKALFALCLVKQTRHRAVAAGAPVVLVDRLADFEKCDA  295

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCR+P+G  AFA HALTVP+LVKIILKIS RATEYAAGALL++CS SE+ Q
Sbjct  296  ERALATVELLCRVPAGITAFAGHALTVPMLVKIILKISDRATEYAAGALLALCSESERCQ  355

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSY--VVPF  50
            REA AAGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WP+D  G SDD+ CS   VVPF
Sbjct  356  REAVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPQDSIGNSDDFACSQVVVVPF  415



>gb|KJB32363.1| hypothetical protein B456_005G237200 [Gossypium raimondii]
Length=416

 Score =   297 bits (761),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 167/237 (70%), Positives = 196/237 (83%), Gaps = 0/237 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E+E   + SD  RV YL  LL + S++VR+NSA+LIE+VL+G RS +LRA+I N DEI
Sbjct  180  LTESECTGIGSDSNRVVYLSELLFHSSIEVRVNSASLIETVLAGMRSSDLRAEICNVDEI  239

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            F G+  IL    SY RAL+IGV+ALFALCL KQ RHKAV AGA E LIDRL D DKCDAE
Sbjct  240  FAGVTDILKNLSSYPRALRIGVRALFALCLLKQTRHKAVQAGAAETLIDRLTDLDKCDAE  299

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            RALAT+ELLCRIPSGC+AFA+HALTVPLLVK IL+IS RATEYAAGAL+++CS SEQ+Q+
Sbjct  300  RALATIELLCRIPSGCSAFASHALTVPLLVKTILRISDRATEYAAGALMALCSESEQSQK  359

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +A +AGV+TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED  G SDD+ CS +VPF
Sbjct  360  DAVSAGVLTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSIGNSDDFACSEIVPF  416



>ref|XP_006583889.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Glycine max]
Length=444

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 168/236 (71%), Positives = 200/236 (85%), Gaps = 0/236 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   + SD +++GYL  +L++ S DVR+NSAAL+E V+ GT SPELRA++S+ DE
Sbjct  175  PLGESECASLASDSMKIGYLSRMLAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDE  234

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I++G+V +L  P+S+ RALKIG+KALFALCL K  R KAV AGA   L+DRL DF+KCDA
Sbjct  235  IYDGVVDLLRSPISHPRALKIGIKALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDA  294

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+GCAAFAAHALTVP+LVKIILKIS+RATEYAAGALLS+CS SE+ Q
Sbjct  295  ERALATVELLCRIPAGCAAFAAHALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQ  354

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            REA AAGV+TQLLLL+QSDCTERAKRKAQMLLKLLRD WP+D  G SDD+ CS VV
Sbjct  355  REAVAAGVLTQLLLLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVV  410



>ref|XP_003518699.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=415

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/241 (71%), Positives = 199/241 (83%), Gaps = 3/241 (1%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   + SD V++GYL  +L++ S DVR+NSAALIE V++GT SPELRA++S+ DE
Sbjct  175  PLGESECASLASDSVKIGYLSRMLTHNSFDVRVNSAALIEIVVAGTHSPELRAEVSSVDE  234

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I++G+V +L  P+S+ RALKIG+KALFALCL K  R KAV AG    L+DRL DF+KCDA
Sbjct  235  IYDGVVDLLRSPISHPRALKIGIKALFALCLVKNTRQKAVDAGTPAVLVDRLADFEKCDA  294

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+GC AFA HALTVP+LVKIILKIS RATEYAAGALLS+CS SE+ Q
Sbjct  295  ERALATVELLCRIPAGCEAFAGHALTVPMLVKIILKISDRATEYAAGALLSLCSESERCQ  354

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTG-ISDDYNCSY--VVP  53
            REA AAGV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D  G  SDD+ CS   VVP
Sbjct  355  REAVAAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPQDSIGNNSDDFACSQVVVVP  414

Query  52   F  50
            F
Sbjct  415  F  415



>ref|XP_003607940.1| U-box domain-containing protein [Medicago truncatula]
Length=451

 Score =   295 bits (755),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 196/234 (84%), Gaps = 0/234 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E+E   + SD  ++ YL SLLS+ S DVR+NSAALIE +++GT SPE+R Q+SN D 
Sbjct  175  PLSESECTSLASDSDKINYLTSLLSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDG  234

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I++G+V IL  P+SY RALKIG+KALFALCL KQ RH+AV+AGA   LIDRL DF+KCDA
Sbjct  235  IYDGVVEILKNPISYPRALKIGIKALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDA  294

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCR+P+GCA+FA HALTVP+LVKIILKIS RATEYAAGAL+++CS SE+ Q
Sbjct  295  ERALATVELLCRVPAGCASFAGHALTVPMLVKIILKISDRATEYAAGALMALCSESERCQ  354

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSY  62
            REA AAGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WP+D  G SDD+   +
Sbjct  355  REAVAAGVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPQDSVGNSDDFGIWF  408



>gb|EPS67592.1| hypothetical protein M569_07183, partial [Genlisea aurea]
Length=419

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 190/230 (83%), Gaps = 0/230 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E + + + SD  RV YLV+LLS+ S+DVR+NSAA IE +++G RS +LRAQI + D +
Sbjct  189  LSEQDCLYLASDLDRVKYLVNLLSHSSIDVRINSAAAIEMIVAGVRSSDLRAQIGSLDGV  248

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            FEGIVGILN PL+   ALKIG+KALFALCLAKQ+RH AV+AGA  ++I+RL +F+KC+AE
Sbjct  249  FEGIVGILNYPLANPHALKIGIKALFALCLAKQHRHVAVSAGAAGSIINRLAEFEKCEAE  308

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  221
            +ALATVELLCRIP G AAFA+H LT+PLLVKIILKIS RATEYA+GALLS+C+ S+Q Q 
Sbjct  309  KALATVELLCRIPDGRAAFASHPLTIPLLVKIILKISDRATEYASGALLSLCTMSDQTQA  368

Query  220  eaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  71
            EA AAGV+ QL+LLVQSDCTERAKRKAQMLLKLLR+ WP+D     DD+ 
Sbjct  369  EAVAAGVLNQLILLVQSDCTERAKRKAQMLLKLLRNSWPQDDFEYHDDFG  418



>ref|XP_006422990.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
 gb|ESR36230.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
Length=418

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/238 (72%), Positives = 196/238 (82%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E E + + SD  ++  L SLL + S++VR+NSAALIE VL+G RS ELRAQISN DE
Sbjct  181  PLTETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLDE  240

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ IL    SY R LK+G+KALFALCL KQ RHKAV AGA E L+DRL DFDKCDA
Sbjct  241  IFEGVIDILKNLSSYPRGLKVGIKALFALCLVKQTRHKAVAAGAAETLVDRLADFDKCDA  300

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+GCA FA HALTVPLLVK ILKIS RATEYAAGAL ++CSASE+ Q
Sbjct  301  ERALATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERCQ  360

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            R+A +AGV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WP+D  G SDD+ CS VVPF
Sbjct  361  RDAVSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>ref|XP_006487052.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
 gb|KDO59728.1| hypothetical protein CISIN_1g014817mg [Citrus sinensis]
Length=418

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 196/238 (82%), Gaps = 0/238 (0%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E E + + SD  ++  L SLL + S++VR+NSAALIE VL+G RS ELRAQISN DE
Sbjct  181  PLTETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLDE  240

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            IFEG++ IL    SY R LK+G+KALFALCL KQ R+KAV AGA E L+DRL DFDKCDA
Sbjct  241  IFEGVIDILKNLSSYPRGLKVGIKALFALCLVKQTRYKAVAAGAAETLVDRLADFDKCDA  300

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ERALATVELLCRIP+GCA FA HALTVPLLVK ILKIS RATEYAAGAL ++CSASE+ Q
Sbjct  301  ERALATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERCQ  360

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            R+A +AGV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WP+D  G SDD+ CS VVPF
Sbjct  361  RDAVSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>ref|XP_010690605.1| PREDICTED: U-box domain-containing protein 26 [Beta vulgaris 
subsp. vulgaris]
Length=427

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 195/232 (84%), Gaps = 3/232 (1%)
 Frame = -1

Query  736  VFSDPVRVGYLVSLLSNPS-VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGI  560
            + SDP +VGYLVSLL +PS +D+R+NSAALIES+++GT+SP+LR+ I  ++EI+ G+V I
Sbjct  196  IVSDPDKVGYLVSLLFHPSSIDIRVNSAALIESIIAGTKSPDLRSFICTSEEIYVGVVSI  255

Query  559  LNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVE  380
            L  P    RALKIGVK LFALCL+KQ+RHKA++AGAV ALI RL + DKCD ERALATVE
Sbjct  256  LTNPTPSPRALKIGVKTLFALCLSKQHRHKAISAGAVNALISRLTELDKCDCERALATVE  315

Query  379  LLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGV  200
            LLCR+P GC++F +HALTVPLLVK ILK+S RATEYAAGALLS+ S+SE+ QREA  AGV
Sbjct  316  LLCRVPQGCSSFGSHALTVPLLVKTILKVSDRATEYAAGALLSLASSSERLQREAVNAGV  375

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT--GISDDYNCSYVVPF  50
            +TQLLLLVQSDCTERAKRKAQMLLKLLRD WP++ +    SDD+ CS +VPF
Sbjct  376  LTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDEKSIGNYSDDFYCSDIVPF  427



>ref|XP_010538612.1| PREDICTED: U-box domain-containing protein 26-like [Tarenaya 
hassleriana]
Length=434

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 191/247 (77%), Gaps = 10/247 (4%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + EAE   + +DP RVG +  LL + S++VR+N+AA+IE VL+G++S +L+  IS +  I
Sbjct  188  MTEAECASIAADPNRVGLMTQLLFDSSIEVRVNAAAMIEMVLTGSKSMDLKRLISGSGTI  247

Query  580  FEGIVGILNCPLS-YSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-------  425
            FEG++ +L  P+S + RALK+G+KALFALCL K  RH A++AGA   L+DRL        
Sbjct  248  FEGVLDLLQNPISSFPRALKVGIKALFALCLVKHTRHLAISAGAPAVLVDRLAAGLVDRI  307

Query  424  --DFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLS  251
              DFD+C  ERALATVELLCRIP GC+AFA HALTVP+LVK IL++S RATEYAAGALL 
Sbjct  308  AADFDRCATERALATVELLCRIPVGCSAFAEHALTVPVLVKTILRVSDRATEYAAGALLG  367

Query  250  ICsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  71
            +CSA+E  +REAAAAGV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D  GISD++ 
Sbjct  368  LCSAAEHCRREAAAAGVVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSLGISDEFG  427

Query  70   CSYVVPF  50
             S + PF
Sbjct  428  LSEIAPF  434



>ref|NP_175400.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
 sp|Q9FXA4.1|PUB26_ARATH RecName: Full=U-box domain-containing protein 26; AltName: Full=Plant 
U-box protein 26 [Arabidopsis thaliana]
 gb|AAG13057.1|AC011807_16 Hypothetical protein [Arabidopsis thaliana]
 gb|ABI93922.1| At1g49780 [Arabidopsis thaliana]
 gb|AEE32475.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
Length=421

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/238 (65%), Positives = 190/238 (80%), Gaps = 1/238 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   V SDP RVG++  LL + S+++R+N+AALIE VL+G +S +L+  IS +D I
Sbjct  184  MTETECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGSDSI  243

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  244  FEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDT  303

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ +
Sbjct  304  ERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCR  363

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  364  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAPF  421



>ref|XP_002894216.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70475.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=421

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 191/238 (80%), Gaps = 1/238 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   + SDP RVG++  LL + S+++R+N+AALIE VL+G++S +L+  IS +D I
Sbjct  184  MTETECEAIASDPGRVGFMTRLLFDSSIEIRVNAAALIEMVLTGSKSMDLKLIISGSDSI  243

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  244  FEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDT  303

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ +
Sbjct  304  ERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCR  363

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  364  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVNSDDFNRSEVAPF  421



>dbj|BAC42960.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 189/238 (79%), Gaps = 1/238 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   V SDP RVG++  LL + S+++R+N+AALIE VL+G +S +L+  IS +D I
Sbjct  184  MTETECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGSDSI  243

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AG    LIDRL  DFD+CD 
Sbjct  244  FEGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGVPGILIDRLAADFDRCDT  303

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ +
Sbjct  304  ERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCR  363

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  364  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAPF  421



>ref|XP_010500528.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=422

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 191/239 (80%), Gaps = 2/239 (1%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   V SDP RVG++  LL + S+++R+N+AAL+E VL+G++S +L+  IS +D I
Sbjct  184  MTETECEAVASDPGRVGFMTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSI  243

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  244  FEGVLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAAGILIDRLAADFDRCDT  303

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ +
Sbjct  304  ERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERFR  363

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI-SDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D + + SDD+  + V PF
Sbjct  364  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEVAPF  422



>ref|XP_010461826.1| PREDICTED: U-box domain-containing protein 26 [Camelina sativa]
Length=422

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 191/239 (80%), Gaps = 2/239 (1%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   V SDP RVG+L  LL + S+++R+N+AAL+E VL+G++S +L+  IS +D I
Sbjct  184  MTETECEAVASDPGRVGFLTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSI  243

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  244  FEGVLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDT  303

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ +
Sbjct  304  ERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCR  363

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI-SDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D + + SDD+  + V PF
Sbjct  364  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEVAPF  422



>ref|XP_006306175.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
 gb|EOA39073.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
Length=422

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 189/238 (79%), Gaps = 1/238 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   V SDP RVG++  LL + S+++R+N+AALIE VL+G++S +L+  IS +D I
Sbjct  185  MTETECEAVASDPGRVGFMTRLLFDSSIEIRVNAAALIEMVLTGSKSMDLKLIISGSDSI  244

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            F G++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  245  FVGVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDT  304

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ +
Sbjct  305  ERGLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCR  364

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D T  SDD+  + V PF
Sbjct  365  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTANSDDFARTEVAPF  422



>ref|XP_009145797.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
 ref|XP_009145799.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
Length=422

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 183/243 (75%), Gaps = 5/243 (2%)
 Frame = -1

Query  763  PLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            P+ E +  V + SDP RVG+L  LL + S++ R+N+AALIE V++GT++ +++  +  ++
Sbjct  180  PMTEPDQCVSIISDPGRVGFLTRLLFDSSIETRVNAAALIEMVVTGTKAADIKGTVLTSE  239

Query  586  EIFEGIVGILNCPLSYS---RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DF  419
             IFEG++ +L  P   S   RALKIGVKALFALCL K  RH AV++GA E LIDRL    
Sbjct  240  CIFEGVIDLLRNPTVTSSPRRALKIGVKALFALCLVKNTRHLAVSSGAPEILIDRLAAGL  299

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            D+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A
Sbjct  300  DRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTA  359

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYV  59
             E+ + EA AAGV+ QLLL+VQS+CTERAKRK Q LLKLLRD WP+     SDD+ CS V
Sbjct  360  EERWREEAVAAGVVVQLLLMVQSECTERAKRKGQKLLKLLRDSWPDYSFANSDDFGCSEV  419

Query  58   VPF  50
            VPF
Sbjct  420  VPF  422



>ref|XP_006393215.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
 gb|ESQ30501.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
Length=422

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 190/239 (79%), Gaps = 2/239 (1%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   + SDP RVG++  LL + S++VR+N+AALIE VL+G++S +L+  IS +D +
Sbjct  184  MTEEECESIASDPGRVGFMTRLLFDSSIEVRVNAAALIEMVLTGSKSTDLKLVISGSDSV  243

Query  580  FEGIVGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCD  407
            FEG++ +L  P+S SR ALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD
Sbjct  244  FEGVLDLLKNPISSSRRALKIGIKALFALCLVKQTRHLAISAGAPGILIDRLAADFDRCD  303

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
             ER LATVELLCR+P GC+ F  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ 
Sbjct  304  TERGLATVELLCRLPEGCSGFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERC  363

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            + EAAAAG++TQLLLLVQS+CTERAKRKAQMLLKLLRD WP+D    SDD+  S VVPF
Sbjct  364  RDEAAAAGLVTQLLLLVQSECTERAKRKAQMLLKLLRDSWPDDTLVNSDDFGRSEVVPF  422



>emb|CDY16513.1| BnaA08g02540D [Brassica napus]
Length=423

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 186/238 (78%), Gaps = 1/238 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   + SDP RVG++  LL + S++ R+N+AAL+E VL+G++S +L+  IS +  +
Sbjct  186  MTEGECESISSDPGRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSV  245

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L   +S  RALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  246  FEGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDT  305

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ +
Sbjct  306  ERGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCR  365

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D    SD++  S V PF
Sbjct  366  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSEVAPF  423



>emb|CDY59286.1| BnaCnng34640D [Brassica napus]
Length=423

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 186/238 (78%), Gaps = 1/238 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   + SDP RVG++  LL + S++ R+N+AAL+E VL+G++S +L+  IS +  +
Sbjct  186  MTEGECDSISSDPDRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSV  245

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L   +S  RALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  246  FEGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDT  305

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ +
Sbjct  306  ERGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCR  365

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D     D++  S VVPF
Sbjct  366  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNDDEFGRSEVVPF  423



>ref|XP_009107285.1| PREDICTED: U-box domain-containing protein 26 [Brassica rapa]
Length=472

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 186/238 (78%), Gaps = 1/238 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   + SDP RVG++  LL + S++ R+N+AAL+E VL+G++S +L+  IS +  +
Sbjct  235  MTEGECESISSDPGRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSV  294

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDA  404
            FEG++ +L   +S  RALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  295  FEGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDT  354

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            ER LATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ +
Sbjct  355  ERGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCR  414

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D    SD++  S V PF
Sbjct  415  DEAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSEVAPF  472



>emb|CDX92328.1| BnaA05g20790D [Brassica napus]
Length=423

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 181/244 (74%), Gaps = 6/244 (2%)
 Frame = -1

Query  763  PLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPEL-RAQISNA  590
            P+ E E  V + SDP RVG+L  LL + S++ R+N+AALIE V++GT++ ++ +  +   
Sbjct  180  PMTEPEQCVSIISDPGRVGFLTRLLFDSSIETRVNAAALIEMVVTGTKTADIIKGTVLTT  239

Query  589  DEIFEGIVGILNCPLSYS---RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-D  422
            + IFEG++ +L  P   S   RALKIGVKALFALCL K  R  AV++GA E LIDRL   
Sbjct  240  EYIFEGVIDLLRNPTVTSSPRRALKIGVKALFALCLVKNTRQLAVSSGAPEILIDRLAAG  299

Query  421  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  242
             D+CD ERALATVELLCR P GC AF  HALTVPLLVK IL++S RATEYAAGALL++C+
Sbjct  300  LDRCDTERALATVELLCRTPEGCVAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCT  359

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSY  62
            A E+ + EA AAGV+ QLLL+VQS+CTERAKRKAQ LLKLLRD WP+     S+D+ CS 
Sbjct  360  AEERWREEAVAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSNDFGCSE  419

Query  61   VVPF  50
            VVPF
Sbjct  420  VVPF  423



>emb|CDX99233.1| BnaC05g33480D [Brassica napus]
Length=421

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 182/239 (76%), Gaps = 6/239 (3%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            + ES+I  SD  RVG+L  LL + S++ R+N+AALIE V++G+++ +++  +  ++ IFE
Sbjct  185  QCESII--SDAGRVGFLTRLLFDSSIETRVNAAALIEMVVTGSKTADIKGTVLTSECIFE  242

Query  574  GIVGILNCPLSYS---RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCD  407
            G++ +L  P   S   RALKIGVKALFALCLAK  R  AV++GA E LIDRL    D+CD
Sbjct  243  GVIDLLRNPTVTSSPRRALKIGVKALFALCLAKNTRRIAVSSGAPEILIDRLAAGLDRCD  302

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
            AERALATVELLCR   GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ 
Sbjct  303  AERALATVELLCRTAEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERW  362

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            + EA AAGV+ QLLL+VQS+CTERAKRKAQ LLKLLRD WP+     SDD+ CS VVPF
Sbjct  363  RDEAVAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  421



>ref|XP_002518745.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF43670.1| Spotted leaf protein, putative [Ricinus communis]
Length=420

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 171/203 (84%), Gaps = 1/203 (0%)
 Frame = -1

Query  772  VDVPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V  PL E+E + + S+  R+ +L +LL + S+++R+NSAALIE+V++GT+S +LRAQ SN
Sbjct  172  VMFPLTESECISIASNTERIIFLANLLFHSSIEIRVNSAALIETVIAGTKSSDLRAQFSN  231

Query  592  ADEIFEGIVGILNCPLS-YSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD  416
             DEI EG++ +L  P+S Y RALKIG+KALFALCL KQ RHKAV+AGAVE LIDRL DFD
Sbjct  232  VDEIVEGVIELLKRPISNYPRALKIGIKALFALCLVKQTRHKAVSAGAVETLIDRLADFD  291

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  236
            KCDAERALAT+ELLCR+P G A FA HALTVPLLVK ILKIS RATEYAAGALL++C+AS
Sbjct  292  KCDAERALATIELLCRVPEGVAEFAEHALTVPLLVKTILKISDRATEYAAGALLALCTAS  351

Query  235  eqaqreaaaAGVMTQLLLLVQSD  167
            E++QREA +AG++TQLLLLVQSD
Sbjct  352  EKSQREAVSAGILTQLLLLVQSD  374



>ref|XP_009111906.1| PREDICTED: U-box domain-containing protein 25-like [Brassica 
rapa]
Length=417

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 182/242 (75%), Gaps = 9/242 (4%)
 Frame = -1

Query  763  PLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            P+ E +  V + SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +S+++
Sbjct  181  PMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSSSE  235

Query  586  EIFEGIVGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFD  416
             IFEG++ +L  P S    RALKIG+KALFALCL+K  RH AV+AGA E LIDRL    D
Sbjct  236  SIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLD  295

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  236
            +CD ERALATVE+LCR P GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A 
Sbjct  296  RCDTERALATVEILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAE  355

Query  235  eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            E+ + EAAAAGV+ QLLL+VQS+CTERAKRKAQ LLKLLRD WP+     SDD+ CS VV
Sbjct  356  ERWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVV  415

Query  55   PF  50
            PF
Sbjct  416  PF  417



>gb|ABV89622.1| U-box domain-containing protein [Brassica rapa]
Length=417

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 182/242 (75%), Gaps = 9/242 (4%)
 Frame = -1

Query  763  PLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            P+ E +  V + SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +S+++
Sbjct  181  PMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSSSE  235

Query  586  EIFEGIVGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFD  416
             IFEG++ +L  P S    RALKIG+KALFALCL+K  RH AV+AGA E LIDRL    D
Sbjct  236  SIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLD  295

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  236
            +CD ERALATVE+LCR P GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A 
Sbjct  296  RCDTERALATVEILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAE  355

Query  235  eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            E+ + EAAAAGV+ QLLL+VQS+CTERAKRKAQ LLKLLRD WP+     SDD+ CS VV
Sbjct  356  ERWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVV  415

Query  55   PF  50
            PF
Sbjct  416  PF  417



>emb|CDY50158.1| BnaA01g26180D [Brassica napus]
Length=417

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 182/242 (75%), Gaps = 9/242 (4%)
 Frame = -1

Query  763  PLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            P+ E +  V + SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +S+++
Sbjct  181  PMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSSSE  235

Query  586  EIFEGIVGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFD  416
             IFEG++ +L  P S    RALKIG+KALFALCL+KQ R  AV+AGA E LIDRL    D
Sbjct  236  SIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKQTRRIAVSAGAPEILIDRLAAGLD  295

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  236
            +CD ERALATVE+LCR P GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A 
Sbjct  296  RCDTERALATVEILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAE  355

Query  235  eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            E+ + EAAAAGV+ QLLL+VQS+CTERAKRKAQ LLKLLRD WP+     SDD+ CS VV
Sbjct  356  ERWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVV  415

Query  55   PF  50
            PF
Sbjct  416  PF  417



>ref|XP_006299353.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
 gb|EOA32251.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
Length=425

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 152/250 (61%), Positives = 190/250 (76%), Gaps = 10/250 (4%)
 Frame = -1

Query  772  VDVPLPEAESVI-VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  596
            V +P+ E   ++ + SDP RV +L  LL + S++ R+N+AALIE V +GT+S +L    S
Sbjct  177  VMLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLVGMFS  236

Query  595  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DF  419
            N++ +FEG++ +L  P+S  RALKIG+KALFALCLAKQ RH A+TAGA E LIDRL  DF
Sbjct  237  NSESVFEGVLDLLRNPISSRRALKIGIKALFALCLAKQTRHLAITAGAPEILIDRLAADF  296

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            D+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A
Sbjct  297  DRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLTLCTA  356

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-------DFTGISD  80
             E+ + EAA AGV+ QLLL+VQS+CTERAK+KAQ LLKLLR+ WP+        F   SD
Sbjct  357  EERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRNSWPDYNHHNNSSFAN-SD  415

Query  79   DYNCSYVVPF  50
            D+ CS VVPF
Sbjct  416  DFACSQVVPF  425



>emb|CDX95458.1| BnaC01g33500D [Brassica napus]
Length=417

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 181/242 (75%), Gaps = 9/242 (4%)
 Frame = -1

Query  763  PLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            P+ E +  V + SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +SN++
Sbjct  181  PMTEHDKCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSNSE  235

Query  586  EIFEGIVGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFD  416
             IFEG++ +L  P S    RALKIG+KALFALCL+K  RH AV+AGA E LIDRL    D
Sbjct  236  SIFEGVLDLLRNPASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLD  295

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  236
            +CD ERALATVE+LCR   GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A 
Sbjct  296  RCDTERALATVEILCRSLEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAE  355

Query  235  eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            ++ + EAAAAGV+ QLLL+VQS+CTERAKRKAQ LLKLLRD WP+     SDD+ CS VV
Sbjct  356  DRWRDEAAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVV  415

Query  55   PF  50
            PF
Sbjct  416  PF  417



>ref|XP_006406505.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
 gb|ESQ47958.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
Length=420

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 188/242 (78%), Gaps = 4/242 (2%)
 Frame = -1

Query  763  PLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            P+ E +  V + SDP RV +L  LL + S++ R+N+AALIE V +G++SP+L+   SN++
Sbjct  179  PMTEPDQCVSIASDPGRVEFLTRLLFDSSLETRVNAAALIEMVSTGSKSPDLKGMFSNSE  238

