BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12517

Length=1047
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782686.1|  PREDICTED: uncharacterized protein LOC104231395    315   7e-103   Nicotiana sylvestris
ref|XP_009599114.1|  PREDICTED: uncharacterized protein LOC104094824    312   1e-101   Nicotiana tomentosiformis
ref|XP_006353858.1|  PREDICTED: uncharacterized protein LOC102598192    290   4e-93    Solanum tuberosum [potatoes]
ref|XP_004245046.1|  PREDICTED: uncharacterized protein LOC101267629    287   6e-92    Solanum lycopersicum
emb|CDP13472.1|  unnamed protein product                                279   6e-89    Coffea canephora [robusta coffee]
ref|XP_011081597.1|  PREDICTED: uncharacterized protein LOC105164607    261   1e-81    Sesamum indicum [beniseed]
ref|XP_010261896.1|  PREDICTED: uncharacterized protein LOC104600566    253   8e-79    Nelumbo nucifera [Indian lotus]
emb|CBI20725.3|  unnamed protein product                                251   8e-78    Vitis vinifera
ref|XP_002308522.1|  YGGT family protein                                250   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_002280034.3|  PREDICTED: uncharacterized protein LOC100242172    251   2e-77    Vitis vinifera
ref|XP_011019343.1|  PREDICTED: uncharacterized protein LOC105122118    250   2e-77    Populus euphratica
gb|KHG08512.1|  putative ycf19                                          249   8e-77    Gossypium arboreum [tree cotton]
ref|XP_007012427.1|  YGGT family protein                                248   1e-76    
gb|KJB07394.1|  hypothetical protein B456_001G019900                    247   6e-76    Gossypium raimondii
ref|XP_012077192.1|  PREDICTED: uncharacterized protein LOC105638080    245   1e-75    Jatropha curcas
gb|KJB07395.1|  hypothetical protein B456_001G019900                    245   1e-75    Gossypium raimondii
ref|XP_009414813.1|  PREDICTED: uncharacterized protein LOC103995830    243   1e-74    
ref|XP_008802450.1|  PREDICTED: uncharacterized protein LOC103716288    241   3e-74    Phoenix dactylifera
gb|EYU20294.1|  hypothetical protein MIMGU_mgv1a012313mg                241   8e-74    Erythranthe guttata [common monkey flower]
ref|XP_003522302.1|  PREDICTED: uncharacterized protein LOC100802756    235   6e-72    Glycine max [soybeans]
ref|XP_006452990.1|  hypothetical protein CICLE_v10009264mg             236   8e-72    Citrus clementina [clementine]
ref|XP_010420979.1|  PREDICTED: uncharacterized protein LOC104706478    234   3e-71    Camelina sativa [gold-of-pleasure]
ref|XP_007136887.1|  hypothetical protein PHAVU_009G082300g             233   4e-71    Phaseolus vulgaris [French bean]
ref|XP_006474498.1|  PREDICTED: uncharacterized protein LOC102618998    233   7e-71    Citrus sinensis [apfelsine]
ref|XP_010454454.1|  PREDICTED: uncharacterized protein LOC104736203    232   1e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010939914.1|  PREDICTED: uncharacterized protein LOC105058630    232   1e-70    Elaeis guineensis
ref|XP_010669316.1|  PREDICTED: uncharacterized protein LOC104886561    232   1e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001240890.1|  uncharacterized protein LOC100791676               231   2e-70    Glycine max [soybeans]
ref|XP_006288523.1|  hypothetical protein CARUB_v10001794mg             231   6e-70    Capsella rubella
ref|XP_010493251.1|  PREDICTED: uncharacterized protein LOC104770515    230   1e-69    Camelina sativa [gold-of-pleasure]
ref|XP_006400697.1|  hypothetical protein EUTSA_v10014336mg             230   2e-69    Eutrema salsugineum [saltwater cress]
gb|KFK26355.1|  hypothetical protein AALP_AA8G237700                    228   5e-69    Arabis alpina [alpine rockcress]
ref|XP_002874035.1|  YGGT family protein                                228   7e-69    
ref|NP_001142613.1|  uncharacterized protein LOC100274882               225   7e-68    
ref|XP_008445540.1|  PREDICTED: uncharacterized protein LOC103488523    225   1e-67    Cucumis melo [Oriental melon]
ref|XP_009362782.1|  PREDICTED: uncharacterized protein LOC103952817    224   2e-67    Pyrus x bretschneideri [bai li]
emb|CDY16604.1|  BnaC09g36690D                                          224   2e-67    Brassica napus [oilseed rape]
ref|XP_008220572.1|  PREDICTED: uncharacterized protein LOC103320643    224   2e-67    
ref|XP_002516142.1|  conserved hypothetical protein                     222   4e-67    
ref|XP_010520479.1|  PREDICTED: uncharacterized protein LOC104799578    223   7e-67    Tarenaya hassleriana [spider flower]
emb|CDX88822.1|  BnaA03g08270D                                          222   9e-67    
ref|XP_010047396.1|  PREDICTED: uncharacterized protein LOC104436351    223   1e-66    Eucalyptus grandis [rose gum]
emb|CDX70968.1|  BnaC03g10520D                                          222   1e-66    
ref|XP_009131841.1|  PREDICTED: uncharacterized protein LOC103856...    222   1e-66    Brassica rapa
ref|XP_004144214.1|  PREDICTED: uncharacterized protein LOC101210772    222   2e-66    Cucumis sativus [cucumbers]
ref|XP_003603213.1|  hypothetical protein MTR_3g105100                  221   3e-66    Medicago truncatula
ref|XP_009120708.1|  PREDICTED: uncharacterized protein LOC103845594    221   3e-66    Brassica rapa
ref|XP_008360949.1|  PREDICTED: uncharacterized protein LOC103424631    221   4e-66    Malus domestica [apple tree]
ref|XP_004501430.1|  PREDICTED: uncharacterized protein LOC101500659    220   4e-66    Cicer arietinum [garbanzo]
gb|ACJ84760.1|  unknown                                                 220   5e-66    Medicago truncatula
ref|NP_680180.1|  protein YLMG2                                         220   6e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131840.1|  PREDICTED: uncharacterized protein LOC103856...    218   4e-65    Brassica rapa
ref|XP_007224287.1|  hypothetical protein PRUPE_ppa019472mg             216   4e-65    
ref|XP_010098371.1|  Uncharacterized protein ycf19                      216   2e-64    Morus notabilis
ref|NP_001190356.1|  protein YLMG2                                      214   7e-64    
gb|ADE76935.1|  unknown                                                 211   1e-62    Picea sitchensis
ref|XP_006849690.1|  PREDICTED: uncharacterized protein LOC18439463     203   1e-59    Amborella trichopoda
ref|XP_004303461.1|  PREDICTED: uncharacterized protein LOC101299599    202   5e-59    Fragaria vesca subsp. vesca
ref|XP_004985502.1|  PREDICTED: uncharacterized protein LOC101785923    189   4e-54    Setaria italica
ref|XP_003558678.1|  PREDICTED: uncharacterized protein LOC100838421    188   7e-54    Brachypodium distachyon [annual false brome]
ref|XP_002468404.1|  hypothetical protein SORBIDRAFT_01g045330          187   2e-53    Sorghum bicolor [broomcorn]
ref|NP_001150770.1|  YGGT family protein                                187   3e-53    Zea mays [maize]
gb|EPS61278.1|  hypothetical protein M569_13520                         182   4e-53    Genlisea aurea
gb|AAO13463.1|  Hypothetical protein                                    180   1e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649495.1|  PREDICTED: uncharacterized protein LOC102707940    181   5e-51    Oryza brachyantha
gb|EEC74625.1|  hypothetical protein OsI_10244                          178   8e-50    Oryza sativa Indica Group [Indian rice]
ref|NP_001049150.1|  Os03g0178200                                       178   8e-50    
gb|EMT09865.1|  Putative protein ycf19                                  167   1e-46    
dbj|BAJ98539.1|  predicted protein                                      162   1e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR25393.1|  yggt family protein                                     157   2e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_001785227.1|  predicted protein                                  154   4e-42    
ref|XP_002946335.1|  hypothetical protein VOLCADRAFT_79012              157   6e-42    Volvox carteri f. nagariensis
ref|XP_002500318.1|  fanciful K+ uptake-b family transporter            154   2e-41    Micromonas commoda
ref|XP_002980605.1|  hypothetical protein SELMODRAFT_38262              150   8e-41    
ref|XP_001762561.1|  predicted protein                                  148   3e-40    