Query  586  EIFEGIVGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFD  416
             +FEG++ +L  P+S    RALKIG+K LFALCL K  RH AV+AGA E LIDRL  DFD
Sbjct  239  SVFEGVLDLLRNPISSYPRRALKIGIKTLFALCLPKNTRHIAVSAGAPEILIDRLAADFD  298

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  236
            +CD ERALATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A 
Sbjct  299  RCDTERALATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAE  358

Query  235  eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  56
            E+ + EAAAAGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+     SDD+ CS VV
Sbjct  359  ERWRDEAAAAGVVVQLLLIVQSECTERAKKKAQKLLKLLRDSWPDYSFANSDDFVCSQVV  418

Query  55   PF  50
            PF
Sbjct  419  PF  420



>gb|KFK35978.1| hypothetical protein AALP_AA4G062500 [Arabis alpina]
Length=432

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 181/239 (76%), Gaps = 2/239 (1%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E E V + SD  RV ++  LL +  +D R+N+AALIE VL+G +S +L+  IS +D +
Sbjct  194  LTETECVSIASDLGRVKFITRLLFDSLIDNRVNAAALIEMVLTGVKSHDLKLMISGSDSV  253

Query  580  FEGIVGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCD  407
            FEG++ +L  P S SR ALKIG+K++FALCL KQ RH AV+AG    LIDRL  DFD+CD
Sbjct  254  FEGVLDLLKNPNSSSRRALKIGIKSVFALCLVKQSRHLAVSAGVPAVLIDRLAADFDRCD  313

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
             ER LATVELLCR+P GCAAF+ HALTV  LVK IL++S RATEYAAGALL++C+A E+ 
Sbjct  314  TERGLATVELLCRLPEGCAAFSEHALTVDFLVKTILRVSERATEYAAGALLALCTAEERC  373

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            + EA   G++TQLLLLVQSDCTERAKRKAQMLLKLLRD WPE+  G SD++  S V PF
Sbjct  374  REEAVTVGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPENNLGNSDEFGRSEVAPF  432



>ref|XP_010468287.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=412

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 186/249 (75%), Gaps = 9/249 (4%)
 Frame = -1

Query  772  VDVPLPEAESVI-VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  596
            V +P+ E   ++ + SDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   S
Sbjct  165  VMLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFS  224

Query  595  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DF  419
            N + +FEG++ +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DF
Sbjct  225  NYESVFEGVLDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADF  284

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            D+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+ 
Sbjct  285  DRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTE  344

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE------DFTGISDD  77
             E+ + EAA AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+       F   SDD
Sbjct  345  EERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNNHNSSFAN-SDD  403

Query  76   YNCSYVVPF  50
            + CS VVPF
Sbjct  404  FACSQVVPF  412



>ref|XP_010466083.1| PREDICTED: U-box domain-containing protein 25 [Camelina sativa]
Length=424

 Score =   253 bits (646),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 149/249 (60%), Positives = 186/249 (75%), Gaps = 9/249 (4%)
 Frame = -1

Query  772  VDVPLPEAESVI-VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  596
            V +P+ E   ++ + SDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   S
Sbjct  177  VMLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFS  236

Query  595  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DF  419
            N + +FEG++ +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DF
Sbjct  237  NYESVFEGVLDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADF  296

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            D+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+ 
Sbjct  297  DRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTE  356

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE------DFTGISDD  77
             E+ + EAA AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+       F   SDD
Sbjct  357  EERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNNHNSSFAN-SDD  415

Query  76   YNCSYVVPF  50
            + CS VVPF
Sbjct  416  FACSQVVPF  424



>dbj|BAF01749.1| hypothetical protein [Arabidopsis thaliana]
Length=419

 Score =   253 bits (645),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 187/246 (76%), Gaps = 6/246 (2%)
 Frame = -1

Query  772  VDVPLPEAESVI-VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  596
            V +P+ E    + + SDP RV +L  LL + S++ R+N+AALIE V +GT+S +L+  IS
Sbjct  175  VMLPITEPNQFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSIS  234

Query  595  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DF  419
            N++ +FEG++ +L  P+S  RALKIG+K LFALC  K  RH A+TAGA E LIDRL  DF
Sbjct  235  NSESVFEGVLDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADF  294

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            D+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A
Sbjct  295  DRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTA  354

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI--SDDYNC-  68
             E+ + EAA AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP D+     SDD+ C 
Sbjct  355  EERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWP-DYNSFANSDDFGCS  413

Query  67   SYVVPF  50
            S VVPF
Sbjct  414  SQVVPF  419



>ref|NP_566632.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
 sp|Q9LT79.1|PUB25_ARATH RecName: Full=U-box domain-containing protein 25; AltName: Full=Plant 
U-box protein 25 [Arabidopsis thaliana]
 dbj|BAB02462.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63504.1| unknown [Arabidopsis thaliana]
 gb|ABG25071.1| At3g19380 [Arabidopsis thaliana]
 gb|AEE76233.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
Length=421

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 187/246 (76%), Gaps = 6/246 (2%)
 Frame = -1

Query  772  VDVPLPEAESVI-VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  596
            V +P+ E    + + SDP RV +L  LL + S++ R+N+AALIE V +GT+S +L+  IS
Sbjct  177  VMLPITEPNQFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSIS  236

Query  595  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DF  419
            N++ +FEG++ +L  P+S  RALKIG+K LFALC  K  RH A+TAGA E LIDRL  DF
Sbjct  237  NSESVFEGVLDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADF  296

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            D+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A
Sbjct  297  DRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTA  356

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI--SDDYNC-  68
             E+ + EAA AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP D+     SDD+ C 
Sbjct  357  EERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWP-DYNSFANSDDFGCS  415

Query  67   SYVVPF  50
            S VVPF
Sbjct  416  SQVVPF  421



>ref|XP_002885309.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61568.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 189/248 (76%), Gaps = 8/248 (3%)
 Frame = -1

Query  772  VDVPLPEAES-VIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRA--Q  602
            V +P+ E    V + SDP RV +L  LL + S+D R+N+AALIE V +GT+S +L+    
Sbjct  151  VMLPITEPNQCVSISSDPGRVEFLTRLLFDSSIDTRVNAAALIEIVSTGTKSADLKGMFS  210

Query  601  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-  425
            ISN++ +FEG++ +L  P+S  RALKIG+K LFALCL K  RH A+TAGA E LIDRL  
Sbjct  211  ISNSESVFEGVLDLLRNPISSRRALKIGIKTLFALCLVKSTRHIAITAGAPEILIDRLAA  270

Query  424  DFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  245
            DFD+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S R+TEYAAGALL++C
Sbjct  271  DFDRCDTERALATVELLCRSPEGCAAFGEHALTVPLLVKTILRVSDRSTEYAAGALLALC  330

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI--SDDYN  71
            +A E+ + EAAAAGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP D+     SDD+ 
Sbjct  331  TAEERWREEAAAAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWP-DYNSFANSDDFG  389

Query  70   C-SYVVPF  50
            C S VVPF
Sbjct  390  CSSQVVPF  397



>ref|XP_010507691.1| PREDICTED: U-box domain-containing protein 25-like [Camelina 
sativa]
Length=425

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 148/250 (59%), Positives = 185/250 (74%), Gaps = 10/250 (4%)
 Frame = -1

Query  772  VDVPLPEAESVI-VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  596
            V +P+ E   ++ + SDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   S
Sbjct  177  VMLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSEDPKGTFS  236

Query  595  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DF  419
            N + +FEG++ +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DF
Sbjct  237  NYESVFEGVLNLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADF  296

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            D+CD ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+ 
Sbjct  297  DRCDTERALATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTE  356

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-------DFTGISD  80
             E+ + EAA AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+        F   SD
Sbjct  357  EERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNNHNNNSFAN-SD  415

Query  79   DYNCSYVVPF  50
            D+ CS V PF
Sbjct  416  DFACSQVAPF  425



>gb|KFK39278.1| hypothetical protein AALP_AA3G223600 [Arabis alpina]
Length=418

 Score =   250 bits (639),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 187/241 (78%), Gaps = 5/241 (2%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            P+ + ES+   SDP RV +L  LL + S++ R+N+AALIE VL+GT+S +L+  ISN++ 
Sbjct  180  PITDPESIA--SDPNRVEFLTRLLYDSSIETRVNAAALIEMVLTGTKSSDLKEAISNSES  237

Query  583  IFEGIVGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDK  413
            +F+G++ IL  P+S    RALKIG+KALFALCL+K  RH AV +GA E LIDRL  DFD+
Sbjct  238  VFQGVLDILRNPISSYPRRALKIGIKALFALCLSKTARHIAVFSGAPEILIDRLASDFDR  297

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
            C+ ERALATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+A E
Sbjct  298  CETERALATVELLCRSPEGCAAFGDHALTVPLLVKTILRVSDRATEYAAGALLAICTAEE  357

Query  232  qaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVP  53
            + + EAAAAGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+     S  + CS VVP
Sbjct  358  RWREEAAAAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYSFANSHHFACSQVVP  417

Query  52   F  50
            F
Sbjct  418  F  418



>ref|XP_006847114.1| PREDICTED: U-box domain-containing protein 26 [Amborella trichopoda]
 gb|ERN08695.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda]
Length=420

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 172/236 (73%), Gaps = 3/236 (1%)
 Frame = -1

Query  757  PEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  578
            PE     V S+   +  L  LL + S+DVR N+AA++E+ LS  R  E RA I   D + 
Sbjct  188  PEPYCASVVSNSNHLSRLSVLLVHASLDVRANTAAIVEAALSSGR--ESRAIIGATDGLI  245

Query  577  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAER  398
              +V +L  PL++ RALK+ VK+LF+LCLAK  R  A+ AGA  AL++RL D D+CDAER
Sbjct  246  PALVNLLREPLAHPRALKLAVKSLFSLCLAKPNRELAIEAGAASALVERLVDLDRCDAER  305

Query  397  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  218
            ALAT+ELLCR P+GCAAF AHAL VPLLVK+ILK+S RATE AAGALL++C+ SE  Q+E
Sbjct  306  ALATIELLCRTPAGCAAFEAHALAVPLLVKMILKVSDRATESAAGALLAVCATSEATQKE  365

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            A   GV+TQLLLLVQS+CT RAKRKAQ+LLKLLRD WP++    S DY CS +VPF
Sbjct  366  AVTVGVVTQLLLLVQSECTARAKRKAQLLLKLLRDAWPDESVANS-DYACSDIVPF  420



>gb|EYU37659.1| hypothetical protein MIMGU_mgv1a019070mg, partial [Erythranthe 
guttata]
Length=327

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E E + V SDP RV YLV+LL + S+DVR+NSAA+IE+V++G RSPE R QIS +D +
Sbjct  179  LSEPECLYVASDPDRVCYLVNLLFHSSIDVRVNSAAVIENVVAGIRSPEFRTQISCSDGV  238

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  401
            FEGIVGIL+ P++Y+RALK+G+KALFALCL KQ+RHKAV AGAVEALIDRL +F+KCDAE
Sbjct  239  FEGIVGILSYPVAYNRALKVGIKALFALCLVKQHRHKAVAAGAVEALIDRLAEFEKCDAE  298

Query  400  RALATVELLCRIPSGCAAFAAHALTVPLL  314
            RALATVELLCR PSGCAAFA+HALTVPLL
Sbjct  299  RALATVELLCRFPSGCAAFASHALTVPLL  327



>emb|CBI32390.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -1

Query  508  LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHAL  329
            +F L  ++  RHKAV AGAV ALIDRL DF+KCD ERALATVELLCR+P+GCAAFAAHAL
Sbjct  226  MFPLSESECARHKAVAAGAVTALIDRLADFEKCDVERALATVELLCRVPAGCAAFAAHAL  285

Query  328  TVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQSDCTERAK  149
            TVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+QREA +AGV+TQLLLLVQSDCTERAK
Sbjct  286  TVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSAGVVTQLLLLVQSDCTERAK  345

Query  148  RKAQMLLKLLRDCWPEDFTGISDDYNCSYV  59
            RKAQ+LLKLLRD WPED    SDD+ CS V
Sbjct  346  RKAQLLLKLLRDSWPEDSVVNSDDFGCSDV  375



>ref|XP_009416906.1| PREDICTED: U-box domain-containing protein 26 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 151/238 (63%), Gaps = 8/238 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNA  590
            +PL EAES +V + P R+  L  ++  +PS + R+N+AA+IESV +GTRS E RA I   
Sbjct  180  LPLSEAESAVVATRPERLHRLGEIVKGHPSSEARINAAAVIESVATGTRSAETRATIGGM  239

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  410
            D +  G+V ++  P    RA+++G++ L A+CLAK+ R +AV AGA  A++ R+ +    
Sbjct  240  DGVMGGLVALVEQP-GNPRAVRVGIRGLLAMCLAKENRARAVAAGAAAAVVRRMGELSSS  298

Query  409  DAERALATVELLCRIPSGCAAFAAHALTVPLLVK-----IILKISHRATEYAAGALLSIC  245
            D ERALATVELLCR   G  A  A        V      +  K S RA E+AAGAL+++ 
Sbjct  299  DLERALATVELLCRGEGGREAVVAGWGGGAAAVAALVRLMAWKASGRAAEHAAGALVAVL  358

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  74
              SE  QREA AAGV+  LLL+VQ  C++RAKRKAQ+LLKLLR  WP  DF   SDD+
Sbjct  359  GGSEALQREAVAAGVVAHLLLMVQGGCSDRAKRKAQLLLKLLRPAWPYRDFIANSDDF  416



>ref|XP_010481065.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=361

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            + E E   V SDP RVG+L  LL + S+++R+N+AAL+E VL+G++S +L+  IS +D I
Sbjct  184  MTETECEAVASDPGRVGFLTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSI  243

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDA  404
            FEG++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD 
Sbjct  244  FEGVLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDT  303

Query  403  ERALATVELLCRIPSG  356
            ER LATVEL+    +G
Sbjct  304  ERGLATVELILSHQTG  319



>ref|XP_008784183.1| PREDICTED: U-box domain-containing protein 25-like [Phoenix dactylifera]
Length=416

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 157/238 (66%), Gaps = 9/238 (4%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            L E ES  V   P R+  LV ++  +P+++ R+++AA++E+V +G RS E RA +   + 
Sbjct  175  LTEGESAEVAGRPERLRRLVEVMREHPAMEARISAAAVLEAVAAGARSAEARAAVGATEG  234

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKC  410
            + EG+VG++    S +RA+++G++ LF+LCLAK+ R +AV AGA  A++ R+ D   ++ 
Sbjct  235  VMEGLVGLVEEKGSSARAVRVGIRGLFSLCLAKENRGRAVAAGAAAAVVRRIVDLAAERG  294

Query  409  DAERALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  245
            DAERALATVELLCR   G       A    A    L+  +  K S RA E+AAGAL+++ 
Sbjct  295  DAERALATVELLCRTEGGREAVVAGAGGGAAAVEALVRAMAGKASERAAEHAAGALVAVV  354

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  74
              SE  QREA  AGV+TQLLL+VQ  C++RAKRKAQ+LLKLLR  WP +D+   SDD+
Sbjct  355  GGSECLQREAVGAGVVTQLLLMVQGGCSDRAKRKAQVLLKLLRSAWPHDDYIANSDDF  412



>gb|ABK24171.1| unknown [Picea sitchensis]
Length=308

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 133/234 (57%), Gaps = 18/234 (8%)
 Frame = -1

Query  736  VFSDPVRVGYLV--SLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV-  566
            VF D  R+  L   SL S     VR+N+  L+E  L          Q S    + +G++ 
Sbjct  78   VFVDEQRMLDLAAFSLNSTAPPGVRLNALLLLEKTLV--------FQPSGGHVVVKGLME  129

Query  565  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  386
            G++    +Y    K+ +KAL ALCL ++ R +AV AG V+A+++ L +  +  AERALAT
Sbjct  130  GLVRSLPNYQ---KLVIKALLALCLTERNRGEAVRAGVVDAILELLPNLKEVCAERALAT  186

Query  385  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas---eqaqrea  215
            ++LLC +  G  A   HAL VPLL+ +ILK+S R T YA  AL +IC        A++ A
Sbjct  187  LDLLCTVSEGRRALREHALAVPLLLDMILKVSDRGTGYAVSALCAICVHEDGGIDARKNA  246

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVP  53
              +G  TQLLLL+QSDCT RAKRKA  LLK+L   W E    I D+ NC +  P
Sbjct  247  IQSGAFTQLLLLLQSDCTSRAKRKALQLLKVLHKVWGEGSCNIPDE-NCIFSSP  299



>ref|XP_001778934.1| predicted protein [Physcomitrella patens]
 gb|EDQ56270.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 115/203 (57%), Gaps = 24/203 (12%)
 Frame = -1

Query  676  DVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGI-------LNCPL---SYSRAL  527
            D R N+ +L+E +              + +E F+G +G        LN  L    + + +
Sbjct  7    DARENACSLLEKL--------------SLNEAFKGTIGACSGVMEALNTTLPDEKHLKLV  52

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K+  K L ALCL ++ R +AV  GAV +L++ L       AE+ALAT+ELL  I  G AA
Sbjct  53   KMATKTLLALCLLQENRFRAVEVGAVASLLEMLPRTRSATAEKALATLELLGTIEEGKAA  112

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQSD  167
               HAL VP+LV++IL +S R TEYAAG L S+C  +   +  A A G  T+LLLL+QSD
Sbjct  113  IIDHALAVPVLVELILTVSDRGTEYAAGTLSSMCRDNMAMREAAVAHGAPTKLLLLIQSD  172

Query  166  CTERAKRKAQMLLKLLRDCWPED  98
            CT RA RKA  LLK+L   W +D
Sbjct  173  CTARANRKANQLLKVLHKLWVQD  195



>gb|ABK25582.1| unknown [Picea sitchensis]
Length=413

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 132/240 (55%), Gaps = 30/240 (13%)
 Frame = -1

Query  736  VFSDPVRVGYLV--SLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE---G  572
            VF D  R+  L   SL S     VR+N+  L+E  L                 +F+   G
Sbjct  183  VFVDEQRMLDLAAFSLNSTAPPGVRLNALLLLEKTL-----------------VFQPSGG  225

Query  571  IVGILNCPLSYSRAL----KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
             VG+        R+L    K+ +KAL ALCL ++ R +AV AG V+A+++ L +  +  A
Sbjct  226  HVGVKGLMEGLVRSLPNYQKLVIKALLALCLTERNRGEAVRAGVVDAILELLPNLKEVCA  285

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq--  230
            ERALAT++LLC +  G  A   HAL VPLL+ +ILK+S R TEYA  AL +IC   +   
Sbjct  286  ERALATLDLLCTVSEGRRALREHALAVPLLLDMILKVSDRGTEYAVSALCAICVHEDGGI  345

Query  229  -aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVP  53
             A+  A  +G  TQLLLL+QSDCT RAKRKA  LLK+L   W E    I D+ NC +  P
Sbjct  346  DARENAIQSGAFTQLLLLLQSDCTSRAKRKALQLLKVLHKVWGEGSCNIPDE-NCIFSSP  404



>ref|XP_004952703.1| PREDICTED: U-box domain-containing protein 26-like [Setaria italica]
Length=408

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 116/182 (64%), Gaps = 3/182 (2%)
 Frame = -1

Query  601  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  422
            +  A+ + EG+V +     +++RA+++G++ LFALCLAK+ R +AV+AGA  AL  R+ +
Sbjct  228  LGAAEGVMEGLVALAE-EKAHARAVRVGIRGLFALCLAKENRPRAVSAGAASALARRVSE  286

Query  421  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSIC  245
                + ERALA VE LCR   G  A  A A   P  V  +++ +S RA E+AAGAL+++ 
Sbjct  287  GGAGEPERALAAVERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRAAEHAAGALVAVV  346

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDYNC  68
              SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+  
Sbjct  347  GGSEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPTTDCIANSDDFLQ  406

Query  67   SY  62
             Y
Sbjct  407  PY  408



>dbj|BAJ97989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 144/240 (60%), Gaps = 7/240 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSN--PSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V + EAE+V V     RV  L  +L +   +++ ++N+ A++E+  +     E R  +  
Sbjct  170  VGMGEAEAVDVVGREDRVTRLAKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLGA  228

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD-  416
            AD + EG+V +++   + +RA+++G++ LFALCLAK+ R +AV+AGA  AL  R+ +   
Sbjct  229  ADGVIEGLVALVD-EKANARAVRVGIRGLFALCLAKENRQRAVSAGAASALARRVAEGGC  287

Query  415  KCDAERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
              + ERALA VE L R   G  A  +       +++ ++  +S RA E+AAGAL+++   
Sbjct  288  AGELERALAAVERLSRTDGGREAVISGAGGGAAVVIALVRAMSGRAAEHAAGALVAVVGG  347

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDYNCSY  62
            SE  Q EA  AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+   Y
Sbjct  348  SEVLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSDDFLRPY  407



>ref|XP_009403520.1| PREDICTED: U-box domain-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 139/236 (59%), Gaps = 8/236 (3%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            + EAES  V + P R+  L  ++  +PS + R+N+A +IE+V +G RS E RA +   + 
Sbjct  183  MTEAESAGVAARPERLRRLGEVVRGHPSTEARINAATVIEAVAAGARSAETRAAVGGTEG  242

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            + EG+V ++       RA ++G++ LFALCLAK+ R +A+ AGA  A++ R+ +    D 
Sbjct  243  VMEGLVELV-AQRGNGRAGRVGIRGLFALCLAKENRGRALAAGAAAAVVGRVAELASSDV  301

Query  403  ERALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            ERALATVELLCR   G                 L+  +  K S RA E+AA  L+++   
Sbjct  302  ERALATVELLCREDGGRDAVVAGWGGGAVAVAALVRVMAGKASGRAAEHAAAVLVAVLGG  361

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  74
            SE    EA AAGV+  LLL+VQ  C+ERAKRKAQ+LLKL R  WP  D    SDD+
Sbjct  362  SEALHAEAVAAGVVAHLLLMVQGGCSERAKRKAQLLLKLFRSAWPRHDTISNSDDF  417



>gb|EMS66308.1| U-box domain-containing protein 25 [Triticum urartu]
Length=407

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 144/240 (60%), Gaps = 7/240 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSN--PSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V + EAE+V V     RV  L  +L +   +++ ++N+ A++E+  +     E R  +  
Sbjct  170  VGMGEAEAVDVVGREERVTRLGKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLGA  228

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD-  416
            AD + EG+V +++   + +RA++IG++ LFALCLAK+ R +AV+AGA  AL  R+ +   
Sbjct  229  ADGVIEGLVALVD-EKANARAVRIGIRGLFALCLAKENRQRAVSAGAASALARRVAEGGC  287

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALT-VPLLVKIILKISHRATEYAAGALLSICsa  239
              + ERALA VE L R   G  A  + A     +++ ++  +S RA E+AAGAL+++   
Sbjct  288  AGELERALAAVERLSRTEGGREAVVSGAGGGAAVVIALVRAMSGRAAEHAAGALVAVVGG  347

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDYNCSY  62
            SE  Q EA  AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D    S D+   Y
Sbjct  348  SEGLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSADFLQPY  407



>gb|EMT28323.1| U-box domain-containing protein 25 [Aegilops tauschii]
Length=407

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 144/240 (60%), Gaps = 7/240 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSN--PSVDVRMNSAALIESVLSGTRSPELRAQISN  593
            V + EAE+V V     RV  L  +L +   +++ ++N+ A++E+  +     E R  +  
Sbjct  170  VGMGEAEAVDVVGREDRVTRLGKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLGA  228

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD-  416
            AD + EG+V +++   + +RA++IG++ +FALCLAK+ R +AV+AGA  AL  R+ +   
Sbjct  229  ADGVIEGLVALVD-EKANARAVRIGIRGVFALCLAKENRQRAVSAGAASALARRVAEGGC  287

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALT-VPLLVKIILKISHRATEYAAGALLSICsa  239
              + ERALA VE L R   G  A  + A     L++ ++  +S RA E+AAGAL+++   
Sbjct  288  AGELERALAAVERLSRTEGGREAVVSGAGGGAALVIALVRAMSGRAAEHAAGALVAVVGG  347

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDYNCSY  62
            SE  Q EA  AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D    S D+   Y
Sbjct  348  SEVLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSADFLQPY  407



>ref|XP_010489938.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=302

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = -1

Query  772  VDVPLPEAESVI-VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  596
            V +P+ E   ++ + SDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   S
Sbjct  177  VMLPITEPNQLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFS  236

Query  595  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDF  419
            N + +FEG++ +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DF
Sbjct  237  NYESVFEGVLDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADF  296

Query  418  DKCDAE  401
            D+CD E
Sbjct  297  DRCDTE  302



>ref|XP_009406118.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Musa acuminata subsp. malaccensis]
Length=421

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 148/238 (62%), Gaps = 8/238 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLS-NPSVDVRMNSAALIESVLSGTRSPELRAQISNA  590
            +PL E ESV V S P R+  L  ++  + S++ R+N+AA+IE+V  G RS E RA +   
Sbjct  181  LPLTETESVAVASRPERLCRLGEMVRRHASMEARINAAAVIEAVAVGARSAETRASVGGT  240

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  410
            + +  G+V +        RA+++G++ LFALCLAK+ R +AV AGA  A++ RL +    
Sbjct  241  NGVVVGLVALAE-QRGNPRAVRVGIRGLFALCLAKENRGRAVAAGAAAAVVGRLGELASS  299

Query  409  DAERALATVELLCRIPSGCAAFAA-----HALTVPLLVKIILKISHRATEYAAGALLSIC  245
            DAERALATVELLCR+  G  A  A      A  V L+  +  K S RA E+AAGALL++ 
Sbjct  300  DAERALATVELLCRVEGGREAVVAGWGGGDAAVVALVRAMAGKASWRAAEHAAGALLAVL  359

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTGISDDY  74
              SE  Q  A AAGV+  LL+LVQ  C++RA RKAQ+LLKLLR  WP  D    SDD+
Sbjct  360  GPSEALQMVAVAAGVVGHLLMLVQGGCSDRAXRKAQLLLKLLRSAWPHYDSIANSDDF  417



>ref|XP_001752821.1| predicted protein [Physcomitrella patens]
 gb|EDQ82325.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 3/162 (2%)
 Frame = -1

Query  574  GIVGILNCPLSYSRALKI---GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            G++  LN  L + + LK+     + L ALCL ++ R +A  AGAV ++++ L       A
Sbjct  414  GVLEGLNSILLHEKHLKLVKLATRTLLALCLLRENRLRAAEAGAVASILEMLPLARSAVA  473