ref|XP_002976887.1|  hypothetical protein SELMODRAFT_38265              148   4e-40    
ref|XP_005849508.1|  hypothetical protein CHLNCDRAFT_20845              142   5e-37    Chlorella variabilis
ref|XP_003078529.1|  putative protein (ISS)                             136   2e-34    Ostreococcus tauri
ref|XP_007512897.1|  predicted protein                                  135   7e-34    Bathycoccus prasinos
ref|XP_003603214.1|  hypothetical protein MTR_3g105100                  125   1e-30    
ref|XP_008660483.1|  PREDICTED: uncharacterized protein LOC103639519    125   4e-30    Zea mays [maize]
ref|XP_008678606.1|  PREDICTED: YGGT family protein isoform X1          123   2e-29    
gb|AFW89486.1|  hypothetical protein ZEAMMB73_425125                    122   4e-29    
ref|XP_001702829.1|  predicted protein                                  120   9e-29    Chlamydomonas reinhardtii
ref|XP_005644916.1|  hypothetical protein COCSUDRAFT_8690               114   1e-27    Coccomyxa subellipsoidea C-169
ref|XP_003061862.1|  fanciful K+ uptake-b family                        106   7e-25    Micromonas pusilla CCMP1545
emb|CCI61384.1|  hypothetical protein (GL-P13hh marker)                 104   2e-24    Lens orientalis [ye bing dou]
ref|XP_001417118.1|  predicted protein                                  103   7e-24    Ostreococcus lucimarinus CCE9901
ref|XP_005705095.1|  YggT family protein                                103   7e-23    Galdieria sulphuraria
ref|XP_002180626.1|  predicted protein                                  104   1e-22    Phaeodactylum tricornutum CCAP 1055/1
gb|EJK55210.1|  hypothetical protein THAOC_25079                        108   4e-22    Thalassiosira oceanica
ref|XP_005824684.1|  hypothetical protein GUITHDRAFT_165419             100   1e-21    Guillardia theta CCMP2712
ref|XP_005535261.1|  hypothetical protein, conserved                  88.2    2e-17    Cyanidioschyzon merolae strain 10D
ref|WP_002763635.1|  MULTISPECIES: hypothetical protein               83.6    2e-16    Microcystis
ref|WP_002733084.1|  hypothetical protein                             83.2    2e-16    Microcystis aeruginosa
ref|WP_002766817.1|  hypothetical protein                             83.2    2e-16    Microcystis
ref|XP_005718586.1|  unnamed protein product                          85.5    3e-16    Chondrus crispus [carageen]
ref|WP_016516829.1|  YGGT family protein                              83.2    3e-16    Microcystis aeruginosa
ref|XP_010054052.1|  PREDICTED: uncharacterized protein LOC104442347  85.5    8e-16    Eucalyptus grandis [rose gum]
gb|KGG12495.1|  Cell division protein YlmG/Ycf19                      82.0    9e-16    Prochlorococcus sp. MIT 0601
ref|WP_045356251.1|  hypothetical protein                             81.6    1e-15    Microcystis aeruginosa
gb|ABK26868.1|  unknown                                               84.3    2e-15    Picea sitchensis
ref|WP_036903716.1|  membrane protein                                 80.9    2e-15    Prochlorococcus sp. MIT 0601
ref|XP_001772465.1|  predicted protein                                80.5    2e-15    
ref|XP_010923462.1|  PREDICTED: uncharacterized protein LOC105046547  83.2    3e-15    Elaeis guineensis
ref|WP_002777308.1|  hypothetical protein                             80.1    4e-15    Microcystis aeruginosa
ref|XP_001781061.1|  predicted protein                                80.5    6e-15    
ref|WP_012195402.1|  membrane protein                                 79.7    7e-15    Prochlorococcus marinus
ref|XP_006849595.1|  PREDICTED: uncharacterized protein LOC18439366   82.0    1e-14    Amborella trichopoda
ref|XP_010250069.1|  PREDICTED: uncharacterized protein LOC104592405  82.0    1e-14    Nelumbo nucifera [Indian lotus]
gb|AFG52305.1|  hypothetical protein 2_9683_02                        79.7    1e-14    Pinus taeda
gb|AFG52301.1|  hypothetical protein 2_9683_02                        79.7    1e-14    Pinus taeda
ref|XP_004242431.1|  PREDICTED: uncharacterized protein LOC101255803  81.3    2e-14    
ref|XP_002882528.1|  hypothetical protein ARALYDRAFT_478063           81.3    2e-14    
gb|AFG52303.1|  hypothetical protein 2_9683_02                        79.3    2e-14    Pinus taeda
ref|WP_009455432.1|  MULTISPECIES: hypothetical protein               78.2    2e-14    Fischerella
ref|XP_011080524.1|  PREDICTED: uncharacterized protein LOC105163...  81.3    2e-14    
gb|EPS74141.1|  hypothetical protein M569_00615                       79.7    2e-14    Genlisea aurea
ref|WP_017300298.1|  hypothetical protein                             78.2    2e-14    Nodosilinea nodulosa
ref|XP_011080523.1|  PREDICTED: uncharacterized protein LOC105163...  81.3    2e-14    Sesamum indicum [beniseed]
ref|WP_016869431.1|  hypothetical protein                             78.2    2e-14    Fischerella muscicola
gb|AFK49498.1|  unknown                                               77.0    2e-14    Medicago truncatula
ref|XP_011024561.1|  PREDICTED: uncharacterized protein LOC105125696  81.3    2e-14    Populus euphratica
gb|AFK43466.1|  unknown                                               80.9    2e-14    Lotus japonicus
ref|WP_016861183.1|  MULTISPECIES: hypothetical protein               77.8    2e-14    Hapalosiphonaceae
ref|NP_566307.1|  protein YLMG1-1                                     80.9    2e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531773.1|  PREDICTED: uncharacterized protein LOC100819562  80.1    3e-14    Glycine max [soybeans]
ref|XP_004144422.1|  PREDICTED: uncharacterized protein LOC101222332  80.5    3e-14    Cucumis sativus [cucumbers]
emb|CDP03954.1|  unnamed protein product                              80.5    3e-14    Coffea canephora [robusta coffee]
ref|WP_017309436.1|  hypothetical protein                             77.8    3e-14    Hapalosiphonaceae
ref|XP_009799559.1|  PREDICTED: uncharacterized protein LOC104245629  80.5    3e-14    Nicotiana sylvestris
ref|XP_009620301.1|  PREDICTED: uncharacterized protein LOC104112161  80.5    3e-14    Nicotiana tomentosiformis
ref|XP_004303819.1|  PREDICTED: uncharacterized protein LOC101314968  80.1    3e-14    Fragaria vesca subsp. vesca
gb|AAM66973.1|  unknown                                               80.5    3e-14    Arabidopsis thaliana [mouse-ear cress]
ref|WP_017662674.1|  hypothetical protein                             77.4    3e-14    Geitlerinema sp. PCC 7105
ref|XP_010092852.1|  Uncharacterized protein ycf19                    81.6    3e-14    Morus notabilis
ref|XP_002301821.2|  YGGT family protein                              80.5    4e-14    
ref|XP_009387199.1|  PREDICTED: uncharacterized protein LOC103974162  80.1    4e-14    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002263900.1|  PREDICTED: uncharacterized protein LOC100253131  79.7    4e-14    Vitis vinifera
ref|XP_006352658.1|  PREDICTED: uncharacterized protein LOC102587...  80.1    4e-14    Solanum tuberosum [potatoes]
ref|XP_010673289.1|  PREDICTED: uncharacterized protein LOC104889701  80.1    4e-14    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU40657.1|  hypothetical protein MIMGU_mgv1a013023mg              80.1    4e-14    Erythranthe guttata [common monkey flower]
ref|WP_008317950.1|  putative integral membrane protein               77.4    4e-14    Leptolyngbya sp. PCC 6406
ref|XP_009587816.1|  PREDICTED: uncharacterized protein LOC104085478  79.7    5e-14    Nicotiana tomentosiformis
ref|XP_010486296.1|  PREDICTED: uncharacterized protein LOC104764458  80.1    5e-14    Camelina sativa [gold-of-pleasure]
ref|XP_002527246.1|  conserved hypothetical protein                   80.1    5e-14    Ricinus communis
ref|XP_011089625.1|  PREDICTED: uncharacterized protein LOC105170526  80.1    5e-14    Sesamum indicum [beniseed]
gb|KJB42572.1|  hypothetical protein B456_007G159100                  80.1    5e-14    Gossypium raimondii
ref|XP_010438523.1|  PREDICTED: uncharacterized protein LOC104722113  79.7    5e-14    Camelina sativa [gold-of-pleasure]
ref|XP_010438522.1|  PREDICTED: uncharacterized protein LOC104722112  79.7    5e-14    Camelina sativa [gold-of-pleasure]
ref|XP_008786168.1|  PREDICTED: platelet glycoprotein Ib alpha ch...  80.5    5e-14    Phoenix dactylifera
ref|XP_007049612.1|  YGGT family protein                              79.7    5e-14    
ref|XP_002265251.1|  PREDICTED: uncharacterized protein LOC100251416  80.1    5e-14    Vitis vinifera
ref|XP_006437216.1|  hypothetical protein CICLE_v10033520mg           78.6    5e-14    
ref|XP_010433280.1|  PREDICTED: uncharacterized protein LOC104717425  79.7    5e-14    Camelina sativa [gold-of-pleasure]
ref|XP_006407837.1|  hypothetical protein EUTSA_v10021454mg           79.7    5e-14    Eutrema salsugineum [saltwater cress]
ref|XP_006298360.1|  hypothetical protein CARUB_v10014430mg           80.5    5e-14    
ref|XP_010448050.1|  PREDICTED: uncharacterized protein LOC104730562  79.7    5e-14    Camelina sativa [gold-of-pleasure]
gb|AAM64721.1|  unknown                                               79.7    6e-14    Arabidopsis thaliana [mouse-ear cress]
ref|WP_015205556.1|  hypothetical protein                             77.0    6e-14    Crinalium epipsammum
ref|NP_194528.1|  YGGT family protein                                 79.7    6e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936393.1|  PREDICTED: uncharacterized protein LOC105056026  79.7    6e-14    Elaeis guineensis
ref|XP_009758250.1|  PREDICTED: uncharacterized protein LOC104210966  79.3    6e-14    Nicotiana sylvestris
ref|XP_008227970.1|  PREDICTED: uncharacterized protein LOC103327420  79.3    6e-14    Prunus mume [ume]
gb|AHA84186.1|  YGGT family protein                                   79.3    7e-14    Phaseolus vulgaris [French bean]
ref|XP_007215935.1|  hypothetical protein PRUPE_ppa011088mg           79.3    7e-14    Prunus persica
ref|WP_015955324.1|  hypothetical protein                             76.6    7e-14    Cyanothece sp. PCC 7424
ref|WP_035985781.1|  membrane protein                                 76.6    7e-14    Leptolyngbya sp. KIOST-1
ref|XP_009145744.1|  PREDICTED: uncharacterized protein LOC103869420  79.3    7e-14    Brassica rapa
ref|XP_002867475.1|  YGGT family protein                              79.0    7e-14    Arabidopsis lyrata subsp. lyrata
ref|XP_007135850.1|  hypothetical protein PHAVU_010G163400g           79.0    8e-14    Phaseolus vulgaris [French bean]
ref|XP_010241669.1|  PREDICTED: uncharacterized protein LOC104586206  79.7    9e-14    Nelumbo nucifera [Indian lotus]
ref|WP_011432695.1|  membrane protein                                 76.6    9e-14    Synechococcus sp. JA-2-3B'a(2-13)
ref|XP_008805970.1|  PREDICTED: uncharacterized protein LOC103718780  79.3    9e-14    
ref|XP_012084994.1|  PREDICTED: uncharacterized protein LOC105644299  79.7    9e-14    Jatropha curcas
ref|XP_008805971.1|  PREDICTED: uncharacterized protein LOC103718781  79.3    9e-14    
ref|XP_010527281.1|  PREDICTED: uncharacterized protein LOC104804641  79.0    9e-14    Tarenaya hassleriana [spider flower]
ref|XP_010451956.1|  PREDICTED: uncharacterized protein LOC104734111  79.3    1e-13    Camelina sativa [gold-of-pleasure]
ref|XP_006414996.1|  hypothetical protein EUTSA_v10026192mg           79.0    1e-13    Eutrema salsugineum [saltwater cress]
gb|KFK29324.1|  hypothetical protein AALP_AA7G118600                  78.6    1e-13    Arabis alpina [alpine rockcress]
ref|XP_008342639.1|  PREDICTED: uncharacterized protein LOC103405417  79.3    1e-13    
ref|XP_010464364.1|  PREDICTED: uncharacterized protein LOC104744930  79.0    1e-13    Camelina sativa [gold-of-pleasure]
ref|XP_006468566.1|  PREDICTED: uncharacterized protein LOC102630904  78.6    1e-13    Citrus sinensis [apfelsine]
ref|XP_006448610.1|  hypothetical protein CICLE_v10016703mg           78.6    1e-13    Citrus clementina [clementine]
gb|KJB08761.1|  hypothetical protein B456_001G102300                  78.6    1e-13    Gossypium raimondii
ref|XP_002989440.1|  hypothetical protein SELMODRAFT_447668           78.2    1e-13    
ref|XP_008380376.1|  PREDICTED: uncharacterized protein LOC103443337  78.6    1e-13    
ref|XP_006284355.1|  hypothetical protein CARUB_v10005528mg           79.0    2e-13    
ref|XP_009346313.1|  PREDICTED: uncharacterized protein LOC103938040  78.2    2e-13    Pyrus x bretschneideri [bai li]
ref|XP_009345352.1|  PREDICTED: uncharacterized protein LOC103937165  78.2    2e-13    Pyrus x bretschneideri [bai li]
gb|AJK93583.1|  YGGT family protein                                   78.2    2e-13    Suaeda glauca
ref|WP_036000850.1|  membrane protein                                 75.5    2e-13    [Leptolyngbya] sp. JSC-1
ref|XP_010557753.1|  PREDICTED: uncharacterized protein LOC104826649  78.2    2e-13    
ref|WP_011430407.1|  membrane protein                                 75.9    2e-13    Synechococcus
ref|XP_008460284.1|  PREDICTED: uncharacterized protein LOC103499156  78.2    2e-13    Cucumis melo [Oriental melon]
ref|XP_002962858.1|  hypothetical protein SELMODRAFT_438165           77.8    2e-13    Selaginella moellendorffii
ref|NP_001238520.1|  uncharacterized protein LOC100500209             77.4    3e-13    
ref|WP_011293831.1|  MULTISPECIES: membrane protein                   75.1    3e-13    Prochlorococcus
emb|CBJ31375.1|  conserved unknown protein                            77.8    3e-13    Ectocarpus siliculosus
ref|XP_004507553.1|  PREDICTED: uncharacterized protein LOC101511801  77.4    3e-13    Cicer arietinum [garbanzo]
gb|KGF87526.1|  Cell division protein YlmG/Ycf19                      74.7    3e-13    Prochlorococcus marinus str. EQPAC1
ref|WP_011125077.1|  MULTISPECIES: membrane protein                   75.1    3e-13    Prochlorococcus
ref|WP_025926473.1|  membrane protein                                 74.7    4e-13    
ref|WP_011132543.1|  membrane protein                                 74.7    4e-13    Prochlorococcus marinus
ref|WP_044151357.1|  membrane protein                                 74.7    4e-13    Lyngbya confervoides
ref|WP_025947338.1|  membrane protein                                 74.7    4e-13    
gb|KHN39369.1|  Hypothetical protein glysoja_018141                   76.6    4e-13    Glycine soja [wild soybean]
ref|WP_032526167.1|  membrane protein                                 74.3    4e-13    Prochlorococcus marinus
ref|WP_011862920.1|  membrane protein                                 74.3    5e-13    Prochlorococcus marinus
ref|WP_025941637.1|  membrane protein                                 74.3    5e-13    
ref|WP_025973296.1|  membrane protein                                 74.3    5e-13    
ref|WP_025962929.1|  membrane protein                                 74.3    5e-13    
ref|WP_025881389.1|  MULTISPECIES: membrane protein                   74.3    5e-13    
ref|WP_002807500.1|  MULTISPECIES: membrane protein                   74.3    5e-13    Prochlorococcus
ref|WP_025970194.1|  membrane protein                                 74.3    5e-13    
ref|WP_025943806.1|  membrane protein                                 74.3    6e-13    
gb|KGF89596.1|  Cell division protein YlmG/Ycf19                      74.3    6e-13    Prochlorococcus marinus str. MIT 9107
ref|WP_036917632.1|  MULTISPECIES: membrane protein                   74.3    6e-13    Prochlorococcus
ref|WP_011364402.1|  membrane protein                                 74.3    6e-13    Synechococcus sp. CC9605
ref|WP_026733210.1|  membrane protein                                 73.9    6e-13    Fischerella sp. PCC 9605
gb|EYU46125.1|  hypothetical protein MIMGU_mgv1a022784mg              75.5    6e-13    Erythranthe guttata [common monkey flower]
ref|WP_011619336.1|  membrane protein                                 74.3    6e-13    Synechococcus sp. CC9311
ref|WP_032524419.1|  membrane protein                                 73.9    6e-13    Prochlorococcus marinus
ref|WP_032514354.1|  membrane protein                                 73.9    6e-13    Prochlorococcus marinus
gb|KEH28534.1|  YGGT family protein                                   76.6    7e-13    Medicago truncatula
gb|ABE11457.1|  conserved hypothetical protein membrane protein       73.6    7e-13    uncultured Prochlorococcus marinus clone HOT0M-7B6
ref|WP_015141301.1|  hypothetical protein                             73.9    7e-13    Nostoc sp. PCC 7524
ref|WP_010996222.1|  MULTISPECIES: hypothetical protein               73.9    7e-13    Nostocaceae