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            E+ALAT+ELL     G AA   HAL VP+LV++ILK+S R TEYAAG L +ICS +   Q
Sbjct  474  EKALATLELLSTTEEGKAAIIDHALAVPVLVELILKVSDRGTEYAAGTLSAICSDNLAMQ  533

Query  223  reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
              A   G  T+LLLL+QSDCT RAKRKA  LLK+L   W ++
Sbjct  534  EAAVEHGAPTKLLLLIQSDCTARAKRKANQLLKVLHKLWMQN  575



>ref|XP_003575105.1| PREDICTED: U-box domain-containing protein 25-like [Brachypodium 
distachyon]
Length=412

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 144/242 (60%), Gaps = 8/242 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNP----SVDVRMNSAALIESVLSGTRSPELRAQI  599
            + + EAE+V V     RV  L  LL +     +++ R+N+ A++E+  +     E R  +
Sbjct  172  IGMGEAEAVEVVGREERVARLGKLLGSSQGIMTLEARVNAGAVVEAAAA-VSGAEARVVL  230

Query  598  SNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF  419
              A+ + EG+V +++   + +RA+++G++ LFALCLAK+ R +AV AGA  AL  R+ + 
Sbjct  231  GVAEGVMEGLVALVDEKGNNARAVRVGIRGLFALCLAKENRPRAVAAGAASALARRVAEG  290

Query  418  D-KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSIC  245
                + ERALA VE LCR   G  A  + A      V  +++ +S RA E+AAGAL+++ 
Sbjct  291  GCAGEPERALAAVERLCRTEGGRDAVVSGAGGGATAVTALVRAMSGRAAEHAAGALVAVV  350

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDYNC  68
              SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+  
Sbjct  351  GGSEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSDDFLN  410

Query  67   SY  62
             Y
Sbjct  411  PY  412



>ref|XP_001762017.1| predicted protein [Physcomitrella patens]
 gb|EDQ73121.1| predicted protein [Physcomitrella patens]
Length=587

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 94/158 (59%), Gaps = 14/158 (9%)
 Frame = -1

Query  529  LKIGVKALFALCLAKQYRHK--------------AVTAGAVEALIDRLQDFDKCDAERAL  392
            +K+  K L ALCL ++ R +              AV  GAV +L++ L       AE+ L
Sbjct  416  VKLATKTLLALCLLRENRRRFSKSYTVQLLALSRAVEVGAVASLLEMLPWVGSATAEKVL  475

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  212
            AT+ELL  I  G AA   HAL VP+LV++ILK+S R TEYAAG L  +CS S   +  A 
Sbjct  476  ATLELLGTIEEGKAAIIDHALAVPVLVELILKVSDRGTEYAAGTLSMMCSDSIAMREAAV  535

Query  211  aAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
            A G  T+LLLL+QSDCT RAKRKA  LLK+L   W +D
Sbjct  536  AHGAPTKLLLLIQSDCTARAKRKASQLLKVLHKLWVQD  573



>ref|XP_010912457.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Elaeis guineensis]
Length=411

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 147/238 (62%), Gaps = 14/238 (6%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            L E ES  V   P R+  LV ++  +P+++ R+++AA++E+V +       RA +   + 
Sbjct  175  LTEGESAEVAGRPERLRRLVEVMREHPAMEARISAAAVLEAVAA-----GARAAVGATEG  229

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC--  410
            + EG+VG+L    S +RA++ G++ LF+LCLAK+ R +AV AGA  A++   +       
Sbjct  230  VMEGLVGLLEEKGSSARAVRAGIRGLFSLCLAKENRGRAVAAGAAAAVVXADRGAGGXAR  289

Query  409  DAERALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  245
            DAERALATVELLCR   G       A    A  V L+  +  K S RA E+AAGAL+++ 
Sbjct  290  DAERALATVELLCRTEGGREAVVAGAGGGAAAVVALVRAMAGKASERAAEHAAGALVAVV  349

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  74
              SE  QREA  AG++TQLLL+VQ  C++RAKRKAQ+LLKLLR  WP  D    SDD+
Sbjct  350  GGSEWLQREAVGAGLVTQLLLMVQGGCSDRAKRKAQLLLKLLRSAWPHHDSIANSDDF  407



>ref|XP_002974135.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
 gb|EFJ25090.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
Length=405

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 139/230 (60%), Gaps = 9/230 (4%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLS-NPSVDVRMNSAALIESVLSGTRSPEL-RAQISN  593
            +PL ++E   +     R+G +  ++    S+D R+N+A L+E + S   +PE  +  +  
Sbjct  178  LPLKDSERRSIAQCRRRLGAVSRIVRRGRSMDARINAAVLVEKIASD--APEAAKLAMGQ  235

Query  592  ADEIFEGIVGILNCPLS--YSRALKIGVKALFALCL--AKQYRHKAVTAGAVEALIDRLQ  425
               + EG+V +L    S    RA K GVKALF+LCL  A     +AV+AGA  AL++ L 
Sbjct  236  IPGLLEGLVDLLRGDHSAVSPRAPKSGVKALFSLCLCSAASNSERAVSAGAAAALVEHLP  295

Query  424  DFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIIL-KISHRATEYAAGALLSI  248
                 DA+R L  +ELLCR  +G    A HAL VP LV  I  + S +A E AAG LL++
Sbjct  296  AAQHGDADRTLGALELLCRTRAGREVVAQHALAVPALVAAIQCRSSFQAAECAAGTLLAV  355

Query  247  CsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
            CS SE+ Q  AA AGV+TQLLLL+QSDCT+RAKRKA  LLKLLR  W ED
Sbjct  356  CSGSEEVQLAAAEAGVLTQLLLLIQSDCTDRAKRKAVELLKLLRRWWAED  405



>ref|XP_002968838.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
 gb|EFJ29954.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
Length=396

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 139/230 (60%), Gaps = 9/230 (4%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLS-NPSVDVRMNSAALIESVLSGTRSPEL-RAQISN  593
            +PL ++E   +     R+G +  ++    S+D R+N+A L+E + S   +PE  +  +  
Sbjct  155  LPLKDSERRSIAQCRRRLGAVSRIVRRGRSMDARINAAVLVEKIASD--APEAAKLAMGQ  212

Query  592  ADEIFEGIVGILNCPLS--YSRALKIGVKALFALCL--AKQYRHKAVTAGAVEALIDRLQ  425
               + EG+V +L    S    RA K GVKALF+LCL  A     +AV+AGA  AL++ L 
Sbjct  213  IPGLLEGLVDLLRGDHSAVSPRAPKSGVKALFSLCLCSAASNSERAVSAGAAAALVEHLP  272

Query  424  DFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIIL-KISHRATEYAAGALLSI  248
                 DA+R L  +ELLCR  +G    A HAL VP LV  I  + S +A E AAG LL++
Sbjct  273  AAQHGDADRTLGALELLCRTRAGREVVAQHALAVPALVAAIQCRSSFQAAECAAGTLLAV  332

Query  247  CsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
            CS SE+ Q  AA AGV+TQLLLL+QSDCT+RAKRKA  LLKLLR  W ED
Sbjct  333  CSGSEEVQLAAAEAGVLTQLLLLIQSDCTDRAKRKAVELLKLLRRWWAED  382



>ref|XP_002453962.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
 gb|EES06938.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
Length=407

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  601  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  422
            +  A+ + +G+V ++    + +RA+++G++ALFALCLAK+ R +AV AGA  AL  R+ +
Sbjct  227  LGAAEGVMDGLVALVE-EKANARAVRVGIRALFALCLAKENRPRAVAAGAASALARRVAE  285

Query  421  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSIC  245
                + ERALA VE LCR   G  A  A A      V  +++ +S RA E+AAGAL+++ 
Sbjct  286  GGAGEPERALAAVERLCRAEGGRDAVVAGAGGGSAAVTALVRAMSGRAAEHAAGALVAVV  345

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTGISDDYNC  68
              SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+  
Sbjct  346  GGSEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPNTDCIANSDDFLQ  405

Query  67   SY  62
             Y
Sbjct  406  HY  407



>ref|XP_002991371.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
 gb|EFJ07483.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
Length=417

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/226 (32%), Positives = 124/226 (55%), Gaps = 8/226 (4%)
 Frame = -1

Query  727  DPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCP  548
            +P  +  L  +L   + + ++N+A L+E V +   S   ++ +   + +  G+V ++   
Sbjct  200  NPSLLAVLSWILHRRNTEGQINAARLLELVATDDES---KSMVGATERLIPGLVKLVKED  256

Query  547  LSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCR  368
             +Y RA++  + AL A+   ++   KAV  G V  LI+ L +  + + ERALA +E + R
Sbjct  257  SAYPRAVRASLTALLAIVSCRKNLVKAVQGGVVPPLIELLSEASRLNTERALAVLEFVAR  316

Query  367  IPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQL  188
               G  A   H+L+VP+LVKIIL +S  A+E A G LL +C A +   + AA+ G  TQ+
Sbjct  317  CAEGREALMDHSLSVPMLVKIILTVSDLASERAVGILLLMCQADDSVVQAAASEGAFTQM  376

Query  187  LLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
            +LL+Q+D T     +A+  LKLLR   P +       ++ ++ +PF
Sbjct  377  ILLIQADNTSETNHRARQFLKLLRGAVPRECM-----HDFAFTMPF  417



>ref|XP_001776109.1| predicted protein [Physcomitrella patens]
 gb|EDQ59020.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 126/227 (56%), Gaps = 12/227 (5%)
 Frame = -1

Query  733  FSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILN  554
             S+P  + +L  +L++ S++ ++N+A +I ++     +P ++A + +       IV +L 
Sbjct  176  LSEPKMLSHLGFVLASGSLEGKVNAADIIHALCK--ENPRVKAAVGDLPGAIRAIVNLLR  233

Query  553  CPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELL  374
              L Y RA++ G++ L ++CL+++ R  A+    +  L+  L + DK + ER  A +E+L
Sbjct  234  EDL-YPRAVQSGLRCLQSMCLSRRNRVTAINCRTITTLVALLPNTDKRNKERVFALLEIL  292

Query  373  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--reaaaAGV  200
                 G  A + HAL +P++VK +L +SHRATEYA  AL  + S +        A  AG 
Sbjct  293  ANCAEGREAISNHALAIPVMVKSMLGVSHRATEYAVAALWLVLSYASNRNVINTALQAGA  352

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYV  59
             T LL+L+ S C++ AK++AQ  +KLL +        + D Y C +V
Sbjct  353  FTNLLMLLSSQCSQLAKKRAQDSVKLLNEV-------VLDTYTCRHV  392



>ref|XP_002988236.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
 gb|EFJ10655.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
Length=392

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 116/208 (56%), Gaps = 3/208 (1%)
 Frame = -1

Query  727  DPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCP  548
            +P  +  L  +L   + + ++N+A L+E V +   S   ++ +   + +  G+V ++   
Sbjct  188  NPSLLAVLSWILHRRNTEGQINAARLLELVATDDES---KSMMGATERLIPGLVKLVKED  244

Query  547  LSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCR  368
             +Y RA++  + AL A+   ++   KAV  G V  LI+ L +  + + ERALA +E + R
Sbjct  245  SAYPRAVRASLTALLAIVSCRKNLVKAVQGGVVPPLIELLSEASRLNTERALAVLEFVAR  304

Query  367  IPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQL  188
               G  A   H+L+VP+LVKIIL +S  A+E A G LL +C A +   + AA+ G  TQ+
Sbjct  305  CAEGREALMDHSLSVPMLVKIILTVSDLASERAVGILLLMCQADDSVVQAAASEGAFTQM  364

Query  187  LLLVQSDCTERAKRKAQMLLKLLRDCWP  104
            +LL+Q+D T     +A+  LKLLR   P
Sbjct  365  ILLIQADNTSETNHRARQFLKLLRGAVP  392



>ref|NP_001148065.1| ubiquitin-protein ligase [Zea mays]
 gb|ACG29626.1| ubiquitin-protein ligase [Zea mays]
Length=416

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 131/242 (54%), Gaps = 8/242 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPS-VDVRMNSAALIESVLSGTRSPELRAQISNA  590
            V L EAE+  V     RV  L  +L     ++ R+N+ A++E+V S +   E RA +  A
Sbjct  174  VGLGEAEAAEVVGREERVARLGKVLGGGGPLEARVNAGAVVEAVASAS-GAEARAALGGA  232

Query  589  DEIFEGIVGILNC-PLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
            + + +G+V +      + +RA+++GV+ALFALCLAK+ R +AV AGA  AL  R+ +   
Sbjct  233  EGVMDGLVALAEEEKANNARAVRVGVRALFALCLAKENRARAVAAGAAAALARRVAEGGA  292

Query  412  CDAERALATVELLCRIPSG----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  245
             + ERALA VE LCR   G     A        V  LV+ +          A  A++   
Sbjct  293  GEPERALAAVERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRGAEHAAGALAAVVVGA  352

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTGISDDYNC  68
              SE  Q EA  AG M +LLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+  
Sbjct  353  GGSEALQAEAVRAGAMGRLLLMVQGGCSERAKRKAQHLLKLLRSAWPSADCVANSDDFLQ  412

Query  67   SY  62
             Y
Sbjct  413  HY  414



>gb|AFW71736.1| ubiquitin-protein ligase [Zea mays]
Length=418

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 131/242 (54%), Gaps = 8/242 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPS-VDVRMNSAALIESVLSGTRSPELRAQISNA  590
            V L EAE+  V     RV  L  +L     ++ R+N+ A++E+V S +   E RA +  A
Sbjct  176  VGLGEAEAAEVVGREERVARLGKVLGGGGPLEARVNAGAVVEAVASAS-GAEARAALGGA  234

Query  589  DEIFEGIVGILNC-PLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
            + + +G+V +      + +RA+++GV+ALFALCLAK+ R +AV AGA  AL  R+ +   
Sbjct  235  EGVMDGLVALAEEEKANNARAVRVGVRALFALCLAKENRARAVAAGAAAALARRVAEGGA  294

Query  412  CDAERALATVELLCRIPSG----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  245
             + ERALA VE LCR   G     A        V  LV+ +          A  A++   
Sbjct  295  GEPERALAAVERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRGAEHAAGALAAVVVGA  354

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTGISDDYNC  68
              SE  Q EA  AG M +LLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+  
Sbjct  355  GGSEALQAEAVRAGAMGRLLLMVQGGCSERAKRKAQHLLKLLRSAWPSADCVANSDDFLQ  414

Query  67   SY  62
             Y
Sbjct  415  HY  416



>ref|NP_001047085.2| Os02g0548700 [Oryza sativa Japonica Group]
 dbj|BAF08999.2| Os02g0548700 [Oryza sativa Japonica Group]
Length=417

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -1

Query  610  RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  431
            RA +  A+ + EG+V ++    +++RA+++G++ LFALCLAK+ R +AV AGA  AL  R
Sbjct  232  RAVLGAAEGVMEGLVALVE-EKAHARAVRVGIRGLFALCLAKENRPRAVAAGAAAALARR  290

Query  430  LQDFDKCDA--ERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGA  260
            + +        ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAGA
Sbjct  291  VAEGGGGAGEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAGA  350

Query  259  LLSICsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGIS  83
            L+++   SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    S
Sbjct  351  LVAVVGGSEPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIANS  410

Query  82   DDYNCSY  62
            DD+   Y
Sbjct  411  DDFLQPY  417



>dbj|BAD16187.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
 dbj|BAD16270.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
Length=423

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = -1

Query  610  RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  431
            RA +  A+ + EG+V ++    +++RA+++G++ LFALCLAK+ R +AV AGA  AL  R
Sbjct  238  RAVLGAAEGVMEGLVALVE-EKAHARAVRVGIRGLFALCLAKENRPRAVAAGAAAALARR  296

Query  430  LQDFDKCDA--ERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGA  260
            + +        ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAGA
Sbjct  297  VAEGGGGAGEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAGA  356

Query  259  LLSICsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGIS  83
            L+++   SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    S
Sbjct  357  LVAVVGGSEPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIANS  416

Query  82   DDYNCSY  62
            DD+   Y
Sbjct  417  DDFLQPY  423



>ref|XP_001751378.1| predicted protein [Physcomitrella patens]
 gb|EDQ83695.1| predicted protein [Physcomitrella patens]
Length=146

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -1

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
            AE+ALA +ELL  I  G AA   +AL VP+LV++ILK+S R TEYAAG L  +CS S   
Sbjct  30   AEKALAILELLGTIEEGKAAIIDYALAVPVLVELILKVSDRGTEYAAGTLRMMCSDSIAM  89

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
            +  A A G  T+LLL +QSDCT RAKRKA  LLK+L   W +
Sbjct  90   REAAVAHGAPTKLLLHIQSDCTARAKRKASQLLKVLHKIWTQ  131



>ref|XP_004501176.1| PREDICTED: uncharacterized protein LOC101503409 [Cicer arietinum]
Length=308

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 77/141 (55%), Gaps = 0/141 (0%)
 Frame = -1

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  356
            R  K   K LFALCL++  R  AV AGAV A+++   + D   AERALA +EL+C +P G
Sbjct  158  REAKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELDGAPAERALAALELMCTVPEG  217

Query  355  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLV  176
                 AHAL VP++V ++ K   R  EYA G L  I       Q  A    V   + L +
Sbjct  218  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDVGEQLTAPPEEVARAVELAL  277

Query  175  QSDCTERAKRKAQMLLKLLRD  113
            Q +C+ R KRK   LLK+L+ 
Sbjct  278  QGECSARGKRKGAQLLKMLQH  298



>ref|XP_003636449.1| U-box domain-containing protein [Medicago truncatula]
Length=288

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 76/140 (54%), Gaps = 0/140 (0%)
 Frame = -1

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  356
            R  K   K LFALCL++  R  AV AGAV A+++   + +   AERALA +EL+C +P G
Sbjct  138  RESKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELEGAPAERALAALELMCTVPEG  197

Query  355  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLV  176
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  198  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  257

Query  175  QSDCTERAKRKAQMLLKLLR  116
            Q DC+ R KRK   LLK L+
Sbjct  258  QGDCSARGKRKGAQLLKTLQ  277



>gb|KEH36040.1| hypothetical protein MTR_3g110138 [Medicago truncatula]
Length=302

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 76/141 (54%), Gaps = 0/141 (0%)
 Frame = -1

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  356
            R  K   K LFALCL++  R  AV AGAV A+++   + +   AERALA +EL+C +P G
Sbjct  152  RESKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELEGAPAERALAALELMCTVPEG  211

Query  355  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLV  176
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  212  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  271

Query  175  QSDCTERAKRKAQMLLKLLRD  113
            Q DC+ R KRK   LLK L+ 
Sbjct  272  QGDCSARGKRKGAQLLKTLQH  292



>ref|XP_003523734.1| PREDICTED: U-box domain-containing protein 25-like [Glycine max]
Length=287

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 78/139 (56%), Gaps = 1/139 (1%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K LFALCL+   R  AV AGAV A+++   D D   AERALA +EL+C +P G   
Sbjct  132  KPATKILFALCLSDANRRVAVEAGAVSAVVEAAPDLDGAPAERALAALELMCTLPEGAEE  191

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSI-CsaseqaqreaaaAGVMTQLLLLVQS  170
              AHAL VP++V ++ K + R  EYA GAL  +  +A  +    A    V   + L +Q 
Sbjct  192  LRAHALAVPVMVTMMAKTAARGKEYAIGALAVVYGAAGAENHYTAPPEEVARAVELALQG  251

Query  169  DCTERAKRKAQMLLKLLRD  113
            +C+ R +RK   LLK L+ 
Sbjct  252  ECSARGRRKGTQLLKTLQQ  270



>ref|XP_006476069.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
Length=328

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 89/172 (52%), Gaps = 6/172 (3%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            E+  G+VG L        A KI    L ALCLA+  R  AV AGAV A+I+ + + D   
Sbjct  159  ELMRGVVGNLKNKAGAKPATKI----LLALCLAESNRRVAVEAGAVGAVIEVVAELDGAA  214

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
             ERALA +EL+C +  G     AHAL VP++V ++ +++ R  EYA   L  I    +Q 
Sbjct  215  GERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQL  274

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  71
               A    V   + L +Q +CT R +RK   LLK L++    D T   D+ N
Sbjct  275  VVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTT--QDEMN  324



>ref|XP_002885649.1| hypothetical protein ARALYDRAFT_899024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61908.1| hypothetical protein ARALYDRAFT_899024 [Arabidopsis lyrata subsp. 
lyrata]
Length=96

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  694  LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  515
            L + S+++++N AALIE VL+G++  +L+  IS +D IFEG++ +L   +S  RAL+IG+
Sbjct  5    LFDSSIEIKVNGAALIEMVLTGSKLMDLKLIISGSDSIFEGVLDLLKILISSRRALQIGI  64

Query  514  KALFALCLAKQYRHKAVTAGAVEALIDR  431
            KA+FALCL KQ +H A++ GA   LID 
Sbjct  65   KAIFALCLVKQKKHLAISTGAPGILIDH  92



>ref|XP_002976345.1| hypothetical protein SELMODRAFT_416243 [Selaginella moellendorffii]
 gb|EFJ22605.1| hypothetical protein SELMODRAFT_416243 [Selaginella moellendorffii]
Length=465

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 104/178 (58%), Gaps = 10/178 (6%)
 Frame = -1

Query  628  TRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAV  449
            ++S E +    +A    E +VG+L+      + +K GVKAL ALCL+K  R  AV AG V
Sbjct  264  SQSEEQQVDTLDAGSFLEAVVGLLS--EREEQLVKCGVKALLALCLSKDNRVAAVKAGVV  321

Query  448  EALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYA  269
             +L++ L +     +ER LAT+ELL     G AA   HAL +PLL+ +IL++S R TEYA
Sbjct  322  ASLLELLTEAKGVTSERILATLELLSTTLEGRAAILRHALAIPLLLSMILRVSDRGTEYA  381

Query  268  AGALLS-ICsaseqaqreaaaAGVM-------TQLLLLVQSDCTERAKRKAQMLLKLL  119
            AG L S IC+ +         A  M       T LLLL+QS CT+RA+RKA  LLK+L
Sbjct  382  AGVLCSVICTDTSTPLDSNEEALEMAFQARASTSLLLLLQSHCTQRARRKAVKLLKVL  439



>ref|XP_002987240.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
 gb|EFJ11816.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
Length=434

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 110/223 (49%), Gaps = 9/223 (4%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P  +  +  LL    +  R+++AALIE +    +  E R  +     IFEG+V ++    
Sbjct  191  PRNLAAIARLLQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVGEDH  248

Query  544  SYSR---ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELL  374
            S  R   A++  ++A+ A+C   + R + V  G V  L + L + DK   E  LA +E L
Sbjct  249  SQRRHRPAIRGSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAALECL  308

Query  373  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaqreaaaAGV  200
            C    G AA A HAL VP + + + K+S  ATEYA   L ++C     E  +R     G+
Sbjct  309  CGCAEGRAAVARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVEVGL  368

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE--DFTGISDD  77
              +L   +Q  C  R K KA  LLKLL   + E  D +G ++D
Sbjct  369  FPKLFFFLQIGCNPRTKHKAGDLLKLLHRAYRECIDGSGSNND  411



>ref|XP_002976407.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
 gb|EFJ22667.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
Length=434

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 110/223 (49%), Gaps = 9/223 (4%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P  +  +  LL    +  R+++AALIE +    +  E R  +     IFEG+V ++    
Sbjct  191  PRNLAAIARLLQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVGEDH  248

Query  544  SYSR---ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELL  374
            S  R   A++  ++A+ A+C   + R + V  G V  L + L + DK   E  LA +E L
Sbjct  249  SQRRHRPAIRGSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAALECL  308

Query  373  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaqreaaaAGV  200
            C    G AA A HAL VP + + + K+S  ATEYA   L ++C     E  +R     G+
Sbjct  309  CGCAEGRAAVARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVEVGL  368

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE--DFTGISDD  77
              +L   +Q  C  R K KA  LLKLL   + E  D +G ++D
Sbjct  369  FPKLFFFLQIGCNPRTKHKAGDLLKLLHRAYRECIDGSGSNND  411



>gb|EYU29273.1| hypothetical protein MIMGU_mgv1a021565mg [Erythranthe guttata]
Length=345

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 1/153 (1%)
 Frame = -1

Query  571  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            + G++ C L    A K   K L ALCL +  R  AV AGAV A+++ L D +   AER+L
Sbjct  183  VGGVVAC-LREGVARKAASKVLLALCLVEMNRRAAVEAGAVTAVVEALTDAEIAVAERSL  241

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  212
            A +ELLC    G A   AHAL VP++V+++ ++  R  E+A   L  I    E+    A 
Sbjct  242  AALELLCTTAEGTAEVRAHALAVPMMVQVMGRMEGRGKEHAISVLAVIYGGLEEGVAVAP  301

Query  211  aAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
            A  V   ++L +Q DC+ R +RK   LLK+L+ 
Sbjct  302  AEQVARAVMLALQGDCSARGRRKGAHLLKILQQ  334



>ref|XP_007137194.1| hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris]
 gb|ESW09188.1| hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris]
Length=315

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 0/138 (0%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K LFALCL+   R  AV  GAV A+++   + D   AERALA +EL+C +P G   
Sbjct  166  KPATKILFALCLSDVNRRVAVETGAVSAVVEAALELDGAPAERALAALELMCTLPDGAHE  225

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQSD  167
              AHAL VP++V ++ K + RA EYA G L  +   S   Q  A    V   + L +Q +
Sbjct  226  VRAHALAVPVMVTMMGKTAARAKEYAIGVLAVVYGGSASDQHTAPPEEVARAVELALQGE  285

Query  166  CTERAKRKAQMLLKLLRD  113
            C+ RA+RK   L+K L+ 
Sbjct  286  CSARARRKGAQLMKTLKQ  303



>ref|XP_001764309.1| predicted protein [Physcomitrella patens]
 gb|EDQ70863.1| predicted protein [Physcomitrella patens]
Length=440

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 112/211 (53%), Gaps = 11/211 (5%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILN---  554
            P  +  LV LL++ S+D ++N+A +I ++      P ++  +++     +G+V +L    
Sbjct  207  PESLECLVFLLTSGSLDAKLNAADVIHTLCE--EDPHVKTAVASLPGAMKGLVNLLKDDL  264

Query  553  CPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELL  374
            CP    RA++ G++ L  +CL +  R  A+   A+  +++ L + +K   E A A +E+L
Sbjct  265  CP----RAVQAGLRCLLCVCLPRSNRVMAIECRAISVVVELLPNTEKRTKELAFAVMEIL  320