ref|WP_039728523.1|  membrane protein                                 73.9    7e-13    
ref|WP_032517080.1|  membrane protein                                 73.9    7e-13    Prochlorococcus marinus
ref|WP_025969814.1|  membrane protein                                 73.6    8e-13    
ref|WP_036907516.1|  membrane protein                                 73.9    9e-13    Prochlorococcus marinus
ref|WP_015173198.1|  hypothetical protein                             73.6    9e-13    Geitlerinema sp. PCC 7407
ref|WP_032521445.1|  membrane protein                                 73.6    1e-12    Prochlorococcus marinus
ref|WP_006852627.1|  membrane protein                                 73.6    1e-12    Synechococcus
ref|WP_015185263.1|  hypothetical protein                             73.6    1e-12    Microcoleus sp. PCC 7113
ref|WP_038332645.1|  hypothetical protein                             73.2    1e-12    
ref|WP_040944227.1|  hypothetical protein                             73.6    1e-12    
ref|WP_036921035.1|  membrane protein                                 73.2    1e-12    
ref|WP_006454770.1|  membrane protein                                 73.6    1e-12    Synechococcus sp. PCC 7335
dbj|BAD79232.1|  hypothetical protein YCF19                           73.6    1e-12    Synechococcus elongatus PCC 6301
ref|WP_012162044.1|  hypothetical protein                             73.2    1e-12    Acaryochloris marina
ref|WP_029315503.1|  membrane protein                                 73.2    1e-12    Acaryochloris sp. CCMEE 5410
ref|WP_039755419.1|  MULTISPECIES: membrane protein                   73.2    1e-12    
ref|WP_040932409.1|  hypothetical protein                             73.2    1e-12    
ref|WP_006911009.1|  membrane protein                                 73.2    2e-12    Cyanobium sp. PCC 7001
gb|AGY57339.1|  YggT family protein                                   72.8    2e-12    Gloeobacter kilaueensis JS1
ref|WP_025975046.1|  membrane protein                                 72.8    2e-12    
ref|WP_040939420.1|  hypothetical protein                             72.8    2e-12    
ref|WP_025940641.1|  membrane protein                                 72.8    2e-12    
ref|WP_019506458.1|  hypothetical protein                             72.8    2e-12    Pleurocapsa sp. PCC 7319
ref|WP_016872802.1|  hypothetical protein                             72.4    2e-12    Chlorogloeopsis fritschii
ref|WP_041244383.1|  membrane protein                                 72.4    2e-12    
ref|WP_013325223.1|  hypothetical protein                             72.8    2e-12    Cyanothece sp. PCC 7822
ref|WP_045873178.1|  membrane protein                                 72.0    3e-12    Nostocales
ref|WP_035155370.1|  membrane protein                                 72.0    3e-12    Calothrix sp. 336/3
ref|WP_009342830.1|  hypothetical protein                             72.0    4e-12    Aphanizomenonaceae
ref|WP_038554721.1|  membrane protein                                 72.0    4e-12    Synechococcus sp. KORDI-52
ref|WP_006275964.1|  hypothetical protein                             72.0    4e-12    Aphanizomenonaceae
ref|WP_015168558.1|  hypothetical protein                             71.6    4e-12    Synechococcus sp. PCC 7502
ref|WP_026092993.1|  membrane protein                                 71.6    5e-12    Calothrix sp. PCC 7103
ref|WP_025888260.1|  membrane protein                                 70.9    5e-12    
ref|WP_038544782.1|  membrane protein                                 71.6    6e-12    Synechococcus sp. KORDI-100
ref|WP_013190384.1|  hypothetical protein                             71.2    6e-12    Trichormus azollae
ref|WP_019475137.1|  MULTISPECIES: membrane protein                   71.2    6e-12    
ref|WP_007102432.1|  membrane protein                                 71.6    6e-12    Synechococcus sp. RS9917
ref|WP_038004923.1|  membrane protein                                 71.2    7e-12    Synechococcus sp. WH 7805
gb|EAR18742.1|  hypothetical protein WH7805_02867                     71.6    7e-12    Synechococcus sp. WH 7805
ref|WP_009625401.1|  protein of unknown function YGGT                 71.2    7e-12    Pseudanabaena biceps
ref|WP_006106652.1|  hypothetical protein                             71.2    7e-12    Coleofasciculus chthonoplastes
ref|WP_011933127.1|  membrane protein                                 71.6    7e-12    Synechococcus sp. WH 7803
ref|WP_027401027.1|  membrane protein                                 71.2    7e-12    Nostocales
ref|WP_015219455.1|  hypothetical protein                             70.9    8e-12    Cyanobacterium aponinum
ref|WP_015080346.1|  hypothetical protein                             70.9    9e-12    Anabaena sp. 90
ref|WP_037224791.1|  membrane protein                                 70.9    1e-11    
ref|WP_007097886.1|  membrane protein                                 70.9    1e-11    Synechococcus sp. RS9916
ref|WP_013917740.1|  cell division protein                            70.5    1e-11    Paenibacillus mucilaginosus
ref|WP_038021847.1|  membrane protein                                 70.5    1e-11    Synechocystis sp. PCC 7509
ref|WP_006510333.1|  putative integral membrane protein               70.5    1e-11    Xenococcus sp. PCC 7305
gb|AFC32191.1|  cell division protein sepF                            73.6    1e-11    
ref|WP_008277107.1|  hypothetical protein                             70.5    2e-11    
ref|WP_011826175.1|  MULTISPECIES: membrane protein                   70.5    2e-11    
ref|WP_015119623.1|  hypothetical protein                             70.1    2e-11    
ref|WP_011130060.1|  membrane protein                                 70.5    2e-11    
ref|WP_015224498.1|  hypothetical protein                             70.1    2e-11    
ref|WP_009543128.1|  MULTISPECIES: hypothetical protein               70.1    2e-11    
ref|WP_011935811.1|  membrane protein                                 69.7    2e-11    
gb|AFG62780.1|  hypothetical protein 0_1772_01                        68.6    3e-11    
ref|WP_036983548.1|  membrane protein                                 69.7    3e-11    
ref|WP_015213975.1|  protein of unknown function YGGT                 69.3    3e-11    
ref|WP_015228920.1|  hypothetical protein                             69.3    3e-11    
ref|WP_028090433.1|  membrane protein                                 69.3    3e-11    
ref|WP_041234524.1|  integral membrane protein                        69.3    3e-11    
ref|WP_007355877.1|  MULTISPECIES: hypothetical protein               69.3    3e-11    
ref|WP_012410570.1|  hypothetical protein                             69.3    3e-11    
ref|WP_019499934.1|  hypothetical protein                             69.3    4e-11    
gb|AFZ46466.1|  protein of unknown function YGGT                      69.3    4e-11    
ref|WP_010308839.1|  membrane protein                                 68.9    5e-11    
ref|WP_006631083.1|  MULTISPECIES: hypothetical protein               68.9    6e-11    
ref|WP_042349007.1|  membrane protein                                 68.2    7e-11    
ref|WP_006669458.1|  MULTISPECIES: hypothetical protein               68.6    8e-11    
ref|WP_016508982.1|  hypothetical protein                             68.2    8e-11    
ref|WP_009556209.1|  putative integral membrane protein               68.6    8e-11    
ref|XP_002288967.1|  predicted protein                                67.8    8e-11    
ref|XP_002500315.1|  fanciful K+ uptake-b family transporter          69.7    9e-11    
ref|WP_045057253.1|  membrane protein                                 68.2    9e-11    
ref|WP_006197487.1|  hypothetical protein                             68.2    9e-11    
gb|KIE13633.1|  membrane protein                                      68.2    9e-11    
ref|WP_043691024.1|  membrane protein                                 68.2    1e-10    
ref|WP_017318545.1|  hypothetical protein                             67.8    1e-10    
ref|WP_028082059.1|  membrane protein                                 67.8    1e-10    
ref|WP_029634633.1|  membrane protein [                               67.8    1e-10    
ref|WP_016950866.1|  hypothetical protein                             67.8    1e-10    
ref|WP_029982448.1|  membrane protein                                 67.0    1e-10    
ref|WP_015110968.1|  hypothetical protein                             67.8    1e-10    
ref|WP_011128159.1|  membrane protein                                 67.8    1e-10    
gb|KIJ83300.1|  membrane protein                                      67.8    1e-10    
ref|WP_028952096.1|  membrane protein                                 67.4    2e-10    
ref|WP_022740272.1|  hypothetical protein                             67.0    2e-10    
ref|WP_015193658.1|  protein of unknown function YGGT                 67.0    2e-10    
ref|WP_028027436.1|  hypothetical protein                             67.0    2e-10    
ref|WP_006849993.1|  membrane protein                                 67.4    2e-10    
ref|WP_028549298.1|  cell division protein                            67.0    2e-10    
ref|WP_039231993.1|  membrane protein                                 66.6    3e-10    
ref|WP_010024400.1|  membrane protein                                 66.6    3e-10    
ref|WP_024370034.1|  MULTISPECIES: cell division protein              66.6    3e-10    
ref|WP_015142267.1|  hypothetical protein                             66.6    3e-10    
ref|WP_017320243.1|  hypothetical protein                             66.6    3e-10    
ref|WP_034805585.1|  MULTISPECIES: cell division protein              66.6    4e-10    
ref|WP_021067051.1|  MULTISPECIES: membrane protein                   66.6    4e-10    
ref|WP_008225613.1|  Cell division protein YlmG/Ycf19 (putative),...  66.6    4e-10    
ref|WP_011611789.1|  hypothetical protein                             66.6    4e-10    
ref|WP_028977889.1|  membrane protein                                 66.2    4e-10    
ref|WP_006620056.1|  hypothetical protein                             66.2    4e-10    
ref|WP_025932482.1|  membrane protein                                 65.9    4e-10    
dbj|BAM50551.1|  hypothetical protein BEST7613_1620 [Synechocysti...  66.2    5e-10    
ref|WP_010871471.1|  hypothetical protein                             66.2    5e-10    
ref|WP_016309152.1|  YggT family protein                              65.9    5e-10    
ref|WP_006036365.1|  cell division protein                            65.9    5e-10    
ref|XP_009124344.1|  PREDICTED: uncharacterized protein LOC103849305  68.2    6e-10    
gb|KDO60902.1|  hypothetical protein CISIN_1g035609mg                 67.4    6e-10    
ref|WP_011877089.1|  hypothetical protein                             65.5    7e-10    
ref|WP_017289760.1|  hypothetical protein                             65.9    8e-10    
ref|WP_009786658.1|  MULTISPECIES: hypothetical protein               65.5    8e-10    
ref|WP_003251891.1|  MULTISPECIES: membrane protein                   65.5    8e-10    
ref|WP_028948222.1|  hypothetical protein                             65.5    9e-10    
dbj|BAQ60842.1|  cell division protein YlmG/Ycf19 (putative)          65.1    1e-09    
ref|WP_039754385.1|  membrane protein                                 65.1    1e-09    
ref|WP_014274832.1|  hypothetical protein                             65.1    1e-09    
ref|WP_044195387.1|  membrane protein                                 65.1    1e-09    
ref|WP_040054827.1|  integral membrane protein                        65.1    1e-09    
ref|WP_017327606.1|  hypothetical protein                             65.1    1e-09    
emb|CDP03953.1|  unnamed protein product                              67.8    1e-09    
gb|AFY83173.1|  putative integral membrane protein                    65.1    1e-09    
gb|AHY04383.1|  conserved hypothetical plastid protein Ycf19          65.1    1e-09    
ref|WP_015863371.1|  membrane protein                                 64.7    1e-09    
ref|WP_012954348.1|  hypothetical protein                             65.1    1e-09    
ref|WP_003348913.1|  membrane protein                                 64.7    1e-09    
ref|WP_036265022.1|  membrane protein                                 64.7    1e-09    
ref|WP_034313862.1|  membrane protein                                 64.7    1e-09    
ref|WP_034558704.1|  membrane protein                                 64.7    2e-09    
ref|WP_035406819.1|  cell division protein                            64.7    2e-09    
ref|WP_028105981.1|  cell division protein                            64.7    2e-09    
ref|WP_010053427.1|  membrane protein                                 64.3    2e-09    
gb|ACT02506.1|  protein of unknown function YGGT                      64.7    2e-09    
ref|WP_036677370.1|  cell division protein                            64.7    2e-09    
ref|WP_017655594.1|  hypothetical protein                             64.3    2e-09    
ref|WP_035349854.1|  hypothetical protein                             64.3    2e-09    
ref|WP_029191262.1|  cell division protein                            64.3    2e-09    
ref|WP_023468796.1|  MULTISPECIES: membrane protein                   64.3    2e-09    
ref|WP_045671808.1|  cell division protein                            64.3    2e-09    
ref|WP_025853403.1|  cell division protein                            63.9    2e-09    
ref|WP_019242387.1|  hypothetical protein                             63.9    3e-09    
ref|WP_010317238.1|  membrane protein                                 64.3    3e-09    
ref|WP_003350287.1|  membrane protein                                 63.9    3e-09    
ref|WP_017296137.1|  hypothetical protein                             63.9    3e-09    
ref|WP_015200515.1|  hypothetical protein                             63.9    3e-09    
ref|WP_013979404.1|  hypothetical protein                             63.5    3e-09    
ref|WP_003395056.1|  integral membrane protein                        63.9    3e-09    
ref|WP_006527536.1|  putative integral membrane protein               63.5    3e-09    
ref|WP_026826315.1|  cell division protein                            63.5    4e-09    
ref|WP_017721550.1|  hypothetical protein                             63.5    4e-09    
ref|WP_012798044.1|  hypothetical protein                             63.5    4e-09    
ref|WP_013944673.1|  membrane protein                                 63.5    4e-09    
ref|WP_009306237.1|  MULTISPECIES: hypothetical protein               63.2    4e-09    
ref|WP_012629692.1|  hypothetical protein                             63.5    5e-09    
ref|WP_023076952.1|  integral membrane protein                        63.5    5e-09    
dbj|BAQ66832.1|  cell division protein YlmG/Ycf19                     63.2    5e-09    
ref|WP_012370824.1|  membrane protein                                 63.2    5e-09    
ref|WP_025974623.1|  membrane protein                                 62.4    5e-09    
ref|WP_015165854.1|  hypothetical protein                             63.2    5e-09    
ref|WP_034769807.1|  cell division protein                            63.2    5e-09    
ref|WP_041614427.1|  cell division protein                            63.2    5e-09    
ref|WP_042356318.1|  membrane protein                                 63.2    5e-09    
ref|WP_007086285.1|  hypothetical protein                             63.2    6e-09    
ref|WP_015160310.1|  putative integral membrane protein               63.2    6e-09    
ref|WP_011143529.1|  hypothetical protein                             63.2    6e-09    
ref|WP_018975667.1|  hypothetical protein                             63.2    6e-09    
ref|WP_036719248.1|  cell division protein                            62.8    6e-09    
ref|WP_008878668.1|  MULTISPECIES: membrane protein                   63.2    6e-09    
ref|WP_026832565.1|  cell division protein                            62.8    6e-09    
ref|WP_044746577.1|  membrane protein                                 62.8    7e-09    
ref|WP_009139299.1|  hypothetical protein                             62.8    8e-09    
ref|WP_033022236.1|  MULTISPECIES: membrane protein                   62.8    8e-09    
ref|WP_040057042.1|  membrane protein                                 62.8    8e-09    
ref|WP_021829852.1|  Cell division protein YlmG/Ycf19 (putative),...  62.8    9e-09    