Query  373  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa--aAGV  200
                 G  A + HAL +P++VK +L +S R TE A   L  + S +           AG 
Sbjct  321  ANCAEGREAISNHALAIPMIVKSMLGVSQRVTECAVSTLWVVLSYASNRSVTNTALQAGA  380

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  107
               LL+L+  +C++RAK KA+  L+LL + W
Sbjct  381  FANLLMLLPGECSQRAKHKARDSLRLLNENW  411



>ref|XP_006826592.1| PREDICTED: U-box domain-containing protein 21 [Amborella trichopoda]
 gb|ERM93829.1| hypothetical protein AMTR_s00138p00053700 [Amborella trichopoda]
Length=428

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 115/222 (52%), Gaps = 15/222 (7%)
 Frame = -1

Query  706  LVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRAL  527
            L+  L   ++++R NSA LI+ + S     EL       D +FE ++ I+  P+  S +L
Sbjct  211  LIEGLRQGNLELRKNSALLIKEIASNG---ELTIDFRKIDGLFESLLQIIRDPICSS-SL  266

Query  526  KIGVKALFALCLA-KQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCA  350
            K  +  +F +C + ++ R KAV  G + A++D L D D+   E+A+A ++ LC+   G A
Sbjct  267  KASLITVFYVCSSDEEIRAKAVKLGFISAILDILPDSDRSVCEKAMAAIDALCKSKEGRA  326

Query  349  AFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase---qaqreaaaAGVMTQLLLL  179
              + HAL VPL+VK I ++S   TE +   L  +C   E   ++  EA   G   +LLLL
Sbjct  327  KASEHALMVPLVVKKIFRVSDLVTELSVTVLWRLCKDEECKLKSVSEALQVGAFQKLLLL  386

Query  178  VQSDCTERAKRKAQMLLKL---LRDCW----PEDFTGISDDY  74
            +Q  C  + K K   LLK+    R+ W      DF G+   +
Sbjct  387  LQVGCEGKIKEKVTDLLKVTNSYRERWECVDSGDFKGLKRPF  428



>ref|XP_002308611.2| hypothetical protein POPTR_0006s25710g [Populus trichocarpa]
 gb|EEE92134.2| hypothetical protein POPTR_0006s25710g [Populus trichocarpa]
Length=352

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 9/165 (5%)
 Frame = -1

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
            + E+  G+V  L         +K   K L ALCLA+  RH AV AGAV  +++   + D 
Sbjct  178  SPELMRGVVANLK----NKAGVKPATKVLLALCLAEANRHVAVEAGAVGTVVEVAMELDG  233

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI-----  248
              AERALA +EL C +  G A    HAL VP++V ++ K++ R  EYA  AL  I     
Sbjct  234  SPAERALAALELTCTVAEGAAELRNHALAVPVMVTMMGKMAGRGKEYAISALAVIYGSGG  293

Query  247  CsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
              +  +    A    V   +   +Q DCT R +RK   LLK L++
Sbjct  294  VGSDGEQTLHAPPEEVARAVAFALQGDCTARGRRKGAQLLKALQE  338



>ref|XP_008466051.1| PREDICTED: U-box domain-containing protein 26 [Cucumis melo]
Length=326

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 91/169 (54%), Gaps = 8/169 (5%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            E+  G++   N       A KI    L ALCLA+  RH AV AGAV A+I+ L + +   
Sbjct  159  ELMRGLIESFNIKTGSKPATKI----LLALCLAEGNRHVAVEAGAVGAVIESLPEMEDAA  214

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
            AERALA++EL+C +  G A   AHAL+VP +V ++ +++ R  E A   L  I      +
Sbjct  215  AERALASLELMCTVAEGAAEVRAHALSVPAMVTMMGRMAARGKESAISVLGVIYDNGVSS  274

Query  226  qreaaaAG----VMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  92
            + ++A       V   ++L +Q D + R +RK   LLK L++   E FT
Sbjct  275  EAKSAVTAPPEEVARAVVLALQGDSSVRGRRKGARLLKTLQEQQDEFFT  323



>ref|XP_011019811.1| PREDICTED: uncharacterized protein LOC105122418 [Populus euphratica]
Length=530

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 83/163 (51%), Gaps = 9/163 (6%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            E+  G+V  L         LK   K L ALCLA+  RH AV AGAV  +++   + D   
Sbjct  358  ELMRGVVANLK----NKAGLKPATKVLLALCLAEANRHVAVEAGAVGTVVEVAMELDGAP  413

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI-----Cs  242
            AERALA +EL C +  G A    HAL VP++V ++ K++ R  EYA  AL  I       
Sbjct  414  AERALAALELTCTVAEGAAELRNHALAVPVMVTMMGKMAGRGKEYAISALAVIYGGGGVE  473

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
            +  +    A    V   + L ++ DCT R +RK   LLK L++
Sbjct  474  SDGEQTLHAPPEEVARAVALALRGDCTARGRRKGAQLLKALQE  516



>ref|XP_004136217.1| PREDICTED: U-box domain-containing protein 26 [Cucumis sativus]
 gb|KGN60328.1| hypothetical protein Csa_3G895740 [Cucumis sativus]
Length=324

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 92/169 (54%), Gaps = 8/169 (5%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            E+  G++   N       A KI    L ALCLA+  RH AV AGAV A+I+ L + +   
Sbjct  156  ELMRGLIESFNIKTGSKPATKI----LLALCLAEGNRHVAVEAGAVGAVIESLPEMEDAA  211

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
            AERALA++EL+C +  G A   +HAL+VP +V ++ +++ R  E A   L  I  +   +
Sbjct  212  AERALASLELMCTVAEGAAEVRSHALSVPAMVTMMGRMAARGKESAISVLGVIFDSGVSS  271

Query  226  qreaaaAG----VMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  92
            + ++        V   ++L +Q D + R +RK   LLK L++   ++F+
Sbjct  272  EAKSGVTAPPEEVARAVVLALQGDSSVRGRRKGARLLKTLQEQQADEFS  320



>ref|XP_003527831.1| PREDICTED: uncharacterized protein LOC100814020 [Glycine max]
Length=307

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 75/140 (54%), Gaps = 2/140 (1%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K LFALCL+   R  AV  GAV A+++   D D   AERALA +EL+C +P G   
Sbjct  151  KPATKILFALCLSDANRRVAVETGAVSAVVEAAPDLDGAPAERALAALELMCTLPEGAEE  210

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa--AGVMTQLLLLVQ  173
              AHAL VP++V ++ K + R  EYA G L  +  +    +    A    V   + L +Q
Sbjct  211  LRAHALAVPVMVTMMAKTAARGKEYAIGVLAVVYGSVGGGEEHHTAPPEEVARAVELALQ  270

Query  172  SDCTERAKRKAQMLLKLLRD  113
             +C+ R +RK   LLK L+ 
Sbjct  271  GECSARGRRKGAQLLKTLQQ  290



>ref|XP_002962287.1| hypothetical protein SELMODRAFT_403954 [Selaginella moellendorffii]
 gb|EFJ37547.1| hypothetical protein SELMODRAFT_403954 [Selaginella moellendorffii]
Length=630

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 99/215 (46%), Gaps = 47/215 (22%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I    V +L  P + ++ +++ +K++  +CL+K  R  AV AGAVEAL+D L D    D 
Sbjct  410  ILGACVALLKDPSAEAKLVRLALKSMLGICLSKPNRIPAVKAGAVEALLDTLVDLHGVDG  469

Query  403  -------------ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAG  263
                         ERALAT+ELLC    G AA  +    +  LV ++L +S RATEYAAG
Sbjct  470  GEFCSKSGIVVNVERALATLELLCTSSEGRAAICSQPNFISELVGLVLGVSERATEYAAG  529

Query  262  ALLSI---------------------------------CsaseqaqreaaaAGVMTQLLL  182
             L ++                                        Q  A   G   Q+LL
Sbjct  530  VLCAVLCDNLGSEDGTTAAAASFAAGAARITSSATFNGLGEHSSVQEMAVKGGAPAQMLL  589

Query  181  LVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDD  77
            ++QSDC++RA+RKA  LLK L   + E+   I  D
Sbjct  590  VMQSDCSDRARRKAAKLLKALHK-YGENHNTIHSD  623



>ref|XP_012077427.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11 [Jatropha curcas]
 gb|KDP34197.1| hypothetical protein JCGZ_07768 [Jatropha curcas]
Length=350

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 88/173 (51%), Gaps = 14/173 (8%)
 Frame = -1

Query  553  CPLSYSRAL------KIGVKA----LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            CPL   R +      K G KA    L ALCLA+  RH AV AG V  +++   + +   A
Sbjct  177  CPLELMRGVVVNLKNKAGAKAATKILLALCLAEGNRHVAVKAGTVGTVVEVTMELEGPVA  236

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase--q  230
            ERALA +EL+C +  G A   AHAL +P++V  + ++  R  EYA  AL  +       +
Sbjct  237  ERALAALELMCTVEEGAAELRAHALAMPVMVAKMGEMEGRGKEYAISALSVVYGGGVLDE  296

Query  229  aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  71
               +A    V   ++L +Q DCT RA+RK   LLK L++    D T    D N
Sbjct  297  QVHQAPPEEVARAVILALQGDCTARARRKGAQLLKALQEFGRADST--QQDVN  347



>ref|XP_010668167.1| PREDICTED: U-box domain-containing protein 26 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 82/156 (53%), Gaps = 4/156 (3%)
 Frame = -1

Query  547  LSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCR  368
            ++ + + K   K L ALCLA+  R  AV  GA   ++D L D D    ERALA +EL+C 
Sbjct  209  MTRTSSAKSATKILLALCLAEGNRRVAVECGAPTRVVDALPDLDGAVVERALAALELMCT  268

Query  367  IPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAG----V  200
            +P G A   AHAL VP+LV  + ++  R  EYA   L ++    E+  +   AA      
Sbjct  269  VPEGAAEVRAHALAVPMLVATMGRMEGRGREYAISVLTAVYGGGEEDHQVWEAAPPEEVA  328

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  92
               +L + Q +C+ R KRK   LLK+L++    D T
Sbjct  329  RAVVLAMQQGNCSARGKRKGAQLLKVLQENGRVDLT  364



>ref|XP_010028074.1| PREDICTED: U-box domain-containing protein 30 [Eucalyptus grandis]
 gb|KCW54733.1| hypothetical protein EUGRSUZ_I00687 [Eucalyptus grandis]
Length=447

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 114/212 (54%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  S++ ++N   LIE+++      + R++I ++  +  
Sbjct  219  DSESRTNLMQPAKISLVVDMLNEGSMETKINCTRLIETLM---EEKDFRSEIVSSHSLLV  275

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     Y+     G++ L  +CL KQ R   V+ GAV  L+D L + D    E A
Sbjct  276  GLMRLVK-EKRYANGTLPGLRLLRTICLHKQVRSLFVSVGAVPQLVDLLPNLDSECLELA  334

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  +E L  +P G  A      T+P +V++++++S   T+YA   L ++CS + Q     
Sbjct  335  LFILETLSSLPEGQLALKDCQSTIPSMVRLLMRVSEMCTQYALSILWAVCSLAPQECSSV  394

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  395  AVDAGLAAKLLLVIQSGCDPVLKQRSSELLKL  426



>ref|XP_003517356.1| PREDICTED: U-box domain-containing protein 30-like [Glycine max]
Length=449

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 114/212 (54%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P +V  +V +L+  S++ ++N   LIES++      + R+++ ++  +  
Sbjct  221  DSESRKNLLQPAKVSLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEVISSHSLLV  277

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +S  +  G+  L  +CL K+ R+  V+ GAV  L++ L   +    E A
Sbjct  278  GLMRLVK-DKRHSNGVCPGLSLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCTELA  336

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    + T+P++VK++++IS   T+YA   L S+C  S       
Sbjct  337  LCVLDALASVPEGRVALKDCSNTIPIMVKLLMRISENCTQYALSILWSVCKLSPDECSSI  396

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  397  AVDAGLAAKLLLVIQSGCNPILKQQSAELLKL  428



>ref|XP_002987189.1| hypothetical protein SELMODRAFT_46743, partial [Selaginella moellendorffii]
 gb|EFJ11765.1| hypothetical protein SELMODRAFT_46743, partial [Selaginella moellendorffii]
Length=144

 Score = 82.0 bits (201),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 85/140 (61%), Gaps = 8/140 (6%)
 Frame = -1

Query  514  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  335
            KAL ALCL+K  R  AV AG V +L++ L +     +ER LAT+ELL     G AA   H
Sbjct  1    KALLALCLSKDNRVAAVKAGVVASLLELLTEAKGVTSERMLATLELLSTTLEGRAAILRH  60

Query  334  ALTVPLLVKIILKISHRATEYAAGALLS-ICsaseqaqreaaaAGVM-------TQLLLL  179
            AL +PLL+ +IL++S R TEYAAG L S IC+ +         A  M       T LLLL
Sbjct  61   ALAIPLLLSMILRVSDRGTEYAAGVLCSVICTETSTPLDSNEEALEMAFQARASTSLLLL  120

Query  178  VQSDCTERAKRKAQMLLKLL  119
            +QS CT+RA+RKA  LLK+L
Sbjct  121  LQSHCTQRARRKAVKLLKVL  140



>ref|XP_002281453.1| PREDICTED: U-box domain-containing protein 25 [Vitis vinifera]
Length=344

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 84/158 (53%), Gaps = 8/158 (5%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRA-LKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            +  G+VG L       RA  +   K L ALCLA+  RH AV AGAV  +++ + + +   
Sbjct  184  VMRGVVGCLK-----DRAGARPATKVLLALCLAEGNRHVAVEAGAVAEVVEAMSEMEGAV  238

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
            AERALA +EL+C +  G A   AHAL+VP+++ ++  ++ R  E A   L  I   +   
Sbjct  239  AERALAALELMCTVAEGAAELRAHALSVPMMISMMESMAGRGKECAISILAVIYIGAGDQ  298

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
               +    V   + L +Q DC+ R KRK   LL+ L++
Sbjct  299  APPSEE--VARAVALALQGDCSARGKRKGAQLLRALQE  334



>ref|XP_011090755.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Sesamum indicum]
Length=328

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 77/140 (55%), Gaps = 0/140 (0%)
 Frame = -1

Query  532  ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGC  353
            A K   K L ALCL +  R  AV AGAV A+++ L D +     R LA +ELLC    G 
Sbjct  178  ARKPASKVLLALCLVEGNRRVAVEAGAVTAVVEALTDAESAVLWRLLAALELLCTTAEGA  237

Query  352  AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQ  173
            A   AHAL VP++V+++ ++  R  E+A   L  I    E+    A A  V   ++L +Q
Sbjct  238  AEVRAHALAVPMMVQVMGRMEGRGKEHAISVLAVIYGGLEEGVGVAPAEEVARSVMLALQ  297

Query  172  SDCTERAKRKAQMLLKLLRD  113
             DC+ R +RK   LLK+L++
Sbjct  298  GDCSARGRRKGAQLLKILQE  317



>ref|XP_003522485.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=393

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 119/229 (52%), Gaps = 12/229 (5%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            +PL   E + +  D  ++   + L    +  V+ +   +I+S+ S  ++ E+   + ++ 
Sbjct  167  LPLVSLEPLNMIKDESKLATFLLLFEKGTSSVKTSLCHIIDSIAS-PQTEEVCHMLGHSH  225

Query  586  EIFEGIVGIL--NCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---QD  422
            ++   IV ++  NC +S     K+ +KA+ ALC  +  R   V  GA++ +I  +   + 
Sbjct  226  KLVHEIVVLVRQNCEVS-----KVAIKAMLALCSLQSNRENLVREGAIDGVITYISGCET  280

Query  421  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSIC  245
              K  A  A+A ++ L  + S   A   H   V  LVK++ ++ +   +E A G L  IC
Sbjct  281  RQKNAAPLAMAIIKKLLVLESAKEALVNHPNGVETLVKMVFRVCNQECSESAVGILAIIC  340

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
                +A+ EA  AGV+TQLL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  341  CDFGRAREEAIEAGVLTQLLFLLQSQCGTKTKTKARMLLKLLRSKWIEE  389



>ref|XP_003636401.1| U-box domain-containing protein [Medicago truncatula]
 gb|KEH36028.1| hypothetical protein MTR_3g110088 [Medicago truncatula]
Length=289

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 70/141 (50%), Gaps = 13/141 (9%)
 Frame = -1

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  356
            R  K   K LFALCL++  R  AV AGAV              AERALA +EL+C +P G
Sbjct  152  RESKPATKILFALCLSEANRRVAVEAGAV-------------GAERALAALELMCTVPEG  198

Query  355  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLV  176
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  199  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  258

Query  175  QSDCTERAKRKAQMLLKLLRD  113
            Q DC+ R KRK   LLK L+ 
Sbjct  259  QGDCSARGKRKGAQLLKTLQH  279



>gb|KHN31155.1| U-box domain-containing protein 26 [Glycine soja]
Length=217

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 114/219 (52%), Gaps = 12/219 (5%)
 Frame = -1

Query  736  VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGIL  557
            +  D  ++   + L    +  V+ +   +I+S+ S  ++ E+   + ++ ++   IV ++
Sbjct  1    MIKDESKLATFLLLFEKGTSSVKTSLCHIIDSIAS-PQTEEVCHMLGHSHKLVHEIVVLV  59

Query  556  --NCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---QDFDKCDAERAL  392
              NC +S     K+ +KA+ ALC  +  R   V  GA++ +I  +   +   K  A  A+
Sbjct  60   RQNCEVS-----KVAIKAMLALCSLQSNRENLVREGAIDGVITYISGCETRQKNAAPLAM  114

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsaseqaqrea  215
            A ++ L  + S   A   H   V  LVK++ ++ +   +E A G L  IC    +A+ EA
Sbjct  115  AIIKKLLVLESAKEALVNHPNGVETLVKMVFRVCNQECSESAVGILAIICCDFGRAREEA  174

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
              AGV+TQLL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  175  IEAGVLTQLLFLLQSQCGTKTKTKARMLLKLLRSKWIEE  213



>gb|KJB48752.1| hypothetical protein B456_008G084500 [Gossypium raimondii]
Length=471

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 112/212 (53%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  SV+ ++N   LIE ++      E RA+  ++  +  
Sbjct  243  DSESKTNLMQPTKISLMVDMLNEGSVETKINCTRLIEKLM---EEKEFRAESISSHRLLV  299

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     ++  +  G+  L ++CL KQ     V+ GAV  L++ L   +    E A
Sbjct  300  GLMRLVK-DKRHTNGILPGLSLLRSICLHKQVMGLIVSIGAVSQLVELLPALEPDCLELA  358

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  +++L  +P G AA      T+P +V+++++IS   T+YA   L S+C  + +     
Sbjct  359  LFILDILSSLPEGKAALKDCGNTIPNMVRLLMRISESCTQYALSILWSVCKLAPEECSSV  418

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+K+  LLKL
Sbjct  419  AVEAGLAAKLLLVIQSGCNPVLKQKSSELLKL  450



>ref|XP_006450657.1| hypothetical protein CICLE_v10008902mg [Citrus clementina]
 gb|ESR63897.1| hypothetical protein CICLE_v10008902mg [Citrus clementina]
Length=328

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 89/172 (52%), Gaps = 6/172 (3%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            E+  G+VG L        A KI    L ALCLA+  R  AV AGAV A+I+ + + D   
Sbjct  159  ELMRGVVGNLKNKAGAKPATKI----LLALCLAESNRRVAVEAGAVGAVIEVVAELDAAA  214

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  227
             ERALA +EL+C +  G     AHAL VP++V ++ +++ R  EYA   L  I    +Q 
Sbjct  215  GERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQP  274

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  71
               A    V   + L +Q +CT R +RK   LLK L++    D T   D+ N
Sbjct  275  VLAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTT--QDEMN  324



>ref|XP_007137800.1| hypothetical protein PHAVU_009G156600g [Phaseolus vulgaris]
 gb|ESW09794.1| hypothetical protein PHAVU_009G156600g [Phaseolus vulgaris]
Length=392

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 116/227 (51%), Gaps = 8/227 (4%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            +PL   E++ +  D  ++   + L    +  V+ +   LI+S  S  ++ E+   + ++ 
Sbjct  166  LPLVSLEALNMIKDESKLATFLLLFEKGTSSVKTSLCHLIDSTAS-PQTEEVCHMLGHSQ  224

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---QDFD  416
             +   IV ++      S   K+ +KA+ +LC  +  R   V AGA++ +I  +   +   
Sbjct  225  NLLREIVVLVR---QGSEVSKVAIKAMLSLCSLQSNRDNLVRAGAIDGVIIYISGCETRQ  281

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsa  239
            K  A  A+A ++ L  + S   A   H   V  LVK++ K+ +   +E A G L  +C  
Sbjct  282  KNLAPFAMAIIKNLLVLESAKEALVNHPYGVATLVKLVFKVCNQECSESAVGILAIVCRD  341

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
              +A+ EA  AGV+TQLL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  342  FGRAREEAIGAGVLTQLLFLLQSQCDPKTKTKARMLLKLLRSKWIEE  388



>ref|XP_004511816.1| PREDICTED: U-box domain-containing protein 30-like [Cicer arietinum]
Length=449

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 112/212 (53%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  S++ ++N   LIES++      + R++I ++  +  
Sbjct  221  DSESKKNLMQPAKISLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEIISSHSLLV  277

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +S  +  G+  L  +C  K+ +   V+ GAV  L++ L   +    E A
Sbjct  278  GLMRLVK-DKRHSNGICPGLSLLRTVCFYKEVKSLLVSIGAVSQLVELLSGMEHECLELA  336

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  IP G  A      T+P++VK++++IS   T+YA   L S+C  + +     
Sbjct  337  LCVLDSLSSIPEGRVALKDCVRTIPIMVKLLMRISENCTQYALSILWSVCKLAPEECSSI  396

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  397  AVDAGLAAKLLLVIQSGCNPILKQQSAELLKL  428



>ref|XP_009403145.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 106/203 (52%), Gaps = 6/203 (3%)
 Frame = -1

Query  706  LVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRAL  527
            +VS+L +  +D R+N+A ++  +LS +  P     ++  D + E +  ++  P+S  RA 
Sbjct  220  IVSVLRSGDLDARVNAALVLRELLS-SLPPRRINGVAGTDGLVEALSKLIQNPIS-PRAT  277

Query  526  KIGVKALFALCLAKQYRHKA-VTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCA  350
            K  + A F L  +      A V  G + +L++ L D DK   E+ALA ++ +     G  
Sbjct  278  KASLVAAFYLVDSSDRAAGALVDTGIIPSLLEILVDSDKGMCEKALAVLDGVLGCSRGRE  337

Query  349  AFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa---qreaaaAGVMTQLLLL  179
                HALTVP+LVK +L++S  ATE+A  AL  +C   ++      EA   G   + LLL
Sbjct  338  MAYGHALTVPVLVKKMLRVSDMATEFAVSALWKLCRNEKRGGGCSMEAVRVGAFQKSLLL  397

Query  178  VQSDCTERAKRKAQMLLKLLRDC  110
            VQ  C+   K KA  LLKLL  C
Sbjct  398  VQVGCSGATKEKANDLLKLLNGC  420



>gb|KHN13011.1| U-box domain-containing protein 30 [Glycine soja]
Length=449

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 114/212 (54%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P +V  +V +L+  S++ ++N   LIES++      + R+++  +  +  
Sbjct  221  DSESRKNLLQPAKVSLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEVILSHSLLV  277

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     ++  +  G+  L  +CL K+ R+  V+ GAV  L++ L   +    E A
Sbjct  278  GLMRLVK-DKRHNNGVCPGLSLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCLELA  336

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    + T+P++VK++++IS   T+YA   L S+C  S +     
Sbjct  337  LCVLDALASVPEGRVALKDCSNTIPIMVKLLMRISENCTQYALSILWSVCKLSPEECSSI  396

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  397  AVDAGLAAKLLLVIQSGCNPILKQQSAELLKL  428



>emb|CDP16178.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 0/138 (0%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K L ALCL +  RH AV AGAV  ++D + D +   AER+LA +ELLC +  G A 
Sbjct  216  KSASKVLLALCLVEGNRHAAVEAGAVGVVVDAMADLEGAVAERSLAALELLCTVAEGAAE  275

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQSD  167
              +HAL VP++V+++ ++  R  EYA   L  I          A    V   ++L +Q D
Sbjct  276  LRSHALAVPMMVEVMGRMEGRGKEYAISVLAVIFGGCTDGAVVAPPEEVARAVMLALQGD  335

Query  166  CTERAKRKAQMLLKLLRD  113
            C+ R +RKA  LLK+L++
Sbjct  336  CSARGRRKAAQLLKILQE  353



>gb|KDP34438.1| hypothetical protein JCGZ_12798 [Jatropha curcas]
Length=395

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 123/227 (54%), Gaps = 9/227 (4%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E ES+    +  ++     LL   S  ++     LIE + S   + EL A I    +I
Sbjct  168  LGELESLNTLKEESKLESFRILLEQGSSMMQEGLCHLIEGISSSLETKELCAIIGENRQI  227

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD--  407
             +G++ ++      S   + G+KA++ALC  +  R   V AG +  L+  + + ++ +  
Sbjct  228  LQGLILLVQ---QTSGVPEAGIKAIYALCSLESNRENLVQAGVINGLLMYISNTERRENV  284

Query  406  ---AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsa  239
               A +A+AT+E+L R+ +   A   +   V  LVK++ ++S H  +E A  +L+ ICS 
Sbjct  285  RNLAPKAMATIEILLRVETAKDAVINNPNGVSSLVKMVFRVSDHEGSESAVRSLMVICSD  344

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
            S QA+ EA   GV+TQLLLL+QS C+ R K  A+MLLKLLR  W E+
Sbjct  345  SLQAREEAICRGVLTQLLLLLQSQCSVRTKTNARMLLKLLRSKWNEE  391



>ref|XP_006340423.1| PREDICTED: U-box domain-containing protein 26-like, partial [Solanum 
tuberosum]
Length=299

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 107/218 (49%), Gaps = 29/218 (13%)
 Frame = -1

Query  727  DPVRVGYLV--SLLSNP--SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGI  560
            D V+  YL+  SL+ NP  +VD   NS A  ++VL G                      +
Sbjct  92   DKVKAMYLLEHSLVPNPVAAVDGGGNSVACPDTVLRG----------------------V  129

Query  559  LNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVE  380
            + C L   R  K   K L ALCL++  RH AV  GAV  ++D L D D   AER+LA +E
Sbjct  130  VGC-LKDRRVAKSASKVLLALCLSENNRHVAVEVGAVGVVVDSLSDLDVAAAERSLAALE  188