ref|WP_029330903.1|  cell division protein                            62.4    9e-09    
ref|WP_024026912.1|  hypothetical protein                             62.8    9e-09    
gb|EAM50108.1|  Protein of unknown function YGGT                      62.8    9e-09    
ref|WP_015881317.1|  MULTISPECIES: membrane protein                   62.4    1e-08    
ref|WP_016201024.1|  hypothetical protein                             62.4    1e-08    
ref|WP_041033190.1|  membrane protein                                 62.4    1e-08    
ref|WP_022362868.1|  putative integral membrane protein               62.0    1e-08    
ref|WP_035053606.1|  cell shape determination protein                 62.4    1e-08    
gb|EDP68209.1|  hypothetical protein CAT7_08120                       62.4    1e-08    
ref|WP_014970758.1|  membrane protein                                 62.4    1e-08    
ref|WP_040674986.1|  cell division protein                            62.0    1e-08    
ref|WP_026788971.1|  MULTISPECIES: membrane protein                   62.4    1e-08    
ref|WP_004891187.1|  putative protein, YGGT family                    62.0    1e-08    
ref|WP_006286408.1|  putative integral membrane protein               62.0    1e-08    
ref|WP_038540934.1|  membrane protein                                 62.0    1e-08    
ref|WP_018705211.1|  membrane protein                                 62.0    1e-08    
ref|WP_026794466.1|  MULTISPECIES: membrane protein                   62.0    1e-08    
ref|WP_017305828.1|  hypothetical protein                             62.4    1e-08    
ref|WP_029276131.1|  MULTISPECIES: cell shape determination protein   62.0    1e-08    
ref|WP_020959260.1|  membrane protein                                 62.0    1e-08    
ref|WP_041099847.1|  membrane protein                                 62.0    1e-08    
ref|WP_035827320.1|  hypothetical protein                             62.0    1e-08    
ref|YP_001293489.1|  hypothetical plastid protein 19                  62.0    2e-08    
ref|WP_041239409.1|  hypothetical protein                             61.6    2e-08    
ref|WP_022370144.1|  putative integral membrane protein               61.6    2e-08    
ref|WP_015156463.1|  hypothetical protein                             62.0    2e-08    
ref|WP_015127865.1|  hypothetical protein                             62.0    2e-08    
ref|WP_015208321.1|  putative integral membrane protein               61.6    2e-08    
ref|WP_039713839.1|  membrane protein                                 61.6    2e-08    
ref|WP_011344932.1|  MULTISPECIES: hypothetical protein               61.6    2e-08    
ref|WP_033011295.1|  MULTISPECIES: membrane protein                   61.6    2e-08    
ref|WP_006675647.1|  cell division protein                            61.6    2e-08    
ref|WP_036657841.1|  hypothetical protein                             61.6    2e-08    
ref|WP_037995137.1|  hypothetical protein                             61.2    2e-08    
ref|WP_022378716.1|  hypothetical protein                             61.2    2e-08    
ref|WP_036605384.1|  cell division protein                            61.2    3e-08    
ref|WP_006321475.1|  integral membrane protein                        61.2    3e-08    
gb|KEI66440.1|  hypothetical protein A19Y_1380                        62.0    3e-08    
ref|WP_023508973.1|  membrane protein                                 61.2    3e-08    
gb|EPY08799.1|  hypothetical protein PAALTS15_02477                   61.2    3e-08    
ref|WP_036592436.1|  MULTISPECIES: cell division protein              60.8    3e-08    
ref|WP_044893841.1|  membrane protein                                 60.8    3e-08    
ref|WP_039689537.1|  hypothetical protein                             60.8    3e-08    
gb|KDD74335.1|  hypothetical protein H632_c1392p1                     61.2    3e-08    
ref|WP_010631020.1|  membrane protein                                 60.5    4e-08    
ref|WP_045515362.1|  membrane protein                                 60.8    4e-08    
gb|KIZ04744.1|  Uncharacterized protein ycf19                         61.2    4e-08    
ref|WP_006361786.1|  hypothetical protein                             60.5    4e-08    
ref|WP_009078893.1|  hypothetical protein                             60.5    4e-08    
ref|WP_028596998.1|  hypothetical protein                             60.8    4e-08    
ref|WP_022023461.1|  hypothetical protein                             60.5    4e-08    
ref|WP_026566390.1|  membrane protein                                 60.5    4e-08    
ref|WP_035046588.1|  membrane protein                                 60.5    4e-08    
ref|WP_040740959.1|  cell division protein                            60.5    4e-08    
ref|WP_035313326.1|  hypothetical protein                             60.5    5e-08    
ref|WP_019152860.1|  membrane protein                                 60.5    5e-08    
ref|WP_012595796.1|  MULTISPECIES: hypothetical protein               60.5    5e-08    
ref|WP_021094887.1|  integral membrane protein                        60.5    6e-08    
ref|WP_008297306.1|  YGGT family protein                              60.1    6e-08    
ref|WP_027726121.1|  membrane protein                                 60.1    6e-08    
ref|WP_032101525.1|  membrane protein                                 60.5    6e-08    
ref|WP_042456204.1|  membrane protein                                 60.1    6e-08    
ref|WP_012094988.1|  membrane protein                                 60.1    6e-08    
gb|ACJ34176.1|  Predicted integral membrane protein                   60.1    6e-08    
ref|WP_041638580.1|  membrane protein                                 60.1    6e-08    
ref|WP_037293406.1|  cell division protein                            60.1    7e-08    
emb|CCO08764.1|  Uncharacterized membrane protein ylmG                60.1    7e-08    
ref|WP_035101265.1|  hypothetical protein                             60.1    7e-08    
ref|WP_012803324.1|  hypothetical protein                             60.1    7e-08    
ref|WP_017747569.1|  hypothetical protein                             60.1    7e-08    
ref|WP_015593062.1|  membrane protein                                 60.1    7e-08    
ref|WP_005548081.1|  cell division protein                            60.1    8e-08    
ref|WP_017796598.1|  membrane protein                                 59.7    8e-08    
ref|WP_032110822.1|  hypothetical protein                             59.7    8e-08    
ref|WP_044337463.1|  membrane protein                                 59.7    9e-08    
ref|WP_017712581.1|  hypothetical protein                             59.7    9e-08    
ref|WP_019128175.1|  hypothetical protein                             60.1    9e-08    
ref|WP_017434718.1|  membrane protein                                 59.7    9e-08    
ref|WP_040204886.1|  MULTISPECIES: membrane protein                   59.7    9e-08    
ref|WP_044106062.1|  integral membrane protein                        59.7    9e-08    
ref|WP_013843257.1|  hypothetical protein                             59.3    1e-07    
ref|WP_009373551.1|  integral membrane protein                        59.7    1e-07    
ref|WP_042159837.1|  cell division protein                            59.3    1e-07    
ref|WP_034569061.1|  hypothetical protein                             59.7    1e-07    
ref|WP_009789718.1|  MULTISPECIES: membrane protein                   59.7    1e-07    
ref|WP_014569589.1|  cell division protein                            59.7    1e-07    
ref|WP_026011805.1|  MULTISPECIES: membrane protein                   59.7    1e-07    
ref|WP_044396319.1|  membrane protein                                 59.3    1e-07    
ref|YP_277325.1|  hypothetical chloroplast RF19                       59.3    1e-07    
ref|WP_028544987.1|  hypothetical protein                             59.3    1e-07    
ref|WP_029092332.1|  hypothetical protein                             59.3    1e-07    
ref|WP_005685585.1|  cell division protein                            59.3    1e-07    
emb|CEG26747.1|  integral membrane protein                            59.3    1e-07    
ref|WP_018753225.1|  cell division protein                            59.3    1e-07    



>ref|XP_009782686.1| PREDICTED: uncharacterized protein LOC104231395 [Nicotiana sylvestris]
Length=260

 Score =   315 bits (808),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 188/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  911  SSDEALQERQKPVQSNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAED-SSRAVRRFH  735
            SS +   E+Q  V SNC+ISLPF  PP   P F +   K NLQLL MA++ SS A   FH
Sbjct  5    SSSKMADEKQNCVVSNCIISLPFSTPPFVQPPFLKQLPKSNLQLLNMAQEASSNAFLHFH  64

Query  734  SSVVSAADNCLKSLHSLLS-QNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAI  558
            +S+VS A  CLK LHS++S  +P F   LS SSH QD  Q+  R+ QN   LS H+FAA+
Sbjct  65   NSIVSTAAKCLKLLHSVVSPHHPLFSKFLSFSSHFQDFCQVHSRSYQNLGNLSHHSFAAV  124

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAGIVV NGI+NFLNIYNSLLV RLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI
Sbjct  125  LPGDSVAGIVVANGIINFLNIYNSLLVARLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  184

Query  377  IPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT-GVSRDDXPHTMEPXLTMSQRKW  201
            IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP  T   S D  PH     LT SQ+KW
Sbjct  185  IPPLGGTLDLSPILAFLVLNAFTSTASALPAELPSTTRRASSDTPPHAPVFNLTTSQKKW  244

Query  200  MRRRSAGNRPKSAGG  156
            MRR   GN+ K+A G
Sbjct  245  MRRL-VGNKSKTADG  258



>ref|XP_009599114.1| PREDICTED: uncharacterized protein LOC104094824 [Nicotiana tomentosiformis]
Length=261

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 167/259 (64%), Positives = 192/259 (74%), Gaps = 5/259 (2%)
 Frame = -2

Query  926  MNSHCSSDEAL-QERQKPVQSNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAED-SSR  753
            M +  SS  ++ +E+Q  V SNC+ISLPF  PP   P F +   K NLQLL MA++ SS 
Sbjct  1    MAAQSSSKHSMAEEKQNSVISNCIISLPFSTPPFVQPPFLKQLPKSNLQLLNMAQEASSN  60

Query  752  AVRRFHSSVVSAADNCLKSLHSLLS-QNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSS  576
            A   FH+S+ S A+ C+K LHS++S  +P F  +LS SSH QD  Q+  R  QN   LS 
Sbjct  61   AFLHFHNSISSTAEKCIKLLHSVISPHHPLFSKILSFSSHFQDFCQVHCRTYQNLGNLSH  120

Query  575  HNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYL  396
            H+FAA++PGDSVAGIVV NGI+NFLNIYNSLLV RLVLTWFPNAPPAIVSPLSTLCDPYL
Sbjct  121  HSFAAVLPGDSVAGIVVANGIINFLNIYNSLLVARLVLTWFPNAPPAIVSPLSTLCDPYL  180

Query  395  NIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT-GVSRDDXPHTMEPXLT  219
            NIFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP  T   S D  PH     LT
Sbjct  181  NIFRGIIPPLGGTLDLSPILAFLVLNAFTSTASALPAELPSTTRRASSDTPPHAPVFNLT  240

Query  218  MSQRKWMRRRSAGNRPKSA  162
             SQ+KWMRR S GN+ K+A
Sbjct  241  TSQKKWMRRFS-GNKSKTA  258



>ref|XP_006353858.1| PREDICTED: uncharacterized protein LOC102598192 [Solanum tuberosum]
Length=251

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 183/253 (72%), Gaps = 13/253 (5%)
 Frame = -2

Query  911  SSDEALQE--RQKPVQSNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRF  738
            SS +++ E  +Q  V SNCLISLPF       P FF+   K NLQL   A+ SS A   F
Sbjct  5    SSSQSMAETSKQNCVVSNCLISLPF---SFSTPPFFKQLPKSNLQL---AQTSSNAFLHF  58

Query  737  HSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAI  558
            H+S++S A+ C   LHS L+  P F  +++ SSH     Q++ R  QN   LS HNFAA+
Sbjct  59   HNSLLSTAEKCFTFLHSFLASQPLFNKIMNFSSHFS---QVQCRTYQNLGNLSHHNFAAV  115

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAGIVV NGI+NFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI
Sbjct  116  LPGDSVAGIVVANGIINFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  175

Query  377  IPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX-LTMSQRKW  201
            IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP  T  +  D PH      LT SQ+KW
Sbjct  176  IPPLGGTLDLSPILAFLVLNAFTSTASALPAELPSTTVRASSDTPHGAPIFHLTTSQKKW  235