Query  379  LLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsas-eqaqreaaaA  206
            LLC +  G      HAL VP++V+++ ++   R  EYA   L  I   + + A   A   
Sbjct  189  LLCTMAEGAEEVRDHALAVPMMVEVMGRMDGSRGKEYAISVLAVIYGGACDGAPLAAPPE  248

Query  205  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  92
             V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  249  EVARAVMLALQGDCSARGRRKGAQLLKILQNHGRPDPT  286



>ref|XP_012076112.1| PREDICTED: U-box domain-containing protein 26-like [Jatropha 
curcas]
Length=400

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/227 (34%), Positives = 123/227 (54%), Gaps = 9/227 (4%)
 Frame = -1

Query  760  LPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  581
            L E ES+    +  ++     LL   S  ++     LIE + S   + EL A I    +I
Sbjct  173  LGELESLNTLKEESKLESFRILLEQGSSMMQEGLCHLIEGISSSLETKELCAIIGENRQI  232

Query  580  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD--  407
             +G++ ++      S   + G+KA++ALC  +  R   V AG +  L+  + + ++ +  
Sbjct  233  LQGLILLVQ---QTSGVPEAGIKAIYALCSLESNRENLVQAGVINGLLMYISNTERRENV  289

Query  406  ---AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsa  239
               A +A+AT+E+L R+ +   A   +   V  LVK++ ++S H  +E A  +L+ ICS 
Sbjct  290  RNLAPKAMATIEILLRVETAKDAVINNPNGVSSLVKMVFRVSDHEGSESAVRSLMVICSD  349

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
            S QA+ EA   GV+TQLLLL+QS C+ R K  A+MLLKLLR  W E+
Sbjct  350  SLQAREEAICRGVLTQLLLLLQSQCSVRTKTNARMLLKLLRSKWNEE  396



>ref|XP_003539260.2| PREDICTED: U-box domain-containing protein 30-like [Glycine max]
Length=514

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 114/212 (54%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P +V  +V +L+  S++ ++N   LIES++      + R+++  +  +  
Sbjct  286  DSESRKNLLQPAKVSLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEVILSHSLLV  342

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     ++  +  G+  L  +CL K+ R+  V+ GAV  L++ L   +    E A
Sbjct  343  GLMRLVK-DKRHNNGVCPGLSLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCLELA  401

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    + T+P++VK++++IS   T+YA   L S+C  S +     
Sbjct  402  LCVLDALASVPEGRVALKDCSNTIPIMVKLLMRISENCTQYALSILWSVCKLSPEECSSI  461

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  462  AVDAGLAAKLLLVIQSGCNPILKQQSAELLKL  493



>ref|XP_002862799.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39057.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  667  MNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLA  488
            +N AALIE VL+G++  +L+  IS +D IFEG++ +L   +S  RAL+IG+KA+FALCL 
Sbjct  144  VNGAALIEMVLTGSKLMDLKLIISGSDSIFEGVLDLLKILISSRRALQIGIKAIFALCLV  203

Query  487  KQYRHKAVTAGAVEALIDR  431
            KQ +H A++ GA   LID 
Sbjct  204  KQKKHLAISTGAPGILIDH  222



>ref|XP_011078792.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=387

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 121/226 (54%), Gaps = 12/226 (5%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            +P  +  ++ +     +    VSL    S+ ++ +   ++E++ S  +  EL  ++  + 
Sbjct  170  MPFSDIRTINILKQESKQAVFVSLFQQGSMSIKKSLCLMVEAISSSVQ--ELCEKLGMSV  227

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD---  416
            ++ +G+V +L          + G++A+  L L ++ R      GAVE LID L   +   
Sbjct  228  QLVQGLVHLLQ------HKSEAGIRAVSGLALMERNRENLAREGAVEGLIDYLSTAEIHK  281

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsa  239
            +  A  A++T+E L  +P+       H   V  +VK++ ++S H+ +E A  +LL ICS 
Sbjct  282  RSLAPMAMSTIENLLSVPTAKDVIINHPSGVKAIVKMVFRVSDHQGSESAVNSLLLICSD  341

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
            S+ A+ +A   GV+TQLLLL+QS C  R K KA+MLLKLLR  W E
Sbjct  342  SKSAREKAIVDGVLTQLLLLLQSQCNGRIKTKARMLLKLLRSMWNE  387



>ref|XP_006847226.1| PREDICTED: U-box domain-containing protein 26 [Amborella trichopoda]
 gb|ERN08807.1| hypothetical protein AMTR_s00017p00257160 [Amborella trichopoda]
Length=400

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 112/198 (57%), Gaps = 2/198 (1%)
 Frame = -1

Query  706  LVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRAL  527
            L+ LL   ++ ++++   L+ ++ S     EL  +I     I +G++ ++     +  AL
Sbjct  183  LLVLLKGGTMKIKISICQLMVAISSSHDLKELCYEIGQNQVILQGLISVMQHS-HHVGAL  241

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
              G++AL +L L+       + AG +++L++ +   DK +   ALA +E L RI SG   
Sbjct  242  NAGIRALSSLALSLTTVEITIEAGIIDSLVECVMQADKSNVSLALAAIEHLSRIESGKKV  301

Query  346  FAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQS  170
               + L + +LVK++ ++S H  +E A G LL IC  S  AQ  A   G++TQLLLL+QS
Sbjct  302  LRENPLAIRVLVKLVFRVSDHEGSENAIGCLLVICEESLSAQEVAINEGILTQLLLLLQS  361

Query  169  DCTERAKRKAQMLLKLLR  116
             C  RAK KA++LLKLLR
Sbjct  362  QCNSRAKTKARVLLKLLR  379



>gb|AES94509.2| E3 ubiquitin ligase PUB14 [Medicago truncatula]
Length=451

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 112/212 (53%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  S++ ++N   LIE+++      + R++I ++  +  
Sbjct  223  DSESKKNLMQPAKISLMVDILNEGSIETKINCTRLIETLI---EEKDFRSEIISSHSLLV  279

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +S  +  G+  L  +C  K+ +   V+ GAV  L++ L   D    E A
Sbjct  280  GLMRLVK-DKRHSNGICPGLSLLRTVCFYKEVKILLVSIGAVSQLVELLSGMDHDCLELA  338

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  IP G  A      T+P++V+++++IS   T+YA   L S+C  + +     
Sbjct  339  LCVLDSLSSIPEGRVALKECVNTIPIMVRLLMRISESCTQYALSILWSVCKLAPEECSSI  398

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  399  AVDAGLAAKLLLVIQSGCNPILKQQSAELLKL  430



>ref|XP_003611551.1| U-box domain-containing protein [Medicago truncatula]
Length=471

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 112/212 (53%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  S++ ++N   LIE+++      + R++I ++  +  
Sbjct  223  DSESKKNLMQPAKISLMVDILNEGSIETKINCTRLIETLI---EEKDFRSEIISSHSLLV  279

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +S  +  G+  L  +C  K+ +   V+ GAV  L++ L   D    E A
Sbjct  280  GLMRLVK-DKRHSNGICPGLSLLRTVCFYKEVKILLVSIGAVSQLVELLSGMDHDCLELA  338

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  IP G  A      T+P++V+++++IS   T+YA   L S+C  + +     
Sbjct  339  LCVLDSLSSIPEGRVALKECVNTIPIMVRLLMRISESCTQYALSILWSVCKLAPEECSSI  398

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  399  AVDAGLAAKLLLVIQSGCNPILKQQSAELLKL  430



>ref|XP_001783217.1| predicted protein [Physcomitrella patens]
 gb|EDQ51985.1| predicted protein, partial [Physcomitrella patens]
Length=388

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 108/204 (53%), Gaps = 5/204 (2%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P  +  L  +L++ S++ + N+A +I ++      P L+  + +     E  V +L   L
Sbjct  187  PKSLACLAFVLASGSLEAKANAADVIHTLCE--EDPHLKIAVGDLPGAIEAFVDLLKENL  244

Query  544  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  365
             Y R ++ G++ L ++CL ++ R  A+   A+  L++ L + +K + + A   +E++   
Sbjct  245  -YPRVVQAGLRCLLSVCLPRRNRVIAIECRALSVLVELLPNTEKRNKDLAFEVLEIMANC  303

Query  364  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--reaaaAGVMTQ  191
              G  A + HA  +P++VK +L +S R TE A   L  + S +        A  AG  T 
Sbjct  304  AEGREAISNHATAIPMIVKSMLGVSQRVTECAVSTLWVVLSYASNRNVINTALQAGAFTN  363

Query  190  LLLLVQSDCTERAKRKAQMLLKLL  119
            LL+L+ S+C++R K+KA+  LKLL
Sbjct  364  LLVLLPSECSQRTKQKARDSLKLL  387



>ref|XP_010273225.1| PREDICTED: U-box domain-containing protein 30 [Nelumbo nucifera]
Length=452

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 111/212 (52%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES +    P ++  +V +L+  S++ ++N   LIE ++         +++ ++  +  
Sbjct  224  DSESKVNLMQPAKISLMVDILNEGSIETKINCTRLIEMLMD---EKNFSSEVVSSPSLLV  280

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +      G+  L  +C   Q R+  V+ GAV  L++ L + +    E A
Sbjct  281  GLLRLIK-DKRHPNGTSAGLGLLKTICSHNQVRNLVVSVGAVPQLVELLPNLNPDCLESA  339

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  +++LC +P G +A    + T+P +V++++++S   T+YA   L  +C  + +     
Sbjct  340  LFILDILCTLPEGRSALKVCSNTIPNMVRLLMRVSESCTQYALSILWEVCKLAPEECAAI  399

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  400  AVEAGLAAKLLLVIQSGCNPALKQRSSELLKL  431



>ref|XP_007047580.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX91737.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
Length=311

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 111/212 (52%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  SV+ ++N   L++ ++      E R++  ++  +  
Sbjct  83   DSESNTNLMQPTKISLMVDMLNEGSVETKINCTRLMDKLM---EEKEFRSESISSHRLLV  139

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +S  +  G+  L ++CL KQ R   V+ GAV  L++ L   +    E A
Sbjct  140  GVMRLVK-DKRHSNGILPGLSFLRSICLLKQVRSLIVSIGAVSQLVELLPSLEPDCLELA  198

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    A T+P  V++++++S   T+YA   L S+C  + +     
Sbjct  199  LFILDTLSSLPEGKVALKDCANTIPNTVRLLMRVSESCTQYALSILWSVCKLAPEECSSV  258

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  259  AVEAGLAAKLLLVIQSGCNPVLKQRSAELLKL  290



>ref|XP_002452587.1| hypothetical protein SORBIDRAFT_04g028560 [Sorghum bicolor]
 gb|EES05563.1| hypothetical protein SORBIDRAFT_04g028560 [Sorghum bicolor]
Length=462

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 69/218 (32%), Positives = 106/218 (49%), Gaps = 5/218 (2%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E ES    + P  +  +VS+LS+     +  +A ++  + S +  PE    +S  D 
Sbjct  224  PLGE-ESRSHIASPASLNAVVSILSHGETTAKAGAAVVLREIASSS-DPECLDAMSETDG  281

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I + ++ +L  P+S        V A + +  +     + V  G VE L++ L D DK   
Sbjct  282  IHDALIKLLQRPVSAQATKAAMVTAYYLVTNSGLAASRLVDLGMVELLVELLVDADKGTT  341

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-  227
            E+ALA ++ L     G     AHAL VP+LVK +  +S  ATE+A  AL  +C +     
Sbjct  342  EKALAVLDSLLLTEEGRGKACAHALAVPVLVKKMQHVSDMATEFAVSALWRLCKSFSGEG  401

Query  226  --qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
              + EA   G   +LLLL+Q  C    K +A  LL+LL
Sbjct  402  PCKAEALQLGAFQKLLLLLQVGCMGVTKERASELLRLL  439



>ref|XP_008680442.1| PREDICTED: U-box domain-containing protein 26-like [Zea mays]
Length=360

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 75/237 (32%), Positives = 108/237 (46%), Gaps = 52/237 (22%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNP-SVDVRMNSAALIESVLSGTRSPELRAQISNA  590
            V L E E+V V     RV  L  +L+   S++ R+N+ A++E+        + RA +  A
Sbjct  174  VGLGEEEAVEVVGREERVARLGKVLAGGGSLEARVNAGAVVEAAAL-ASGADARAVLGAA  232

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  410
            + +  G+V ++    S +RA+++G  A                         R +    C
Sbjct  233  EGVMAGLVTLVEEKAS-ARAVRVGTGAW-----------------------GRGRGSSSC  268

Query  409  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq  230
              E A  T                          ++  +S RA E+AAGAL+++   SE 
Sbjct  269  TPEPAAVTA-------------------------LVRAMSGRAAEHAAGALVAVVGGSEA  303

Query  229  aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDYNCSY  62
             Q EA  AG M QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D T  SDD+   Y
Sbjct  304  LQVEAVRAGAMGQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDCTANSDDFLQHY  360



>ref|XP_007047579.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91736.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=451

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 111/212 (52%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  SV+ ++N   L++ ++      E R++  ++  +  
Sbjct  223  DSESNTNLMQPTKISLMVDMLNEGSVETKINCTRLMDKLM---EEKEFRSESISSHRLLV  279

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +S  +  G+  L ++CL KQ R   V+ GAV  L++ L   +    E A
Sbjct  280  GVMRLVK-DKRHSNGILPGLSFLRSICLLKQVRSLIVSIGAVSQLVELLPSLEPDCLELA  338

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    A T+P  V++++++S   T+YA   L S+C  + +     
Sbjct  339  LFILDTLSSLPEGKVALKDCANTIPNTVRLLMRVSESCTQYALSILWSVCKLAPEECSSV  398

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  399  AVEAGLAAKLLLVIQSGCNPVLKQRSAELLKL  430



>ref|XP_004251181.1| PREDICTED: U-box domain-containing protein 26 [Solanum lycopersicum]
Length=334

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 89/168 (53%), Gaps = 6/168 (4%)
 Frame = -1

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  410
            D +  G+VG L       R  K   K L ALCL++  RH AV  GAV A++D L D D  
Sbjct  160  DTVLRGVVGCLK----DRRIAKSASKVLLALCLSENNRHVAVEVGAVGAVVDILSDLDVA  215

Query  409  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsas-  236
             AER+LA +ELLC +  G      HAL VP++V+++ ++   R  EYA   L  I   + 
Sbjct  216  AAERSLAALELLCTVAEGAEEVRVHALAVPMMVEVMGRMDGSRGKEYAISVLAVIYGGAC  275

Query  235  eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  92
            + A   A    V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  276  DGAPLAAPPEEVARAVMLALQGDCSARGRRKGAQLLKILQNYGRPDPT  323



>ref|XP_009801169.1| PREDICTED: uncharacterized protein LOC104246952 [Nicotiana sylvestris]
Length=352

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 94/161 (58%), Gaps = 6/161 (4%)
 Frame = -1

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  410
            + + +G+VG L    +  +  K   K L ALCL++  RH AV AGAV  +++ L D +  
Sbjct  170  ETVMKGVVGCL----TDRKISKSASKVLLALCLSENNRHVAVEAGAVGVVVEVLSDLEVA  225

Query  409  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsas-  236
             AER+LA +ELLC +  G     +HAL VP++V+++ ++  +R  EYA G L  I   + 
Sbjct  226  AAERSLAALELLCTVAEGAEEVRSHALAVPMMVEVMGRLEGNRGKEYAIGVLTVIYGGAC  285

Query  235  eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
            + A   A A  V   ++L +QSDC+ R +RK   LLK+L++
Sbjct  286  DGAPVTAPAEEVARAVMLALQSDCSARGRRKGAQLLKILQN  326



>ref|XP_011022933.1| PREDICTED: U-box domain-containing protein 26-like [Populus euphratica]
Length=397

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 125/227 (55%), Gaps = 7/227 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            + L E E + +  +  ++     L    +  ++ +   +IE++ S   + EL A++ N  
Sbjct  170  LSLDEYECLNMLKEESKLESFQFLFDQGTSKIKRSLCQIIEAISSSLETRELCAKLGNNR  229

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---QDFD  416
            ++ +G++ +++     S A   G+KA+ ALC  +  R   V  G +  L+  +   Q  +
Sbjct  230  KLLKGLILLVHQTYGASEA---GIKAISALCCLESNRENMVQEGGINGLLTYIYEAQRHE  286

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsa  239
            +  A +A+AT+ELL  + S   A       +  L+K++ ++S H+ +E A  +L+ IC+ 
Sbjct  287  RNLAPKAMATIELLLGLESAKEALINDPNGIKALIKMVFRVSDHQGSESAIRSLMIICTD  346

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
            S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKLL   W E+
Sbjct  347  SLQAREEAIGAGVLTQLLLLLQSQCSGRTKTKARMLLKLLGSKWDEE  393



>ref|XP_010249635.1| PREDICTED: U-box domain-containing protein 26 [Nelumbo nucifera]
Length=341

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 104/203 (51%), Gaps = 25/203 (12%)
 Frame = -1

Query  700  SLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKI  521
            SL+ NP  D              G+R P      +    +  G+V  L  P     A K+
Sbjct  160  SLVPNPPAD--------------GSRDP------TCPPSVMSGVVRFLKDPAGAKPATKV  199

Query  520  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFA  341
                L ALCLA+  RH AV AGAV  +++ + + +   AERALA +ELLC +P G +   
Sbjct  200  ----LLALCLAECNRHVAVEAGAVAEVVETVAELEGSAAERALAALELLCTVPEGASELR  255

Query  340  AHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQSDCT  161
            AHAL VP+LV+++ K++ R  E+   ++L++       +  A    V   ++L +Q +C+
Sbjct  256  AHALAVPMLVEMVTKMAGRGKEHGI-SVLAVIFGGGGEEGVAPPEEVGRAVVLALQGECS  314

Query  160  ERAKRKAQMLLKLLRDCWPEDFT  92
             RA+RK   +LK+L++    D T
Sbjct  315  ARARRKGAQILKVLQENGRLDLT  337



>ref|XP_003526867.1| PREDICTED: U-box domain-containing protein 25-like isoform X1 
[Glycine max]
 ref|XP_006581770.1| PREDICTED: U-box domain-containing protein 25-like isoform X2 
[Glycine max]
Length=394

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 116/229 (51%), Gaps = 11/229 (5%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            +PL   E + +  D  ++   + L    +  V+ +   LI+S  S  ++ E+   + ++ 
Sbjct  167  LPLVSLEPLNMIKDESKLATFLLLFEKGTSSVKTSLCHLIDSTAS-PQTEEVCHMLGHSH  225

Query  586  EIFEGIVGIL--NCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---QD  422
            ++   IV ++  NC +S      + +KA+ ALC  +  R   V  GA++  I  +   + 
Sbjct  226  KLVHEIVVLVRQNCEVSKV----VAIKAMLALCSLQSNRENLVREGAIDGAITYISGCET  281

Query  421  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSIC  245
              K  A  A+A ++ L  + S   A   H   V  LVK++ ++ +   +E A G L  +C
Sbjct  282  RQKNAAPLAMAIIKKLLVLDSAKEALVNHPNGVETLVKMVFRVCNQECSESAVGILAIVC  341

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
                +A+ EA  AGV+TQLL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  342  CDFGRAREEAIGAGVLTQLLFLLQSQCGTKTKTKARMLLKLLRSKWIEE  390



>ref|NP_196716.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87715.1| putative protein [Arabidopsis thaliana]
 gb|AAO22790.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42420.1| unknown protein [Arabidopsis thaliana]
 gb|AED91694.1| uncharacterized protein AT5G11550 [Arabidopsis thaliana]
Length=314

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 10/160 (6%)
 Frame = -1

Query  565  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  145  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  204

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq----  224
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  205  AALELMCTTAEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGEGGDSG  263

Query  223  ---reaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
                 A A  V   + L ++ +CT R KRK   LLK L +
Sbjct  264  EEIAVAPAEEVARAVALALEGECTARGKRKGAQLLKTLEE  303



>ref|XP_002267145.2| PREDICTED: U-box domain-containing protein 30 [Vitis vinifera]
 ref|XP_010647073.1| PREDICTED: U-box domain-containing protein 30 [Vitis vinifera]
Length=447

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 112/212 (53%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V LL+  S++ ++NS  LIE ++      + R++I ++  +  
Sbjct  219  DSESKANLMQPAKISLMVDLLNEGSIETKINSTRLIEMLM---EEKDFRSEIVSSHSLLV  275

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++      +  L  G+  L  +CL KQ R+  V+ GA+  L++ L   +    E A
Sbjct  276  GLMRLVKDKRHPNGNLP-GLTLLRTICLHKQVRNLFVSIGAIPQLVELLPALNPDCLESA  334

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A      T+P +V++++++S   T+YA   L S+C  + +     
Sbjct  335  LFILDTLSSLPEGRLALRDCLNTIPNMVRLLMRVSESCTQYALAILWSVCKLAPEECSSI  394

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  395  AVEAGLAAKLLLVIQSGCNPVLKQRSAELLKL  426



>ref|XP_010456493.1| PREDICTED: uncharacterized protein LOC104737947, partial [Camelina 
sativa]
Length=269

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = -1

Query  565  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  101  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  160

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  212
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  161  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  220

Query  211  aAGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  113
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  221  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  258



>ref|XP_008237598.1| PREDICTED: U-box domain-containing protein 30 [Prunus mume]
Length=449

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/212 (27%), Positives = 113/212 (53%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  S++ ++N   LI+ ++      + R++I ++  +  
Sbjct  221  DSESRTSLMQPAKISLMVDILNEGSIETKINCTRLIKMLM---EEKDFRSEIISSHSLLV  277

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     ++  +  G+  L  +CL K+ R   V+ GAV  L+D L   D    E A
Sbjct  278  GLMRLVK-DKRHTAGILPGLSLLRTICLHKEVRGFMVSIGAVPQLVDCLPSLDHECLELA  336

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G +A    + T+P +V+++++IS   T++A   L S+C  + +     
Sbjct  337  LFILDALSSLPEGISALKDCSNTIPNMVRLLMRISESCTQFALSILWSVCKHAPEECSSI  396

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  397  ALDAGLAAKLLLVIQSGCGPVLKQQSAELLKL  428



>ref|XP_006289615.1| hypothetical protein CARUB_v10003173mg [Capsella rubella]
 gb|EOA22513.1| hypothetical protein CARUB_v10003173mg [Capsella rubella]
Length=313

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 85/160 (53%), Gaps = 10/160 (6%)
 Frame = -1

Query  565  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC-------sase  233
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  204  AALELMCTTTEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGGGGGGG  262

Query  232  qaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
            +    A A  V   + L ++ +CT R +RK   LLK L +
Sbjct  263  EEIAVAPAEEVARAVALALEGECTARGRRKGAQLLKTLEE  302



>ref|XP_006466465.1| PREDICTED: U-box domain-containing protein 30-like [Citrus sinensis]
Length=450

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 108/212 (51%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P +V  LV +L+  SV+ ++N   LIE ++      + R +I ++  +  
Sbjct  222  DSESKTNLMQPAKVSLLVDMLNEGSVETKINCTRLIEKLM---EEKDFRPEIVSSHRLLI  278

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +   +  G+  L ++CL  + R   V+ GAV  L++ L   D    + A
Sbjct  279  GLMRLVKNK-RHPNGILPGLSLLRSICLLNEVRSLVVSIGAVPQLVELLPSLDPDCLQLA  337

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    A T+P  V++++++S   T+YA   L SIC  + +     
Sbjct  338  LCILDALSSLPEGKLALKDCANTIPNTVRLLMRVSEDCTQYALSILWSICKIAPEECSSA  397

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +L L++QS C    K+++  LLKL
Sbjct  398  AVDAGLAAKLFLVIQSGCNPVLKQRSAELLKL  429



>ref|XP_006410763.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
 gb|ESQ52216.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
Length=412

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 88/165 (53%), Gaps = 7/165 (4%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  416
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  233  VFTEVVQILDDQISH-KATKAAMHILVNICPWGRNRHKAVEAGAISVIIELLMDDSFSSD  291

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  242
            +   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  292  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFC  351

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  107
            A+     E    GV+T+L L++Q  C  + K KA+ LLKL    W
Sbjct  352  ATPALLNEMLQLGVVTKLCLVLQVSCGSKTKEKAKELLKLHARVW  396



>ref|XP_006426094.1| hypothetical protein CICLE_v10025589mg [Citrus clementina]
 gb|ESR39334.1| hypothetical protein CICLE_v10025589mg [Citrus clementina]
Length=450

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 108/212 (51%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P +V  LV +L+  SV+ ++N   LIE ++      + R +I ++  +  
Sbjct  222  DSESKTNLMQPAKVSLLVDMLNEGSVETKINCTRLIEKLM---EEKDFRPEIVSSHRLLI  278

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +   +  G+  L ++CL  + R   V+ GAV  L++ L   D    + A
Sbjct  279  GLMRLVKNK-RHPNGILPGLSLLRSICLLNEVRSLVVSIGAVPQLVELLPSLDPDCLQLA  337

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    A T+P  V++++++S   T+YA   L SIC  + +     
Sbjct  338  LCILDALSSLPEGKLALKDCANTIPNTVRLLMRVSEDCTQYALSILWSICKIAPEECSSA  397

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +L L++QS C    K+++  LLKL
Sbjct  398  AVDAGLAAKLFLVIQSGCNPVLKQRSAELLKL  429



>gb|KDO78935.1| hypothetical protein CISIN_1g041252mg [Citrus sinensis]
Length=450

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 108/212 (51%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P +V  LV +L+  SV+ ++N   LIE ++      + R +I ++  +  
Sbjct  222  DSESKTNLMQPAKVSLLVDMLNEGSVETKINCTRLIEKLM---EEKDFRPEIVSSHRLLI  278

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     +   +  G+  L ++CL  + R   V+ GAV  L++ L   D    + A
Sbjct  279  GLMRLVKNK-RHPNGILPGLSLLRSICLLNEVRSLVVSIGAVPQLVELLPSLDPDCLQLA  337

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G  A    A T+P  V++++++S   T+YA   L SIC  + +     
Sbjct  338  LCILDALSSLPEGKLALKDCANTIPNTVRLLMRVSEDCTQYALSILWSICKIAPEECSSA  397

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +L L++QS C    K+++  LLKL
Sbjct  398  AVDAGLAAKLFLVIQSGCNPVLKQRSAELLKL  429



>ref|XP_007207456.1| hypothetical protein PRUPE_ppa005655mg [Prunus persica]
 gb|EMJ08655.1| hypothetical protein PRUPE_ppa005655mg [Prunus persica]
Length=449

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 112/212 (53%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  +V +L+  S++ ++N   LI+ ++      + R++I ++  +  
Sbjct  221  DSESRTSLMQPAKISLMVDILNEGSIETKINCTRLIKMLM---EEKDFRSEIISSHSLLV  277

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     ++  +  G+  L  +CL K+ R   V+ GAV  L+D L   D    E A
Sbjct  278  GLMRLVK-DKRHTVGILPGLSLLRTICLHKEVRGFMVSIGAVPQLVDCLPSLDHECLELA  336

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G +A      T+P +V+++++IS   T+YA   L S+C  + +     
Sbjct  337  LFILDALSSLPEGISALKDCLNTIPNMVRLLMRISESCTQYALSILWSVCKHAPEECSSI  396

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  397  ALDAGLAAKLLLVIQSACGPVLKQQSAELLKL  428



>ref|XP_010491888.1| PREDICTED: uncharacterized protein LOC104769387 [Camelina sativa]
Length=313

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 80/160 (50%), Gaps = 10/160 (6%)
 Frame = -1

Query  565  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  212
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  204  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGGDDSGE  262

Query  211  aAGVMTQ-------LLLLVQSDCTERAKRKAQMLLKLLRD  113
               V           L L   +CT R +RK   LLK L +
Sbjct  263  EIAVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  302



>gb|AFW73318.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=477

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 106/233 (45%), Gaps = 13/233 (6%)
 Frame = -1

Query  733  FSDPVRVGYLVSLLSNPSVDVRMNSAALI--ESVLSGTRSPELRAQISNADEIFEGIVGI  560
             + P  +  +VS+LS+       +SAA++  E   S    PE    +S  + + + ++ +
Sbjct  245  IASPASLDAIVSILSHDGEATSKSSAAVVLREIASSSDSDPECLDALSETNGVHDALIKL  304

Query  559  LNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVE  380
            L  P+S        V A + +  +     + V  G VE L++ L D DK   E+ALA ++
Sbjct  305  LQKPVSAQATKAALVTAYYLVRGSDLAARRLVDLGMVELLVEMLVDADKGTTEKALAVLD  364

Query  379  LLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa---qreaaa  209
             L     G     AHAL VP+LVK +  +S  ATE+A  AL  +C +       + EA  
Sbjct  365  SLLLTEEGRGKACAHALAVPVLVKKMQHVSEMATEFAVSALWRLCKSFSGEGPCKAEALQ  424

Query  208  AGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             G   +LLLL+Q  C    K +A  LL+LL         G  D   C   V F
Sbjct  425  LGAFQKLLLLLQVGCMGVTKERASELLRLL--------NGSRDGVECIETVDF  469



>ref|XP_006399662.1| hypothetical protein EUTSA_v10014169mg [Eutrema salsugineum]
 gb|ESQ41115.1| hypothetical protein EUTSA_v10014169mg [Eutrema salsugineum]
Length=311

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K L ALCLA+  RH AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  160  KYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERALAALELMCTTAEGAAE  219

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSI---CsaseqaqreaaaAGVMTQLLLLV  176
              AHA+TVP +V ++ +++ R  EYA   L  +      S +    A A  V   + L +
Sbjct  220  VRAHAMTVPAMVAVMARLAGRGREYAISILTVVYGRGGVSGEEIAVAPAEEVARAVSLAL  279

Query  175  QSDCTERAKRKAQMLLKLLRD  113
            + +CT R +RK   LLK L +
Sbjct  280  EGECTARGRRKGAHLLKTLEE  300



>ref|XP_010106916.1| U-box domain-containing protein 30 [Morus notabilis]
 gb|EXC12632.1| U-box domain-containing protein 30 [Morus notabilis]
Length=450

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/212 (28%), Positives = 111/212 (52%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++ES      P ++  LV +L+  S++ +++   L+E ++      + R++I ++  +  
Sbjct  222  DSESKTNLMQPAKMSLLVDILNEGSIETKISCTKLMEMLM---EEKDFRSEIVSSHSLLV  278

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++  L     ++  +  G+  L  +CL K+ R   V  GAV  L+D L   D    E A
Sbjct  279  GLMR-LGKDKRHANGILAGLSLLRTICLHKEVRGLLVRIGAVPQLVDLLPSLDPNCLELA  337

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L  ++ L  +P G +A    + T+P  V+++++IS   T+YA   L S+C  + +     
Sbjct  338  LFILDSLSTLPEGRSALKDCSNTIPNAVRLLMRISESCTQYALSILWSVCKLAPEECSSA  397

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C+   K+++  LLKL
Sbjct  398  AVDAGLAAKLLLVIQSGCSPLLKQRSSELLKL  429



>ref|XP_006380377.1| hypothetical protein POPTR_0007s04220g [Populus trichocarpa]
 gb|ERP58174.1| hypothetical protein POPTR_0007s04220g [Populus trichocarpa]
Length=397

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 124/227 (55%), Gaps = 7/227 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            + L E E + +  +  ++     L    +  ++ +   +IE++ S   + EL A++    
Sbjct  170  LSLGEYECLNMLREESKLESFQFLFDQGTSKIKRSLCQIIEAISSSLETRELCAKLGKNR  229

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            ++ +G++ +++     S A   G+KA+ ALC  +  R   V  G +  L+  + D  + +
Sbjct  230  KLLKGLILLVHQTYGASEA---GIKAISALCCLESNRENMVQEGGINGLLTYIYDAQRHE  286

Query  406  ---AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsa  239
               A +A+AT+ELL  + S   A       +  L+K++ ++S H+ +E A  +L+ IC+ 
Sbjct  287  RNLAPKAMATIELLLGLESAKEALINDPNGIKALIKMVFRVSDHQGSESAIRSLMIICTD  346

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
            S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKLL   W E+
Sbjct  347  SLQAREEAIGAGVLTQLLLLLQSQCSGRTKTKARMLLKLLGSKWDEE  393



>ref|XP_010453204.1| PREDICTED: uncharacterized protein LOC104735168 [Camelina sativa]
Length=309

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = -1

Query  565  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  141  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  200

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  212
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  201  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  260

Query  211  aAGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  113
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  261  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  298



>ref|XP_010419728.1| PREDICTED: uncharacterized protein LOC104705421 [Camelina sativa]
Length=312

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = -1

Query  565  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  212
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  204  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  263

Query  211  aAGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  113
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  264  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  301



>ref|XP_009141534.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
 emb|CDY40422.1| BnaA04g20950D [Brassica napus]
Length=412

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 90/167 (54%), Gaps = 7/167 (4%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  416
            +F  +V IL+  +S ++A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  233  VFTEVVQILDDRIS-NKATKAALHILVNICPWGRNRHKAVEAGAISMMIELLMDESFSSD  291

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  242
            +   E A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+    
Sbjct  292  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFC  351

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
            A+     E    GV+++L L++Q +C  + K KA+ LLKL    W +
Sbjct  352  ATPSLLHEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>ref|XP_002526642.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF35754.1| Spotted leaf protein, putative [Ricinus communis]
Length=404

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 131/233 (56%), Gaps = 11/233 (5%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            +P  + ES+ +  +  ++    SLL + +  +++    LIE++ S + + EL + +    
Sbjct  176  LPFAQYESLNMLKEESKLQSFKSLLEHGTSKMKVGLCHLIEAISSSSDTRELCSILGQNH  235

Query  586  EIFEGIVGIL--NCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  413
             + +G+V ++  NC      A + G+KA+ ALC ++  R   V  G ++ L+  + + ++
Sbjct  236  GLLQGLVLLVQDNC-----EAPEAGIKAISALCSSESNRDNMVQGGVLKGLLTYISNAER  290

Query  412  CDAE---RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSIC  245
            C      RA+AT+ELL  + +   A   +   +  LVK++ ++S H  +E A  +L+ +C
Sbjct  291  CHRNLISRAMATIELLLELDTAKEAVINNPDGIGALVKMVFRVSDHEGSESAVRSLMILC  350

Query  244  saseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI  86
              S QA+ EA +AGV+TQ+LLL+QS C+ R K +A+MLLKLLR  W E    I
Sbjct  351  GDSLQAREEAISAGVLTQVLLLLQSQCSGRTKTRARMLLKLLRSKWNEQPKNI  403



>ref|XP_009603741.1| PREDICTED: uncharacterized protein LOC104098657 [Nicotiana tomentosiformis]
Length=335

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 93/172 (54%), Gaps = 6/172 (3%)
 Frame = -1

Query  601  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  422
            ++  + + +G+VG L       +  K   K L ALCL++  RH AV AGAV  +++ L D
Sbjct  157  VTCPETVMKGVVGCLK----DRKISKSASKVLLALCLSENNRHVAVEAGAVGVVVEVLSD  212

Query  421  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSIC  245
             +   AER+LA +ELLC +  G      HAL VP++V+++ ++   R  EYA G L  I 
Sbjct  213  LEVAAAERSLAALELLCMVAEGAEEVRTHALAVPMMVEVMGRLEGSRGKEYAIGVLAVIY  272

Query  244  sas-eqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  92
              + + A   A    V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  273  GGACDGAPVNAPPEEVARAVMLALQGDCSARGRRKGAQLLKILQNYGQPDPT  324



>gb|AGT17408.1| hypothetical protein SHCRBa_230_N09_R_300 [Saccharum hybrid cultivar 
R570]
Length=449

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 72/228 (32%), Positives = 116/228 (51%), Gaps = 17/228 (7%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRS-PELRAQISNA  590
            +PL E E+      P  +G LV++  N S+  R+N+   I  V+S   +  +L  ++   
Sbjct  204  MPLDE-EAARTLGLPTSLGSLVAIAENGSLAGRLNAVLAIREVVSCDGAFTDLSGKV---  259

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCL-AKQYRHKAVTAGAVEALIDRLQDFDK  413
            DEI + +  I+  P+   +A K G+ A++ L L  ++   +   AG V  L++ L D DK
Sbjct  260  DEIVDALAKIIKAPIC-PQATKAGMVAIYHLALYDERVAARLAAAGLVPVLVEALVDADK  318

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
              +E+ALA ++ +     G A+  AHAL VP+LVK + ++S  AT+ A  A+  +  A  
Sbjct  319  SMSEKALAVLDAVLASEEGRASARAHALAVPMLVKKMFRVSDLATQLAVSAMWRLGKAHS  378

Query  232  qaqreaaa----------AGVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
              + E  A           G   +LLLL+Q  C +  K KA  LLK+L
Sbjct  379  DGEEEEDAVTRCLVEALRVGAFQKLLLLLQVGCRDATKEKATELLKML  426



>ref|XP_007155812.1| hypothetical protein PHAVU_003G233800g [Phaseolus vulgaris]
 gb|ESW27806.1| hypothetical protein PHAVU_003G233800g [Phaseolus vulgaris]
Length=443

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 109/202 (54%), Gaps = 5/202 (2%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P RV  +V +L+  S++ ++N   LIE+++ G    + + +I  +  +  G++ ++    
Sbjct  225  PARVSLMVDILNEGSIETKINCTRLIETLIEG---KDFQLEIFRSHSLLVGLMRLVK-DK  280

Query  544  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  365
             ++  +  G++ L  +CL  + +   V+ GAV  L++ L   +    E AL+ ++ L  +
Sbjct  281  RHTNGICPGLRLLRTVCLHSEVKSLLVSIGAVSQLVELLSGLESECLELALSILDALASV  340

Query  364  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaAGVMTQL  188
            P G  A    + T+ ++VK++++IS   T+YA   L S+C  + +     A  AG+  +L
Sbjct  341  PEGRLALKNCSNTIHVMVKLLMRISENCTQYALSILWSVCKLAPEECSLIAVEAGLAAKL  400

Query  187  LLLVQSDCTERAKRKAQMLLKL  122
            LL++QS C    K+++  LLKL
Sbjct  401  LLVIQSGCNPILKQQSAELLKL  422



>ref|XP_003524698.1| PREDICTED: U-box domain-containing protein 30-like [Glycine max]
Length=444

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 110/212 (52%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            + ES      P +V  +V +L+  S++ ++N   LIE+++      + +  I  +  +  
Sbjct  216  DCESKRSLVQPAKVSLMVDILNEGSIETKINCTWLIETLI---EEKDFQMVIFRSHSLLV  272

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     ++  +  G++ L  LCL  + +   V+ GAV  L+  L   +    E A
Sbjct  273  GLMRLVK-DKRHTNGICSGLRLLRTLCLHSEVKSLLVSIGAVSQLVQLLPGLEHECLELA  331

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L+ ++ L  +P G  A    + T+P++VK+++++S   T+YA   L S+C+ +       
Sbjct  332  LSILDALASVPEGILALKDCSNTIPVMVKLLMRVSENCTQYALSILWSVCNVAPDECSLI  391

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  392  AVEAGLAAKLLLVIQSGCNPILKQQSTELLKL  423



>gb|KDO51673.1| hypothetical protein CISIN_1g015728mg [Citrus sinensis]
Length=401

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 121/228 (53%), Gaps = 8/228 (4%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTR-SPELRAQISNADEIF  578
            E ES+ + ++  ++   + L  + S  ++     L+E ++S +  + EL  ++   D + 
Sbjct  177  ETESLNLLNEESKMESFIVLFEHGSCSIKKRLCHLVEVIISSSHETKELCCKLGKDDRLL  236

Query  577  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF---DKCD  407
              I+ +++     S A   GV+A  ALC  +  R   V  GA+  LI  + +    ++  
Sbjct  237  REIISLVH---HNSEASDAGVRAFSALCSTETNRKTLVQEGAINGLIAYISNALTRERSL  293

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseq  230
            A  A+A +E L  I +   A   +   V  LVK++ ++S H  +E A  +L+ IC  S Q
Sbjct  294  AAIAMARIEQLLAIENSKDALINNPNGVYALVKMVFRVSDHEGSENAINSLMMICCDSLQ  353

Query  229  aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI  86
            A+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKLLR  W E+   +
Sbjct  354  AREEAICAGVLTQLLLLLQSQCSNRTKTKARMLLKLLRSKWAEELKHV  401



>ref|XP_006432191.1| hypothetical protein CICLE_v10001406mg [Citrus clementina]
 gb|ESR45431.1| hypothetical protein CICLE_v10001406mg [Citrus clementina]
Length=395

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 121/228 (53%), Gaps = 8/228 (4%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTR-SPELRAQISNADEIF  578
            E ES+ + ++  ++   + L  + S  ++     L+E ++S +  + EL  ++   D + 
Sbjct  171  ETESLNLLNEESKMESFIVLFEHGSCSIKKRLCHLVEVIISSSHETKELCCKLGKDDRLL  230

Query  577  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF---DKCD  407
              I+ +++     S A   GV+A  ALC  +  R   V  GA+  LI  + +    ++  
Sbjct  231  REIISLVH---HNSEASDAGVRAFSALCSTETNRKTLVQEGAINGLIAYISNALTRERSL  287

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseq  230
            A  A+A +E L  I +   A   +   V  LVK++ ++S H  +E A  +L+ IC  S Q
Sbjct  288  AAIAMARIEQLLAIENSKDALINNPNGVYALVKMVFRVSDHEGSENAINSLMMICCDSLQ  347

Query  229  aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI  86
            A+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKLLR  W E+   +
Sbjct  348  AREEAICAGVLTQLLLLLQSQCSNRTKTKARMLLKLLRSKWAEELKHV  395



>ref|XP_006465012.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
Length=401

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 121/228 (53%), Gaps = 8/228 (4%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTR-SPELRAQISNADEIF  578
            E ES+ + ++  ++   + L  + S  ++     L+E ++S +  + EL  ++   D + 
Sbjct  177  ETESLNLLNEESKMESFIVLFEHGSCSIKKRLCHLVEVIISSSHETKELCCKLGKDDRLL  236

Query  577  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF---DKCD  407
              I+ +++     S A   GV+A  ALC  +  R   V  GA+  LI  + +    ++  
Sbjct  237  REIISLVH---HNSEASDAGVRAFSALCSTETNRKTLVQEGAINGLIAYISNALTRERSL  293

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseq  230
            A  A+A +E L  I +   A   +   V  LVK++ ++S H  +E A  +L+ IC  S Q
Sbjct  294  AAIAMARIEQLLAIENSKDALINNPNGVYALVKMVFRVSDHEGSENAINSLMMICCDSLQ  353

Query  229  aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGI  86
            A+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKLLR  W E+   +
Sbjct  354  AREEAICAGVLTQLLLLLQSQCSNRTKTKARMLLKLLRSKWAEELKHV  401



>ref|XP_009133058.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Brassica rapa]
Length=409

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 88/167 (53%), Gaps = 7/167 (4%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  416
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  230  VFTEVVQILDDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSD  288

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  242
            +   E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  289  RRGPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFC  348

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
            A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  349  ATPALLHEMLQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>ref|XP_002873519.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49778.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 76/145 (52%), Gaps = 8/145 (6%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K L ALCLA+  RH AV AGA  A+I+     +    ERALA +EL+C    G A 
Sbjct  159  KYVTKILLALCLAEGNRHVAVEAGAARAVIETAAGLEISAVERALAALELMCTTAEGAAE  218

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSIC-------saseqaqreaaaAGVMTQL  188
               HA+TVP +V ++ +++ R  EYA  ++LSI          S +    A A  V   +
Sbjct  219  VRGHAMTVPAMVAVMARLAGRGREYAI-SILSIVYGKAGGGGDSGEEIAVAPAEEVARAV  277

Query  187  LLLVQSDCTERAKRKAQMLLKLLRD  113
             L ++ +CT R +RK   LLK L +
Sbjct  278  ALALEGECTARGRRKGAQLLKTLEE  302



>ref|XP_006403803.1| hypothetical protein EUTSA_v10010389mg [Eutrema salsugineum]
 dbj|BAJ34414.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45256.1| hypothetical protein EUTSA_v10010389mg [Eutrema salsugineum]
Length=435

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  255  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  313

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  314  ERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSIGRF  373

Query  238  seq--aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
                   +E    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPCLLQEMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>gb|KHN20357.1| U-box domain-containing protein 30 [Glycine soja]
Length=444

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 110/212 (52%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            + ES      P +V  +V +L+  S++ ++N   LIE+++      + +  I  +  +  
Sbjct  216  DCESKRSLVQPAKVSLMVDILNEGSIETKINCTWLIETLI---EEKDFQMVIFRSHSLLV  272

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G++ ++     ++  +  G++ L  LCL  + +   V+ GAV  L+  L   +    E A
Sbjct  273  GLMRLVK-DKRHTNGICSGLRLLRTLCLHSEVKSLLVSIGAVSQLVQLLPGLEHECLELA  331

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qre  218
            L+ ++ L  +P G  A    + T+P++VK+++++S   T+YA   L S+C+ +       
Sbjct  332  LSILDALASVPEGILALKDCSNTIPVMVKLLMRVSENCTQYALSILWSVCNVAPDECSLI  391

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  392  AVEAGLAAKLLLVIQSGCNPILKQQSTELLKL  423



>emb|CDX84587.1| BnaA03g16430D [Brassica napus]
Length=409

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 88/167 (53%), Gaps = 7/167 (4%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  416
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  230  VFTEVVQILDDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSD  288

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  242
            +   E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  289  RRGPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFC  348

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
            A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  349  ATPALLHEMLQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>emb|CDY32070.1| BnaC04g44960D [Brassica napus]
Length=412

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  416
            +F  +V IL   +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  233  VFTEVVQILEDRISH-KATKAALHILVNICPWGRNRHKAVEAGAIYVMIELLMDESFSSD  291

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  242
            +   E A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+    
Sbjct  292  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFC  351

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
            A+     E    GV+++L L++Q +C  + K KA+ LLKL    W +
Sbjct  352  ATPALLHEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>ref|XP_006382863.1| hypothetical protein POPTR_0005s06470g [Populus trichocarpa]
 gb|ERP60660.1| hypothetical protein POPTR_0005s06470g [Populus trichocarpa]
Length=390

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 124/224 (55%), Gaps = 7/224 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            + L E E + + ++  ++     L    +  ++ +   +IE++ S   + EL A++    
Sbjct  169  LSLGEYEYLNMLNEESKLESFQVLFDQGTGKIKRSLCQVIEAISSSLETRELCAKLGKNR  228

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            ++ +G++ +++     S A   G+KA+ ALC  +  R   V  G +  L+  + D ++ +
Sbjct  229  KLLKGLILLVHQTYEASDA---GIKAISALCCLESNRQNLVQEGVINRLLTYIFDAERHE  285

Query  406  ---AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsa  239
               A +AL+T+ELL  + S  AA   +   +  L+K++ + S H  +E A  +L  IC+ 
Sbjct  286  RNLAPKALSTIELLLELESAKAALINNPNGIKALIKMVFRFSEHEGSESAVRSLTIICTD  345

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  107
            S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKLLR  W
Sbjct  346  SLQAREEAIGAGVLTQLLLLLQSQCSARTKTKARMLLKLLRSRW  389



>ref|XP_009367895.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
26 [Pyrus x bretschneideri]
Length=305

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 87/163 (53%), Gaps = 9/163 (6%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            E+  G+V  L        A K   K L ALCLA+  RH AV +GA  A+++   + +   
Sbjct  146  ELMRGVVRNLK----NKAAAKPATKILLALCLAEGNRHVAVESGAAAAVVETALELEAAS  201

Query  406  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC-----s  242
            AER+LA +EL+C +  G AA  AHA+ VP++V I+ + S R  EYA G L  I       
Sbjct  202  AERSLAALELMCTVAEGAAAVRAHAMAVPVMVMIMGRTSARGKEYAIGVLAVIYGGGDDE  261

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
             + +A   A    V   + L +Q DC+ R +RK   LLK+L++
Sbjct  262  EAAEAVAAAPREEVARAVELALQGDCSGRGRRKGAQLLKVLQE  304



>ref|XP_002965206.1| hypothetical protein SELMODRAFT_439085 [Selaginella moellendorffii]
 gb|EFJ34044.1| hypothetical protein SELMODRAFT_439085 [Selaginella moellendorffii]
Length=567

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 13/125 (10%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  404
            I    V +L  P + ++ +++ +K++  +CL+K  R  AV AGAVEAL+D L D    D 
Sbjct  319  ILGACVALLKDPSAEAKLVRLALKSMLGICLSKPNRIPAVKAGAVEALLDTLVDLHGVDG  378

Query  403  -------------ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAG  263
                         ERALAT+ELLC    G AA  +    +  LV ++L +S RATEYAAG
Sbjct  379  GEFCSKSGIVVNVERALATLELLCTSSEGRAAICSQPNFISELVGLVLGVSERATEYAAG  438

Query  262  ALLSI  248
             L ++
Sbjct  439  VLCAV  443



>emb|CDP20283.1| unnamed protein product [Coffea canephora]
Length=448

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 105/202 (52%), Gaps = 5/202 (2%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P +V  +V +L+  S+D ++N   LIE ++ G    +  ++I ++  +  G++ ++    
Sbjct  230  PAKVSLMVDILNEGSIDTKINCTKLIEILIDGE---DFESEIVSSLSLLVGVLRLVK-DK  285

Query  544  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  365
             +   +  G++ L  +C  +  R+  V+ GAV  L++ L   +    E AL  +E LC +
Sbjct  286  RHPNGVLAGLRLLKMICSHESVRNSVVSIGAVPQLVELLPTLNPECLELALYVLEALCTL  345

Query  364  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaAGVMTQL  188
            P G  A       +P +VK+++K+S   T +A   L ++C  + +     A  AG+  +L
Sbjct  346  PEGGLALKNCPSAIPAIVKLLMKVSESCTHFALSILWAVCKLAPEECAALAVDAGLAAKL  405

Query  187  LLLVQSDCTERAKRKAQMLLKL  122
            LL++QS C    K+++  LLKL
Sbjct  406  LLVIQSGCNPVLKQRSAELLKL  427



>emb|CDX85708.1| BnaA02g01050D [Brassica napus]
Length=308

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 4/142 (3%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K L ALCLA+  R  AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  156  KYVTKILLALCLAEGNRRVAVEAGAARAVVETAAGLENSAVERALAALELMCTTAEGAAE  215

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAG----VMTQLLLL  179
              AHA+TVP +V ++ +++ R  EYA   L  +         E         V   + L 
Sbjct  216  VRAHAMTVPAMVAVMARLAGRGREYAISILAVVYGRGGAFSGEEITVAPAEEVARAVALA  275

Query  178  VQSDCTERAKRKAQMLLKLLRD  113
            ++ +CT R +RK   LLK L +
Sbjct  276  LEGECTARGRRKGAHLLKTLEE  297



>ref|XP_009419493.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 115/226 (51%), Gaps = 11/226 (5%)
 Frame = -1

Query  706  LVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRAL  527
            L  +L   +   R N+  ++ S+L     P  R+ I    E+F+ IV ++   +S  +A 
Sbjct  195  LSMILRRSNYQSRSNAMLILNSLLGVI--PPARS-IGLGGELFQEIVNVVRDRIS-QQAT  250

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALID-RLQDFDKCDAERALATVELLCRIPSGCA  350
            K  + AL  LCL  + R KAV AGAV AL++  L+   K   E ALA ++ LC    G A
Sbjct  251  KAALHALLRLCLYGKSRVKAVEAGAVHALVELLLESPQKRVCELALAGLDWLCGCADGRA  310

Query  349  AFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--reaaaAGVMTQLLLLV  176
                H   +P + K IL++S  A+E A   L S+   S  A   +E    GV+++L L++
Sbjct  311  ELVRHRAAIPAVSKKILRVSQLASEKAVRILHSVARHSATAAVLQEMMNVGVVSKLCLVL  370

Query  175  QSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF*SYC  38
            Q  C  + + KA+ +LKL    W +D   +S  Y+ +Y +   SYC
Sbjct  371  QVGCGGKMEEKAREILKLHSRVW-KDSPCLSPLYSSTYPM---SYC  412



>ref|XP_009125812.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
Length=308

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 4/142 (3%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K L ALCLA+  R  AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  156  KYVTKILLALCLAEGNRRVAVEAGAARAVVETAAGLENSAVERALAALELMCTTAEGAAE  215

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAG----VMTQLLLL  179
              AHA+TVP +V ++ +++ R  EYA   L  +         E         V   + L 
Sbjct  216  VRAHAMTVPAMVAVMARLAGRGREYAISILAVVYGRGGAFSGEEITVAPAEEVARAVALA  275

Query  178  VQSDCTERAKRKAQMLLKLLRD  113
            ++ +CT R +RK   LLK L +
Sbjct  276  LEGECTARGRRKGAHLLKTLEE  297



>ref|XP_002465578.1| hypothetical protein SORBIDRAFT_01g041450 [Sorghum bicolor]
 gb|EER92576.1| hypothetical protein SORBIDRAFT_01g041450 [Sorghum bicolor]
Length=454

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 116/228 (51%), Gaps = 17/228 (7%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRS-PELRAQISNA  590
            +PL E E+      P  +G LV++  N ++  R+N+   I+ V+S   +  +L  ++   
Sbjct  209  MPLDE-EAARTLGLPSSLGSLVAIAENGTLAGRLNAVLAIKEVVSCDGAFTDLSGKV---  264

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCL-AKQYRHKAVTAGAVEALIDRLQDFDK  413
            DEI + +  I+  P+   +A K G+ A + L L  ++   +   AG V  LI+ L D DK
Sbjct  265  DEIVDALAKIIKSPIC-PQATKAGMVATYHLALYDERVAARLAAAGLVPVLIEALVDADK  323

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
              +E+ALA ++ +     G A+  AHAL VP+LVK + ++S  AT+ A  A+  +  A  
Sbjct  324  SMSEKALAVLDAVLASEEGRASARAHALAVPMLVKKMFRVSDLATQLAVSAMWRLGKAHS  383

Query  232  qaqreaaa----------AGVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
              + E  A           G   +LLLL+Q  C +  K KA  LLKLL
Sbjct  384  DGEEEENAVTRCLVEALRVGAFQKLLLLLQVGCRDATKEKATELLKLL  431



>emb|CDY68531.1| BnaCnng59400D [Brassica napus]
Length=304

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 4/155 (3%)
 Frame = -1

Query  565  GILNCPLSYS-RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  389
            G+++C  S S    K   K L ALCLA+  RH AV AGA  A+++     +    ERALA
Sbjct  139  GLVSCLRSNSIVTAKYATKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERALA  198

Query  388  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas---eqaqre  218
             +EL+C    G A    HA+TVP +V ++ +++ R  E A   L  +        +    
Sbjct  199  ALELMCTTAEGAAEVRGHAMTVPAMVAVMARLAGRGRENAISILAVVYGRGGVDGEEIAV  258

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
            A A  V   + L ++ +CT R +RKA  LLK L +
Sbjct  259  APAEEVARAVALALEGECTARGRRKAAHLLKTLEE  293



>ref|XP_009136678.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Brassica rapa]
Length=423

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S+ +A    ++ L  +C   + RHKAV AGAV  +I+ L D     
Sbjct  243  ELFNEVVQILSDQISH-KATTSAMQILVIICPWGRNRHKAVAAGAVSMIIELLMDETFSS  301

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  302  ERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSIGRF  361

Query  238  seq--aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
                   +E    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  362  CATPCLLQEMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  409



>emb|CAN66286.1| hypothetical protein VITISV_011184 [Vitis vinifera]
Length=397

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 120/211 (57%), Gaps = 7/211 (3%)
 Frame = -1

Query  736  VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGIL  557
            +  +  ++  LV L  + +  ++ +   L+E++ S + + EL A +    ++ +GIV ++
Sbjct  178  MLKEESKLESLVVLFKHGTPMIKTSVCNLLEAISSSSETKELCATLGTTHQLLQGIVLLV  237

Query  556  NCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF---DKCDAERALAT  386
            +     S A   G+KA+ ALC  +  +   +  GAV+ LI  + +    +K  A  A+A 
Sbjct  238  HHDCEASEA---GIKAMLALCSVESNKENLIREGAVDGLISYISNAQVKEKSAAPLAIAV  294

Query  385  VELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqaqreaaa  209
            +E+L  + SG  A   +   V  LVK+  K+S H+ +E A  +L+ +C+ S +A+ EA +
Sbjct  295  LEVLLGVESGREAVLNNPNGVKALVKMTFKVSDHQGSENAVSSLMVLCTDSLRAREEAIS  354

Query  208  AGVMTQLLLLVQSDCTERAKRKAQMLLKLLR  116
            AGV++QLL L+QS C+   K KA+MLLKLLR
Sbjct  355  AGVLSQLLFLLQSQCSGTIKTKARMLLKLLR  385



>ref|XP_010526330.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Tarenaya hassleriana]
Length=434

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 92/169 (54%), Gaps = 9/169 (5%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            +IF  +V IL+  +S ++A K  ++ L  +C   + RHKAV AGA+  +I+ L D +   
Sbjct  254  DIFAEVVQILHDQIS-NKATKSALRILVNICPWGRNRHKAVEAGAISVIIELLMD-ETFS  311

Query  406  AER-----ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  242
            +ER     A+  ++LLC+   G A F  H   + ++ K IL++S  A+E A   LLS+  
Sbjct  312  SERRIPEMAMVVLDLLCQCAEGRAEFLNHGAGIAVVSKKILRVSQTASERAVRVLLSVGR  371

Query  241  --aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
              A+    +E    GV+ +L L++Q  C  + K KA+ LL+L    W E
Sbjct  372  FCATPFLLQEMLQLGVVAKLCLVLQVSCGNKTKEKARELLRLHARVWRE  420



>ref|XP_002262704.2| PREDICTED: U-box domain-containing protein 26-like [Vitis vinifera]
Length=399

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 120/211 (57%), Gaps = 7/211 (3%)
 Frame = -1

Query  736  VFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGIL  557
            +  +  ++  LV L  + +  ++ +   L+E++ S + + EL A +    ++ +GIV ++
Sbjct  183  MLKEESKLESLVVLFKHGTPMIKTSVCNLLEAISSSSETKELCATLGTTHQLLQGIVLLV  242

Query  556  NCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF---DKCDAERALAT  386
            +     S A   G+KA+ ALC  +  +   +  GAV+ LI  + +    +K  A  A+A 
Sbjct  243  HHDCEASEA---GIKAMLALCSVESNKENLIREGAVDGLISYISNAQVKEKSAAPLAIAV  299

Query  385  VELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqaqreaaa  209
            +E+L  + SG  A   +   V  LVK+  K+S H+ +E A  +L+ +C+ S +A+ EA +
Sbjct  300  LEVLLGVESGREAVLNNPNGVKALVKMTFKVSDHQGSENAVSSLMVLCTDSLRAREEAIS  359

Query  208  AGVMTQLLLLVQSDCTERAKRKAQMLLKLLR  116
            AGV++QLL L+QS C+   K KA+MLLKLLR
Sbjct  360  AGVLSQLLFLLQSQCSGTIKTKARMLLKLLR  390



>gb|KFK34491.1| hypothetical protein AALP_AA5G152500 [Arabis alpina]
Length=439

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 91/168 (54%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  ++ IL+  +S  +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  255  ELFVEVIQILHDQIS-QKATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDDTFSS  313

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  314  ERRNSEMAMVVLDMLCQCAEGRAEFLHHGAAIAVVSKKILRVSQITSERAVRVLLSIGRF  373

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>ref|XP_010463781.1| PREDICTED: U-box domain-containing protein 31 [Camelina sativa]
Length=447

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 103/206 (50%), Gaps = 13/206 (6%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P RV  +V +LS+ S++ ++N A LI  ++        RA++ ++  +  G++ ++    
Sbjct  229  PARVSLMVDMLSDGSIETKINCARLIGRLV---EEKSFRAELVSSHSLLVGLMRLVK---  282

Query  544  SYSRALKIGVKA----LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVEL  377
               R  + GV      L ++ + KQ R+  V  GAV  L+D L   D    E AL  +E 
Sbjct  283  --DRRRRNGVSPALTLLKSVSVHKQVRNLMVKVGAVPQLVDVLPCLDPESLESALFVLES  340

Query  376  LCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaAGV  200
            LC    G  A      T+P  V++++++S + T YA   L S+C  + +     A   G+
Sbjct  341  LCLESEGRIALKDSVNTIPNTVRLLMRVSEKCTNYAISILWSVCKLASEECSSLAVEVGL  400

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKL  122
              +LLL++QS C    K+++  LLKL
Sbjct  401  AAKLLLVIQSGCDPALKQRSAELLKL  426



>gb|ERN02753.1| hypothetical protein AMTR_s00086p00031680 [Amborella trichopoda]
Length=351

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 91/180 (51%), Gaps = 7/180 (4%)
 Frame = -1

Query  616  ELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALI  437
            E RA I  A  I E +V +L   L   R  K    ALF LC  ++ + +AV AGAV+ LI
Sbjct  179  ENRAPIGCAGAI-EPLVNLL--ALGSFRGKKDAAAALFTLCSVRENKLRAVKAGAVKPLI  235

Query  436  DRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGAL  257
            + + DF     E+A   +++L  I    AA       +P+LV+II   SHR  E+A G L
Sbjct  236  EYMADFSSGMLEKAALVLDVLVGIREAKAAVVEEG-GIPVLVEIIEVGSHRQKEFAVGIL  294

Query  256  LSICsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDD  77
            L +C  S   +   A  G +  L+ L Q+  T RA++KA+ L+  LR   P      SDD
Sbjct  295  LQLCEESSVYRTLVAREGAIPPLVALSQNGTT-RARQKAETLIPFLR--QPRSGFHRSDD  351



>ref|XP_008220387.1| PREDICTED: U-box domain-containing protein 30-like [Prunus mume]
Length=454

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 110/211 (52%), Gaps = 5/211 (2%)
 Frame = -1

Query  751  AESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  572
            +E+  +   P ++  +V +L+  S++ ++N   LIE ++ G    +L ++  ++  +  G
Sbjct  227  SEAKTILMQPAKISLMVDMLNEGSIETKINCTKLIEVLMEGK---DLESENVSSLSLVVG  283

Query  571  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            ++ ++     +S  +  G+  L  +C  +  R+  V+ GAV  LI+ L + +    E AL
Sbjct  284  LLRLVK-DKRHSNGVLPGLSLLKTICSHESVRNSVVSVGAVPQLIELLPNLNHECLELAL  342

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qrea  215
              +E+L  +P G  A      T+P +V++++K+S   T+ A   L ++C  +       A
Sbjct  343  HILEVLSTLPEGRQALKDCPKTIPSVVRLLMKVSESCTQLALSILWAVCKLAPDECASLA  402

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
              AG+  +LLL++QS C    K++A  LLKL
Sbjct  403  VEAGLAAKLLLVIQSGCNPVLKQRAAELLKL  433



>ref|XP_006295808.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
 gb|EOA28706.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
Length=408

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 88/168 (52%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  228  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  286

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  287  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKY  346

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+     E    GV+++L L++Q  C  + K KA+ LLKL    W +
Sbjct  347  CATPALLNEMLQLGVVSKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  394



>emb|CDX91209.1| BnaC02g03880D [Brassica napus]
Length=310

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 4/142 (3%)
 Frame = -1

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K   K L ALCLA+  R  AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  158  KYVTKILLALCLAECNRRVAVEAGAARAVVETAAGLENSAVERALAALELMCTTAEGAAE  217

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAG----VMTQLLLL  179
              AHA+TVP +V ++ +++ R  EYA   L  +         E         V   + L 
Sbjct  218  VRAHAMTVPAMVAVMARLAGRGREYAISILAVVYGRGGAFSGEEITVAPAEEVARAVALA  277

Query  178  VQSDCTERAKRKAQMLLKLLRD  113
            ++ +CT R +RK   LLK L +
Sbjct  278  LEGECTARGRRKGAHLLKTLEE  299



>ref|NP_001147860.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
 gb|ACG28921.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=452

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 69/233 (30%), Positives = 105/233 (45%), Gaps = 13/233 (6%)
 Frame = -1

Query  733  FSDPVRVGYLVSLLSNPSVDVRMNSAALI--ESVLSGTRSPELRAQISNADEIFEGIVGI  560
             + P  +  +VS+LS+       +SAA++  E   S    PE    +S    + + ++ +
Sbjct  220  IASPASLDAIVSILSHDGEATTKSSAAVVLREIASSSDSDPECLDALSVTSGVHDALIKL  279

Query  559  LNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVE  380
            L  P+S        V A + +  +     + V  G V+ L++ L D DK   E+ALA ++
Sbjct  280  LQKPVSAQATKAALVTAYYLVRGSDLAARRLVDLGMVDLLVEMLVDADKGTTEKALAVLD  339

Query  379  LLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa---qreaaa  209
             L     G     AHAL VP+LVK +  +S  ATE+A  AL  +C +       + EA  
Sbjct  340  SLLLTEEGRGKACAHALAVPVLVKKMQHVSEMATEFAVSALWRLCKSFSGEGPCKAEALQ  399

Query  208  AGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  50
             G   +LLLL+Q  C    K +A  LL+LL         G  D   C   V F
Sbjct  400  LGAFQKLLLLLQVGCMGVTKERASELLRLL--------NGSRDGVECIETVDF  444



>gb|KDO79762.1| hypothetical protein CISIN_1g044095mg [Citrus sinensis]
Length=308

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 2/144 (1%)
 Frame = -1

Query  502  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  323
            ALCLA+  R  AV AGAV A+I+ + + D    ERALA +EL+C +  G     AHAL V
Sbjct  163  ALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAV  222

Query  322  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRK  143
            P++V ++ +++ R  EYA   L  I    +Q    A    V   + L +Q +CT R +RK
Sbjct  223  PVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRK  282

Query  142  AQMLLKLLRDCWPEDFTGISDDYN  71
               LLK L++    D T   D+ N
Sbjct  283  GTQLLKSLKEYGQPDTT--QDEMN  304



>ref|XP_008393879.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase PUB23 
[Malus domestica]
Length=330

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 81/145 (56%), Gaps = 5/145 (3%)
 Frame = -1

Query  532  ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGC  353
            A K   K L ALCLA+  RH AV +GA  A+++   + +   AER+LA +EL+C +  G 
Sbjct  185  AAKPATKILLALCLAEGNRHVAVESGAAAAVVETALELEAASAERSLAALELMCTVAEGA  244

Query  352  AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLL----  185
            AA  AHA+ VP++V I+ + S R  EYA G L  I    +  Q   A A    + +    
Sbjct  245  AAVRAHAMAVPVMVMIMGRTSARGXEYAIGVLAVIYGGGDDEQAAEAVAAAPPEEVARAV  304

Query  184  -LLVQSDCTERAKRKAQMLLKLLRD  113
             L +Q DC+ R +RK   LLK+L++
Sbjct  305  ELALQGDCSGRGRRKGAQLLKVLQE  329



>ref|XP_006841078.2| PREDICTED: U-box domain-containing protein 4 [Amborella trichopoda]
Length=423

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 91/180 (51%), Gaps = 7/180 (4%)
 Frame = -1

Query  616  ELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALI  437
            E RA I  A  I E +V +L   L   R  K    ALF LC  ++ + +AV AGAV+ LI
Sbjct  251  ENRAPIGCAGAI-EPLVNLL--ALGSFRGKKDAAAALFTLCSVRENKLRAVKAGAVKPLI  307

Query  436  DRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGAL  257
            + + DF     E+A   +++L  I    AA       +P+LV+II   SHR  E+A G L
Sbjct  308  EYMADFSSGMLEKAALVLDVLVGIREAKAAVVEEG-GIPVLVEIIEVGSHRQKEFAVGIL  366

Query  256  LSICsaseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDD  77
            L +C  S   +   A  G +  L+ L Q+  T RA++KA+ L+  LR   P      SDD
Sbjct  367  LQLCEESSVYRTLVAREGAIPPLVALSQNGTT-RARQKAETLIPFLRQ--PRSGFHRSDD  423



>ref|XP_003564002.1| PREDICTED: U-box domain-containing protein 21 [Brachypodium distachyon]
Length=449

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 101/199 (51%), Gaps = 4/199 (2%)
 Frame = -1

Query  706  LVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRAL  527
            LVS+LS+  +  R ++A ++  V S          IS A  + + +VG++  P+S  +A 
Sbjct  230  LVSVLSHGDLAARASAAIVLREVASSAADRATVEAISRAPGMCDALVGLVRNPVS-PQAT  288

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  347
            K  +   + L   +    +    G V  L + L D DK  +E+ALA ++ +    +G  +
Sbjct  289  KAALVTAYYLASDRAAASRFAELGVVSVLAELLVDADKGTSEKALAALDGVLCADAGLES  348

Query  346  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr---eaaaAGVMTQLLLLV  176
              AHAL VP+LVK + ++S  ATE+A  AL  +C A   A     EA   G   +LLLL+
Sbjct  349  ARAHALVVPVLVKKMFRVSDMATEFAVSALWRLCHAGADAGACRVEALRVGAFQKLLLLL  408

Query  175  QSDCTERAKRKAQMLLKLL  119
            Q  C    K +A  LLKLL
Sbjct  409  QVGCGGPTKERASELLKLL  427



>emb|CDX78096.1| BnaA09g32910D [Brassica napus]
Length=389

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  209  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  267

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            ++   E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  268  ERRTLEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRF  327

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+    ++    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  328  CATPSLLQDMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  375



>emb|CDX95337.1| BnaC04g28210D [Brassica napus]
Length=409

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGA----VEALIDRLQDF  419
            E+F  +V IL+  +S+ +A K  ++ L   C   + RHKAV AGA    +E L+D     
Sbjct  229  ELFTEVVQILHDQISH-KATKSAMQILMITCPWGRNRHKAVEAGAASMIIELLLDESFSS  287

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            ++ + E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLS+   
Sbjct  288  ERRNVEMAMVVLDVLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRF  347

Query  238  seq--aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
                   +E    GV+ +L L++Q+ C  + K KA+ LLKL    W E
Sbjct  348  CATPCLLQEMLQLGVVAKLCLVLQASCGNKTKEKAKELLKLHARVWRE  395



>emb|CDY59599.1| BnaCnng35300D [Brassica napus]
Length=409

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  229  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  287

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            ++   E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  288  ERRTLEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRF  347

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+    ++    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  348  CATPSLLQDMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  395



>ref|XP_004502944.1| PREDICTED: U-box domain-containing protein 25-like [Cicer arietinum]
Length=398

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 117/227 (52%), Gaps = 6/227 (3%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  587
            +P+   E + +  D  ++   + L    +  ++ +   LI+   + +++ E+   + N+ 
Sbjct  170  LPIVNLEPLNIIKDESKLEIFMLLFEKGTSSIKTSLCVLIDYSTTSSQTEEVCHVLGNSQ  229

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD---  416
            ++   IV ++N   + S   K  +KAL ALC  +  R   V AGA++ +I  + + +   
Sbjct  230  KLVHEIVQVVN--QNCSEVSKAAIKALSALCSLQSNRESLVRAGAIDGIITYISECETRH  287

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsa  239
            K  A   +AT++ L  + S   A   +   V  LVK++ K+ +   +E A G L  +C  
Sbjct  288  KNLAPLGMATMKKLLVLDSAKEALVNNPKGVESLVKMVFKVCNQECSESAVGILSIVCCD  347

Query  238  seqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  98
               A+ EA  AGV+TQLL L+QS C  + K KA++LLKLLR  W E+
Sbjct  348  FGSAREEAIGAGVLTQLLFLLQSQCGTKTKTKARLLLKLLRSKWSEE  394



>ref|XP_011031181.1| PREDICTED: U-box domain-containing protein 25-like isoform X2 
[Populus euphratica]
 ref|XP_011031182.1| PREDICTED: U-box domain-containing protein 25-like isoform X2 
[Populus euphratica]
Length=330

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 121/220 (55%), Gaps = 7/220 (3%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            E E + + ++  ++     L    +  ++ +   +IE++ S   + EL A++    ++ +
Sbjct  113  EYEYLNMLNEESKLESFQVLFDQGTGKIKRSLCQVIEAISSSLETRELCAKLGKNRKLLK  172

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE--  401
            G++ +++     S A   G+KA+ ALC  +  R   V  G +  L+  + D ++ +    
Sbjct  173  GLILLVHQTHEASDA---GIKAISALCCLESNRQNLVQEGVINRLLTYIFDAERHERNLT  229

Query  400  -RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqa  227
             +AL+T+ELL  + S  AA   +   +  L+K++ + S H  +E A  +L  IC+ S QA
Sbjct  230  PKALSTIELLLELESAKAALINNPNGIKALIKMVFRFSEHEGSESAVQSLTIICTDSLQA  289

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  107
            + EA  AGV+TQLLLL+QS C+ R K KA+MLLKLLR  W
Sbjct  290  RDEAIGAGVLTQLLLLLQSQCSARTKTKARMLLKLLRSRW  329



>ref|XP_009115945.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Brassica rapa]
Length=435

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  255  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  313

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            ++   E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  314  ERRTLEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRF  373

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+    ++    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQDMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>ref|XP_009395651.1| PREDICTED: U-box domain-containing protein 30-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=455

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 106/212 (50%), Gaps = 5/212 (2%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            ++E++     P ++  +V +L+  +   ++  A  IE VL G  S   R +I ++  +  
Sbjct  227  DSEAMTDLMQPAKISLVVDMLNEGTTKTKIQCARFIE-VLMGAES--FRFEIVSSLSLLV  283

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            G+V ++         +  G+  L  +C   Q R   V+  AV  L++RL D      E A
Sbjct  284  GLVRMVK-DKREPDGVSAGLSLLKTICSHDQVRSSIVSIRAVAQLVERLPDLSPNSLESA  342

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas-eqaqre  218
            L  ++ L  IP G +A      T+P  V+ ++K+S   T +A   L ++C  + E+    
Sbjct  343  LQILDDLAAIPDGRSALKDCPQTIPNTVRPLMKVSEACTRHALSILWAVCKLAPEEFVYL  402

Query  217  aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
            A  AG+ T+LLL++QSDC    K++A  LLKL
Sbjct  403  AVEAGLATRLLLVIQSDCPPELKKQASDLLKL  434



>ref|XP_010505120.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Camelina sativa]
Length=416

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  236  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  294

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  295  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  354

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  355  CATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>ref|XP_011031180.1| PREDICTED: U-box domain-containing protein 25-like isoform X1 
[Populus euphratica]
Length=390

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 121/220 (55%), Gaps = 7/220 (3%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            E E + + ++  ++     L    +  ++ +   +IE++ S   + EL A++    ++ +
Sbjct  173  EYEYLNMLNEESKLESFQVLFDQGTGKIKRSLCQVIEAISSSLETRELCAKLGKNRKLLK  232

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE--  401
            G++ +++     S A   G+KA+ ALC  +  R   V  G +  L+  + D ++ +    
Sbjct  233  GLILLVHQTHEASDA---GIKAISALCCLESNRQNLVQEGVINRLLTYIFDAERHERNLT  289

Query  400  -RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqa  227
             +AL+T+ELL  + S  AA   +   +  L+K++ + S H  +E A  +L  IC+ S QA
Sbjct  290  PKALSTIELLLELESAKAALINNPNGIKALIKMVFRFSEHEGSESAVQSLTIICTDSLQA  349

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  107
            + EA  AGV+TQLLLL+QS C+ R K KA+MLLKLLR  W
Sbjct  350  RDEAIGAGVLTQLLLLLQSQCSARTKTKARMLLKLLRSRW  389



>ref|XP_010516800.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  236  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  294

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  295  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  354

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  355  CATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>ref|XP_010509533.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  236  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  294

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  295  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  354

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  355  CATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>gb|KFK36486.1| hypothetical protein AALP_AA4G130900 [Arabis alpina]
Length=412

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  +V IL+  +S+ +A+K  +  L  +C   + RHKAV A A+  +I+ L D     
Sbjct  232  EVFIEVVQILDDQISH-KAMKAAMHILVNICPWGRNRHKAVDAAAISVIIELLMDESFSS  290

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            ++   E AL  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  291  ERRGPEMALVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  350

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+     E    GV+ ++ L++Q  C  + K KA+ LLKL    W +
Sbjct  351  CATPNLLNEMLQLGVVAKMCLVLQVSCGSKTKDKAKELLKLHARVWKD  398



>ref|XP_010444614.1| PREDICTED: U-box domain-containing protein 31-like [Camelina 
sativa]
Length=448

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 103/206 (50%), Gaps = 13/206 (6%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P RV  +V +LS+ S++ ++N A LI  ++        RA++ ++  +  G++ ++    
Sbjct  230  PARVSLMVDMLSDGSIETKINCARLIWRLV---EEKSFRAELVSSHSLLVGLMRLVK---  283

Query  544  SYSRALKIGVKA----LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVEL  377
               R  + GV      L ++ + KQ R+  V  GAV  L+D L   D    E AL  ++ 
Sbjct  284  --DRRRRNGVSPALTLLKSVSVHKQVRNLMVKVGAVPQLVDVLPCLDPESLESALFVLDS  341

Query  376  LCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaAGV  200
            LC    G  A      T+P  V++++++S + T YA   L S+C  + +     A   G+
Sbjct  342  LCLESEGRIALKDSVNTIPNTVRLLMRVSEKCTNYAISILWSVCKLASEECSSLAVEVGL  401

Query  199  MTQLLLLVQSDCTERAKRKAQMLLKL  122
              +LLL++QS C    K+++  LLKL
Sbjct  402  AAKLLLVIQSGCDPALKQRSAELLKL  427



>ref|XP_009125026.1| PREDICTED: U-box domain-containing protein 4 [Brassica rapa]
Length=344

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 1/140 (1%)
 Frame = -1

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  356
            RA K    AL++LC AK+ + +AV AG ++ L++ + DF     +++   + LL  +P  
Sbjct  199  RAKKDASTALYSLCSAKENKIRAVEAGIMKPLVELMADFGSNMVDKSAFVMSLLMSVPES  258

Query  355  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLV  176
             AA       VP+LV+I+   + R  E A   LL IC  S   +   A  G +  L+ L 
Sbjct  259  KAAVVEEG-GVPVLVEIVEDGTQRQKEMAVSILLQICEESVVYRTMVAREGAIPPLVALS  317

Query  175  QSDCTERAKRKAQMLLKLLR  116
            Q+  T RAK KA+ L++LLR
Sbjct  318  QAGGTSRAKHKAEALIELLR  337



>ref|XP_007225763.1| hypothetical protein PRUPE_ppa005536mg [Prunus persica]
 gb|EMJ26962.1| hypothetical protein PRUPE_ppa005536mg [Prunus persica]
Length=456

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 109/211 (52%), Gaps = 5/211 (2%)
 Frame = -1

Query  751  AESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  572
            +E+  +   P ++  +V +L+  S++ ++N   LIE ++ G    +L ++  ++  +  G
Sbjct  229  SEAKTILMQPAKISLMVDMLNEGSIETKINCTKLIEVLMEGK---DLESENVSSLSLVVG  285

Query  571  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            ++ ++     +   +  G+  L  +C  +  R+  V+ GAV  LI+ L + +    E AL
Sbjct  286  LLRLVK-DKRHCNGVLPGLSLLKTICSHESVRNSVVSVGAVPQLIELLPNLNHECLELAL  344

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qrea  215
              +E+L  +P G  A      T+P +V++++K+S   T+ A   L ++C  +       A
Sbjct  345  HILEVLSTLPEGRQALKDCPKTIPCVVRLLMKVSESCTQLALSILWAVCKLAPDECASLA  404

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
              AG+  +LLL++QS C    K++A  LLKL
Sbjct  405  VEAGLAAKLLLVIQSGCNPVLKQRAAELLKL  435



>ref|XP_010541260.1| PREDICTED: formin-binding protein 4 [Tarenaya hassleriana]
Length=313

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 88/160 (55%), Gaps = 2/160 (1%)
 Frame = -1

Query  565  GILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  389
            G++ C  +  R A K   K+L ALCLA+  R  AV AGA  A+++ +   +   AERALA
Sbjct  150  GLVRCLRTTDRSAAKHASKSLLALCLAESNRRVAVEAGAAGAVVETVAGLEDASAERALA  209

Query  388  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa  209
             +EL+C +P G A    HA+TVP++V ++ +++ R  EYA   L  +     +    AA 
Sbjct  210  ALELVCTVPEGAAEVRTHAMTVPVMVAVMARLAGRGREYAMSILAVVYGGGGEEIPAAAP  269

Query  208  AGVMTQLL-LLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  92
            A  + + + L +Q +CT R +RK   LLK L +    D +
Sbjct  270  AEEVARAVALALQGECTARGRRKGAQLLKTLEEYGRSDLS  309



>ref|XP_010271201.1| PREDICTED: U-box domain-containing protein 21-like [Nelumbo nucifera]
Length=443

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 112/227 (49%), Gaps = 16/227 (7%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSG-TRSPELRAQISNA  590
            +PL ++E+    + P  +  +V  L++ S+  R N+  +++ +LS   +   L A+I  A
Sbjct  200  LPL-DSEAQSYLASPASLRCMVWFLNSGSLSGRQNAVLVLKELLSSDQKHVSLLAEIEGA  258

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALC----LAKQYRHKA--VTAGAVEALIDRL  428
            ++    ++    CP     A K  + A+F +     L+   R K+  V  G V  L+D L
Sbjct  259  NQALVKLIKEPICPT----ATKASLVAIFQMVSPSNLSSSDRIKSGFVEMGLVSLLLDIL  314

Query  427  QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI  248
             D DK   E+AL  ++ LC          ++ALT+P+LVK IL+IS  ATE++   L  +
Sbjct  315  VDSDKSLCEKALGVLDGLCSCQEAREKAYSNALTMPVLVKKILRISDLATEFSVSILWKL  374

Query  247  Csase----qaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
            C            EA   G   +LLLL+Q  C E  K KA  LLKLL
Sbjct  375  CKNRNPDEGSIVIEALQVGAFQKLLLLLQVGCGEGTKEKATELLKLL  421



>ref|XP_009390871.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=433

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 115/224 (51%), Gaps = 13/224 (6%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLS--GTRSPELRAQISN  593
            +PL E  +  + S P  +  LVS+L    V  R+++A  ++ +L+  G R+      I+ 
Sbjct  192  LPLDEEAAACIGSSPESLKRLVSVLRCGDVAARLHAALTVKELLASGGARAD----AIAA  247

Query  592  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLA-KQYRHKAVTAGAVEALIDRLQDFD  416
               + E +V ++  P+S SRA+K  + ++F +  + ++   + V  G V  L++ L D +
Sbjct  248  TKGMGEALVKLVKRPIS-SRAMKASLVSIFYMVNSDEKTATRIVDLGLVPVLVEILVDDE  306

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  236
            K   E+ALA ++ L     G      HALTVP+L K + ++S  ATE+   AL  +C   
Sbjct  307  KSMCEKALAVLDGLLSCERGRENACGHALTVPVLAKKMFRVSDMATEFVVSALWKLCKDH  366

Query  235  eqaqre-----aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
            +   RE     A  AG   +LLLL+Q  C E  K +   LL+LL
Sbjct  367  KGGGRERCLLDALQAGTFHKLLLLLQVGCGEATKERVTDLLRLL  410



>ref|XP_009375140.1| PREDICTED: U-box domain-containing protein 30-like [Pyrus x bretschneideri]
Length=442

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/245 (27%), Positives = 119/245 (49%), Gaps = 19/245 (8%)
 Frame = -1

Query  751  AESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  572
            +ES      P +V  +V +L+  S++ ++N   LIE ++ G    +L ++  ++  +  G
Sbjct  215  SESRTSLLQPAKVSLMVDMLNEGSIETKINCTKLIEVLMEGK---DLESENVSSLSLVVG  271

Query  571  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            ++ ++    + +  L  G+  L  +C  +  R+  V+ GAV  LI+ L   +    E AL
Sbjct  272  LLRLVKDKRNPNGVLP-GLSLLKTICSHESVRNSVVSVGAVPQLIELLPGLNHECLEIAL  330

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qrea  215
              +E+L  +P G  A      T+P +V++++K+S   T+ A   L ++C  +       A
Sbjct  331  HVLEVLSTLPEGRQALKDCPKTIPSVVRLLMKVSESCTQLALSVLWAVCKLAPDECASLA  390

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF*SYCY  35
              AG+  +LLL++QS C    K++A  LLKL            S +Y  ++   F S C 
Sbjct  391  VEAGLAAKLLLVIQSGCNPELKQRAAELLKL-----------CSLNYTATH---FISKCK  436

Query  34   ILRNI  20
            + R I
Sbjct  437  LTRTI  441



>ref|XP_009396054.1| PREDICTED: U-box domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 81/147 (55%), Gaps = 2/147 (1%)
 Frame = -1

Query  538  SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPS  359
            SR  K  +  L+ LC A++ + +AV+AGAV  L++ + +     AE+AL  +  L  +P 
Sbjct  295  SRGKKDALTTLYKLCSARRNKERAVSAGAVPPLVELVAERGGGTAEKALVVLGSLAAVPE  354

Query  358  GCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLL  179
            G AA    A  +P+LV  +     R  E+A  ALL +C+ SE+ +      GV+  L+ L
Sbjct  355  GRAAV-VEAGGIPVLVDAVEAGPTRGREFAVHALLQLCADSERNRGLVVGEGVIPPLVAL  413

Query  178  VQSDCTERAKRKAQMLLKLLRDCWPED  98
             Q+  + RAK KA+ LL+ LR+   +D
Sbjct  414  SQTGSS-RAKHKAETLLRFLREQRQDD  439



>ref|XP_002524056.1| Spotted leaf protein, putative [Ricinus communis]
 ref|XP_002524059.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38266.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38269.1| Spotted leaf protein, putative [Ricinus communis]
Length=413

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 105/206 (51%), Gaps = 7/206 (3%)
 Frame = -1

Query  715  VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYS  536
            +  L  ++ N + + R  +  L++S L      +L   +S   E+F  IV +L+  +S+ 
Sbjct  196  IQSLTRVMQNGNYESRAYAVLLLKSALEVADPMQL---VSLRPELFVEIVQVLSDQISH-  251

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAERALATVELLCRIPS  359
            +A K  ++ L  LC   + R KA  A AV  LID L D  +K   E ALA ++LLC+   
Sbjct  252  QASKAALQLLINLCPWGRSRLKATEAKAVSTLIDLLLDSSEKRTCEMALAVLDLLCQCAE  311

Query  358  GCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr--eaaaAGVMTQLL  185
            G A    H   + ++ K IL++S  A+E A   LLSI   S  +    E    GV+ +L 
Sbjct  312  GRAELLKHGAGLAVVSKKILRVSQVASEKAVRILLSISKFSATSTVLHEMLQIGVVAKLC  371

Query  184  LLVQSDCTERAKRKAQMLLKLLRDCW  107
            L++Q DC  + K KA+ +LKL    W
Sbjct  372  LVLQVDCGSKGKDKAREVLKLHARAW  397



>ref|XP_010541793.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Tarenaya hassleriana]
Length=433

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 86/166 (52%), Gaps = 7/166 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  407
            EIF  +  IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  253  EIFTEVFQILHDQISH-KATKSALQILVNICPWGRNRHKAVEAGAISVIIELLMDETFSS  311

Query  406  AERALATV----ELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
              R +  V    +LLC+   G A F  H   + ++ K IL++S  A+E A   LLS+   
Sbjct  312  VRRIIEMVMVVLDLLCQCAEGRAEFLNHGAAIAVVSKKILRVSQTASERAVRVLLSVGRF  371

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  107
             A+    +E    GV+ +L L++Q  C  + K KA+ LL+L    W
Sbjct  372  CATASLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLRLHARVW  417



>ref|XP_004503116.1| PREDICTED: U-box domain-containing protein 21-like [Cicer arietinum]
Length=435

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 103/217 (47%), Gaps = 13/217 (6%)
 Frame = -1

Query  751  AESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  572
             E+ + F +   +  LV  L    +  R NS  L+E VL          +++  + + EG
Sbjct  207  GETKLCFGNQASLRCLVWFLDGKDLGARQNSVFLLEEVLC-------VDELATIEGVVEG  259

Query  571  IVGILNCPLSYSRALKIGVKALFALCLAKQYR----HKAVTAGAVEALIDRLQDFDKCDA  404
            +V I+  P+  S A K  +  +F L  + + R     K V  G V  L++ + D ++   
Sbjct  260  LVKIIKEPIGLS-ATKACLSTIFNLVSSCKNRVEISEKLVELGLVSFLLETIVDGERGVI  318

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq-a  227
            E+AL  +  LC    G      +ALT+PL+VK IL++S  A+ +A G +  +C   E+  
Sbjct  319  EKALGVLNCLCDCKKGKEVVKMNALTLPLVVKKILRVSPLASSFAVGIVRKMCEKKEEGI  378

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLR  116
              EA   G   +LL+++Q  C E  K     LLKLL 
Sbjct  379  LIEALQLGAFQKLLVMLQVGCEENTKENTTELLKLLN  415



>gb|ACF88418.1| unknown [Zea mays]
 tpg|DAA44319.1| TPA: immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=447

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 117/227 (52%), Gaps = 16/227 (7%)
 Frame = -1

Query  766  VPLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLS-GTRSPELRAQISNA  590
            +PL E ES    + P  +G LV++  N S+  R+N+   I+ V+S    + +L  +   A
Sbjct  203  MPLDE-ESARTLALPTSLGSLVAIAENGSLAGRLNAVLAIKEVVSCDGAATDLSGK---A  258

Query  589  DEIFEGIVGILNCPLSYSRALKIGVKALFALCL-AKQYRHKAVTAGAVEALIDRLQDFDK  413
            DEI + +  I+  P+   +A K G+ A + L L  ++   +   AG V  L++ L D DK
Sbjct  259  DEIVDALAKIIKSPIC-PQATKAGMVATYHLALYDERVAARLAAAGLVPVLVEVLVDADK  317

Query  412  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  233
              +E+ALA ++ +     G A+  AHAL VP+L+K + ++S  AT+ A  A+  +  A  
Sbjct  318  SMSEKALAVLDAVLASEEGRASARAHALAVPMLIKKMFRVSDLATQLAVSAMWRLGKAHS  377

Query  232  qaqreaaaA---------GVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
              + + A           G   +LLLL+Q  C +  K KA  LLKLL
Sbjct  378  DGEDDGAVTRCLVEALGVGAFQKLLLLLQVGCRDATKEKATELLKLL  424



>ref|XP_009139452.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Brassica rapa]
Length=424

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            ++F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGAV  +I+ L D     
Sbjct  244  DLFNEVVQILHDQISH-KATKSAMQILMIICPWGRNRHKAVEAGAVSMIIELLLDESFSS  302

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  239
            ++ + E  +  +++LC+   G A F  H   + ++ K IL++S   +E AA  LLS+   
Sbjct  303  ERRNVEMTMVVLDMLCQCAEGRADFLNHGAAIAVVSKKILRVSQITSERAARVLLSVGRF  362

Query  238  seq--aqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
                   +E    GV+ +L L++Q  C  + K KA+ LL+L    W E
Sbjct  363  CATPCLLQEMLQLGVVAKLCLVLQVSCGNKTKGKAKELLQLHARVWRE  410



>ref|XP_008784119.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=419

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 101/203 (50%), Gaps = 7/203 (3%)
 Frame = -1

Query  706  LVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRAL  527
            L ++L   +   R ++  LI+S+LS      L+     + E+F  +V +L   +SY  A 
Sbjct  205  LATILRRSNYQSRTHAMLLIKSLLSVMAPARLKG---FSKELFGEVVKVLRDQISYP-AT  260

Query  526  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA-ERALATVELLCRIPSGCA  350
            K  V+ L  L    + R KAV AGAV  +I+ L D  +  A E  L  ++ LCR   G A
Sbjct  261  KAAVQVLGGLSPWGRNRVKAVEAGAVRVVIELLLDKTERRACEMMLVVLDQLCRCAEGRA  320

Query  349  AFAAHALTVPLLVKIILKISHRATEYAAGALLSIC--saseqaqreaaaAGVMTQLLLLV  176
                HA  + ++ K +L++S  A+E   G L S    S +    +E    G + +L +L+
Sbjct  321  EMVGHAAGIAVVTKKLLRVSRVASERVVGILYSAARFSPTRAVLQEMKQVGAVAKLCMLL  380

Query  175  QSDCTERAKRKAQMLLKLLRDCW  107
            Q DC E+AK K + +L+L    W
Sbjct  381  QVDCGEKAKEKVKEMLRLHSKVW  403



>gb|EPS58757.1| hypothetical protein M569_16054 [Genlisea aurea]
Length=317

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 86/158 (54%), Gaps = 5/158 (3%)
 Frame = -1

Query  571  IVGILNC-PLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
            + G+++C     + A +   K L AL LA++ R  AV AGAV A+++ L D +   AER+
Sbjct  146  MAGVVSCLREGGAAARRSASKVLLALSLAEENRRVAVEAGAVTAVVEALADAETAAAERS  205

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  215
            LA +ELLC    G A   AHAL+VP++V+++ K+  R  E+A   L  I   S       
Sbjct  206  LAALELLCTTAEGAAEVRAHALSVPMMVQVMGKMEARGKEHALSVLGVIYGGSRSESESD  265

Query  214  aaAG----VMTQLLLLVQSDCTERAKRKAQMLLKLLRD  113
             A      V   ++L +Q +C+ R +RK   LLK L++
Sbjct  266  VAVAPAEEVARAVMLALQGECSARGRRKGAQLLKTLQE  303



>ref|XP_008393710.1| PREDICTED: U-box domain-containing protein 30-like [Malus domestica]
 ref|XP_008351967.1| PREDICTED: U-box domain-containing protein 30-like [Malus domestica]
Length=453

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 108/211 (51%), Gaps = 5/211 (2%)
 Frame = -1

Query  751  AESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  572
            +ES      P +V  +V +L+  S++ ++N   LIE ++ G    +L A+  ++  +  G
Sbjct  226  SESRTSLMQPAKVSLMVDMLNEGSIETKINCTKLIEVLMEGK---DLEAENVSSLSLVVG  282

Query  571  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            ++ ++    + +  L  G+  L  +C  +  R+  V+ GAV  LI+ L   +    E AL
Sbjct  283  LLRLVKDKRNPNGVLP-GLSLLKTICSHESVRNSVVSVGAVPQLIELLPGLNHECLEIAL  341

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qrea  215
              +E+L  +P G  A      T+P +V++++K+S   T+ A   L ++C  +       A
Sbjct  342  HVLEVLSTLPEGRQALKDCPKTIPSVVRLLMKVSESCTQLALSILWAVCKLAPDECASLA  401

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKL  122
              AG+  +LLL++QS C    K++A  LLKL
Sbjct  402  VEAGLAAKLLLVIQSGCNPVLKQRAAELLKL  432



>emb|CDY28679.1| BnaCnng05650D [Brassica napus]
Length=263

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 1/141 (1%)
 Frame = -1

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  356
            RA K    AL++LC AK+ + +AV +G ++ L++ + DF     +++   + LL  +P  
Sbjct  118  RAKKDASTALYSLCSAKENKIRAVESGIMKPLVELMADFGSNMVDKSAFVMSLLMSVPES  177

Query  355  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaAGVMTQLLLLV  176
             AA       VP+LV+I+   + R  E A   LL IC  S   +   A  G +  L+ L 
Sbjct  178  KAAVVEEG-GVPVLVEIVEDGTQRQKEMAVSILLQICEESVVYRTMVAREGAIPPLVALS  236

Query  175  QSDCTERAKRKAQMLLKLLRD  113
            Q+  T RAK KA+ L++LLR 
Sbjct  237  QAGGTSRAKHKAEALIELLRQ  257



>ref|XP_008345702.1| PREDICTED: U-box domain-containing protein 30-like [Malus domestica]
Length=440

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 119/245 (49%), Gaps = 19/245 (8%)
 Frame = -1

Query  751  AESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  572
            +ES      P +V  +V +L+  S++ ++N   LIE ++ G    +L ++  ++  +  G
Sbjct  213  SESRTSLKQPAKVSLMVDMLNEGSIETKINCTKLIEVLMEGK---DLESENVSSLSLVVG  269

Query  571  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  392
            ++ ++    + +  L  G+  L  +C  +  R+  V+ GAV  LI+ L   +    E AL
Sbjct  270  LLRLVKDKRNPNGVLP-GLSLLKTICSHESVRNSVVSVGAVPQLIELLPGLNHECLEIAL  328

Query  391  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qrea  215
              +E+L  +P G  A      T+P +V+I++K+S   T+ A   L ++C  +       A
Sbjct  329  HVLEVLSTLPEGRQALKDCPKTIPSVVRILMKVSESCTQLALSVLGAVCKLAPDECAPLA  388

Query  214  aaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF*SYCY  35
              AG+  +LLL++QS C    K++A  LLKL            S +Y  ++   F S C 
Sbjct  389  VEAGLAAKLLLVIQSGCNPVLKQRAAELLKL-----------CSLNYTATH---FISKCK  434

Query  34   ILRNI  20
            + R I
Sbjct  435  LTRTI  439



>ref|XP_010503987.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Camelina sativa]
Length=263

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = -1

Query  586  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  419
            E+F  ++ IL+  +S+ +A +  ++ L  +C   + RHKAV AG +  +I+ L D     
Sbjct  83   ELFAEVLQILHDQISH-KATRSAMQILVIICPWGRNRHKAVEAGVISMIIELLMDETFSS  141

Query  418  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  242
            ++ + E A+  +++LC+   G + F  H   + L+ K IL++S   +E A   LLS+   
Sbjct  142  ERRNLEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILRVSQITSERAVRVLLSVGRF  201

Query  241  -aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  202  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  249



>gb|AEW09062.1| hypothetical protein CL3508Contig1_02, partial [Pinus radiata]
 gb|AFG50844.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50845.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50846.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50847.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50848.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50849.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50850.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50851.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50852.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50853.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50854.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50855.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50856.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50857.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
Length=117

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = -1

Query  403  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  224
            E  L  +E LCR   G AA A HAL VP++VK + + S  ATEYA GAL S+C       
Sbjct  11   EPCLCLLESLCRCAEGRAAVAGHALAVPVIVKKMSRSSSLATEYALGALWSVCGHCRSEN  70

Query  223  re--aaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLL----RDC  110
                AA +GV ++L  L+Q DCT +AK KA  L++L+    RDC
Sbjct  71   VHRYAAESGVCSKLFWLLQVDCTPKAKLKASDLIRLIHSTCRDC  114



>emb|CDX84168.1| BnaC04g09300D [Brassica napus]
Length=406

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 86/167 (51%), Gaps = 7/167 (4%)
 Frame = -1

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  416
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AG +  +I+ L D     D
Sbjct  227  VFTEVVQILDDRISH-KATKSALHILVNVCPWGRNRHKAVEAGVISMIIELLMDESFSSD  285

Query  415  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  242
            +   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   L S+    
Sbjct  286  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLFSVGRFC  345

Query  241  aseqaqreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  101
            A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  346  ATPALLNEMLQLGVVAKLCLVLQVSCGSKTKDKAKELLKLHARAWKE  392



>ref|XP_010279125.1| PREDICTED: U-box domain-containing protein 21-like [Nelumbo nucifera]
Length=440

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 103/216 (48%), Gaps = 6/216 (3%)
 Frame = -1

Query  754  EAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  575
            EA+S +    P+R   +V    +  +  R N+  +++ + S  R   L A+   A E   
Sbjct  205  EAQSYLGLPAPLRC--MVWFSKSGGLSGRQNAVLVLKELSSDQRHVSLLARTEGASEALV  262

Query  574  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  395
             ++    CP +   +L +  + + +   + + R + V    +  L+D L D DK   E+A
Sbjct  263  KLIKEPICPTATKASLVVIYRMVSSSVSSDKIRSRFVDMDLISLLLDILVDSDKSLCEKA  322

Query  394  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase----qa  227
            L  ++ LC          AHALT+P+LVK IL+IS  ATE+    L  +C   +      
Sbjct  323  LGVLDGLCSCQEAREKAYAHALTMPVLVKKILRISDLATEFTVSILWKLCKNKKIDEGSI  382

Query  226  qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
              EA   G   +LLLL+Q  C ER K KA  LLKLL
Sbjct  383  LVEALQVGAFQKLLLLLQVGCGERTKEKATELLKLL  418



>ref|XP_012074309.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Jatropha curcas]
 gb|KDP36106.1| hypothetical protein JCGZ_08750 [Jatropha curcas]
Length=417

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 105/206 (51%), Gaps = 7/206 (3%)
 Frame = -1

Query  715  VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYS  536
            +  L  +L N + + R  S  L++S+L      +L   I+   E+F  IV IL   +S+ 
Sbjct  200  IDSLTRILKNGNYESRAYSVLLLKSILEVADPIQL---INLRQELFVEIVQILRDQISH-  255

Query  535  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAERALATVELLCRIPS  359
            +A K  ++ L  LC   + R KAV A AV  LI+ L D  +K   E AL  ++L+C+   
Sbjct  256  QATKSSLRLLVNLCPWGRNRVKAVAANAVSVLINLLLDSSEKRVCEMALMVLDLVCQCAE  315

Query  358  GCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--reaaaAGVMTQLL  185
            G A    H   + ++ K IL++S  A+E A   LLSI   S      +E    GV+ +L 
Sbjct  316  GRAELLGHGAGLAVVSKKILRVSQVASEKAVRILLSISKFSATNNVLQEMLQIGVVAKLC  375

Query  184  LLVQSDCTERAKRKAQMLLKLLRDCW  107
            L++Q DC  + K KA+ +LKL    W
Sbjct  376  LVLQVDCGIKNKEKAREVLKLHARAW  401



>ref|XP_010547560.1| PREDICTED: U-box domain-containing protein 30 [Tarenaya hassleriana]
Length=452

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 104/202 (51%), Gaps = 5/202 (2%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P +V  +V +L++ S++ ++N A LI S++        RA++ ++  +  G++ ++    
Sbjct  234  PAKVSLMVDMLNDGSMETKINCAKLIGSLV---EEKGFRAELVSSHSLLVGLLRLVK-DK  289

Query  544  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  365
             +   +   ++ L ++ +  Q R+  V+ GAV  L+DRL   D    E AL  ++ LC  
Sbjct  290  RHKNGISPALRLLKSISVYDQVRNLMVSVGAVPQLVDRLPTLDPECLELALFVLDALCLS  349

Query  364  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaAGVMTQL  188
              G  A      T+P  V+I++++S   T YA   L  +C  + +     A  AG+  +L
Sbjct  350  LEGRVALKKSENTIPNTVRILMRVSENCTGYALSILWWVCKLAPEECSPLAIEAGLAAKL  409

Query  187  LLLVQSDCTERAKRKAQMLLKL  122
            LL++QS C    K+++  LLKL
Sbjct  410  LLVIQSGCDPALKQRSSELLKL  431



>gb|AAM61258.1| unknown [Arabidopsis thaliana]
Length=448

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 102/202 (50%), Gaps = 5/202 (2%)
 Frame = -1

Query  724  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  545
            P +V  +V +L++ S + ++N A LI  ++        RA++ ++  +  G++ ++    
Sbjct  230  PAKVSLIVDMLNDGSNETKINCARLIRGLV---EEKGFRAELVSSHSLLVGLMRLVK-DK  285

Query  544  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  365
             +   +   ++ L  + + KQ R   V+ GAV  L+D LQ  D    E AL  ++ LC  
Sbjct  286  RHRNGVSPALRLLKPISVHKQVRSLMVSIGAVPQLVDILQSLDPECLELALFVLDALCTD  345

Query  364  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaAGVMTQL  188
              G  A    A T+P  V++++++S   T YA   L S+C  + +     A   G+  +L
Sbjct  346  VEGRVAVKDSANTIPYTVRVLMRVSENCTNYALSILWSVCKLAPEECSPLAVEVGLAAKL  405

Query  187  LLLVQSDCTERAKRKAQMLLKL  122
            LL++QS C    K+++  LLKL
Sbjct  406  LLVIQSGCDAALKQRSAELLKL  427



>ref|XP_004953855.1| PREDICTED: U-box domain-containing protein 21-like [Setaria italica]
Length=454

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 111/224 (50%), Gaps = 15/224 (7%)
 Frame = -1

Query  763  PLPEAESVIVFSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  584
            PL E ES    + P  +  +VS+LS+     R ++A ++  + S + +  L A +S  D 
Sbjct  214  PLGE-ESRRHIASPASLNAVVSILSHGETTARASAAVVLREIASSSDAQCLDA-MSETDG  271

Query  583  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTA------GAVEALIDRLQD  422
            I + ++ +L  P+S  +A K  +   + L    Q   +A ++      G V+ L++ L D
Sbjct  272  IHDALIKLLEKPVS-PQATKAALVTAYYLV---QNTGRAASSRRLVELGMVQLLVELLVD  327

Query  421  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  242
             DK   E+ALA ++ L     G     AHAL VP+LVK +  +S  ATE+A  AL  +C 
Sbjct  328  ADKGMTEKALAVLDSLFLTEEGRGRAYAHALAVPVLVKKMQHVSDMATEFAVSALWRLCK  387

Query  241  aseqa---qreaaaAGVMTQLLLLVQSDCTERAKRKAQMLLKLL  119
                    + EA   G   +LLLL+Q  C    K +A  LL+LL
Sbjct  388  NFSGEGPCKAEALQVGAFQKLLLLLQVGCMGVTKERASELLRLL  431



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1538697559425