Query  200  MRRRSAGNRPKSA  162
            MRR S GN+ K++
Sbjct  236  MRRLS-GNKSKTS  247



>ref|XP_004245046.1| PREDICTED: uncharacterized protein LOC101267629 [Solanum lycopersicum]
Length=251

 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 181/253 (72%), Gaps = 13/253 (5%)
 Frame = -2

Query  911  SSDEALQE--RQKPVQSNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRF  738
            SS +++ E  +Q  V SNCLISLPF       P FF+   K NLQL   A+ SS     F
Sbjct  5    SSSQSMAETTKQNSVVSNCLISLPF---SFSTPPFFKQLPKSNLQL---AQTSSNPFLHF  58

Query  737  HSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAI  558
            H+S++S A+ C   LHS L+  P F  +++ SSH     Q++ R  QN   LS HNFAA+
Sbjct  59   HNSLLSTAEKCFTLLHSFLASQPLFNKIMNFSSHFS---QVQCRTYQNMGNLSHHNFAAV  115

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAGIVV NGI+NFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI
Sbjct  116  LPGDSVAGIVVANGIINFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  175

Query  377  IPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX-LTMSQRKW  201
            IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP  T     D PH      LT SQ+KW
Sbjct  176  IPPLGGTLDLSPILAFLVLNAFTSTASALPAELPSTTVRESSDTPHRAPIFHLTTSQKKW  235

Query  200  MRRRSAGNRPKSA  162
            MRR S GN+ K++
Sbjct  236  MRRLS-GNKSKTS  247



>emb|CDP13472.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 158/257 (61%), Positives = 178/257 (69%), Gaps = 13/257 (5%)
 Frame = -2

Query  908  SDEALQERQKPVQSNCLISLPFYAPPLFHPSFFRH----HSKPNLQLLRMAEDSSRAVRR  741
            S E  +   K    NCL  LPF APP      FR     H KPNLQLL++A  +S    +
Sbjct  2    SKEEERFATKKSTPNCLTLLPFSAPP-----HFRQPAPPHLKPNLQLLKVA--ASHVATQ  54

Query  740  FHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIR-QIERRARQNFNTLSSHNFA  564
             H S++ +AD  L  LH L SQNP    LLS SSHLQ    Q+  R   + +  S+HNFA
Sbjct  55   LHDSILISADKFLSMLHGLASQNPLLCRLLSFSSHLQSFSSQMRCRNYGHLDAQSNHNFA  114

Query  563  AIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFR  384
            AI+PGDSVAGIVVTNGILNFLNIYN+LL+VRLVLTWFPNAPPA+VSPLST+CDPYLNIFR
Sbjct  115  AILPGDSVAGIVVTNGILNFLNIYNTLLIVRLVLTWFPNAPPAVVSPLSTICDPYLNIFR  174

Query  383  GIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRK  204
            GIIPPLGGTLDLSPILAF+VLNAFTSTA ALPAEL PPTGVS      T     T SQRK
Sbjct  175  GIIPPLGGTLDLSPILAFIVLNAFTSTAAALPAEL-PPTGVSERLPSRTTVSPFTTSQRK  233

Query  203  WMRRRSAGNRPKSAGGN  153
            W+RR S      S+G N
Sbjct  234  WIRRLSGVESKNSSGEN  250



>ref|XP_011081597.1| PREDICTED: uncharacterized protein LOC105164607 [Sesamum indicum]
Length=263

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 180/267 (67%), Gaps = 14/267 (5%)
 Frame = -2

Query  926  MNSHCSSDEALQERQKPVQ----SNCLISLPFYAPPL--FHPS-FFRH--HSKPNLQLLR  774
            M+S  SS  +L++  K       S  L+ LPF +PPL   H + FFR      PN +LL 
Sbjct  1    MDSCFSSKHSLEDEHKSSALGPPSQFLMLLPFSSPPLNFIHCTPFFRQPLSLNPNFKLLM  60

Query  773  MAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQN  594
             A   S  VR    S++S  + CLK + +  SQ      ++S  S+LQ   QI R   QN
Sbjct  61   GA---SNVVREVQKSIMSNVEKCLKIVDNFRSQIAVLDKIMSFPSYLQYGCQIPRTNCQN  117

Query  593  FNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLST  414
               LS+ NFAAI+PGDSVAGIVVTNGILNFLNIYN+LLVVRLVLTWFPNAPPA+VSPLST
Sbjct  118  LEMLSNSNFAAILPGDSVAGIVVTNGILNFLNIYNTLLVVRLVLTWFPNAPPAVVSPLST  177

Query  413  LCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTM  234
            LCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALPAEL P   VS+ +  H  
Sbjct  178  LCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAAALPAEL-PSAEVSKVNPSHAT  236

Query  233  EPXLTMSQRKWMRRRSAGNRPKSAGGN  153
               LT  Q+KWMRR S GN+ KS+   
Sbjct  237  TAHLTTLQKKWMRRLS-GNKSKSSNAG  262



>ref|XP_010261896.1| PREDICTED: uncharacterized protein LOC104600566 [Nelumbo nucifera]
Length=254

 Score =   253 bits (647),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 182/262 (69%), Gaps = 14/262 (5%)
 Frame = -2

Query  926  MNSHCSSDEA-LQE--RQKPVQSNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSS  756
            M S  SS+E  ++E   +  + SN L++  F   P F P   RH  KPNL          
Sbjct  1    MASSSSSNEVEIREANYEAKMVSNFLLASTFPQTP-FSPPRVRHL-KPNL-----VSTPP  53

Query  755  RAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSS  576
              ++  HSS++S+AD C K+L++++S NPF +NL SL ++  +  QI  R  ++ NTL +
Sbjct  54   DIIQVLHSSLLSSADRCFKTLNTIISANPFLQNLFSLPTNFCNFFQIHCRNSRSLNTLYN  113

Query  575  HNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYL  396
            HNFAAI+PGDS AGI V+NGILNFLNIYN+LL+VRLVLTWFPN PPAIVSPLSTLCDPYL
Sbjct  114  HNFAAILPGDSXAGIXVSNGILNFLNIYNTLLIVRLVLTWFPNTPPAIVSPLSTLCDPYL  173

Query  395  NIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXL--  222
            NIFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALPAEL P TG S      +       
Sbjct  174  NIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAAALPAEL-PITGASEVGQSSSKSRFFSP  232

Query  221  TMSQRKWMRRRSAGNRPKSAGG  156
            T +QRKW+ RR  GN  K++GG
Sbjct  233  TTAQRKWL-RRVYGNGSKNSGG  253



>emb|CBI20725.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   251 bits (640),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 166/249 (67%), Gaps = 13/249 (5%)
 Frame = -2

Query  908  SDEALQERQKPVQSNCLISLPFYAPPLFHPSF--FRHHSKPNLQLLRMAEDSS--RAVRR  741
            S E+  ER +    N   + P  +      SF  F   +K     L + E S     +R+
Sbjct  5    STESSTERARCAAPNWAANCPLLSSAFLQTSFPPFLRPTK-----LTLPETSGVPDFIRQ  59

Query  740  FHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAA  561
            FHSSV SA   C+  L    SQNPF   L SLS+H     QI  R ++N N LS+ NFAA
Sbjct  60   FHSSVASATQRCVALLQLFASQNPFLNRLSSLSAHFS---QIHCRKQRNLNPLSNQNFAA  116

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRG  381
            I+PGDSVAGIVV NGILNFLNIYN+LL+VRLVLTWFPN+PPAIVSPLSTLCDPYLNIFRG
Sbjct  117  ILPGDSVAGIVVANGILNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTLCDPYLNIFRG  176

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKW  201
            IIPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP      +    HT    LT +Q+KW
Sbjct  177  IIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPMAGVPQQIPSSHTRLFDLTTTQKKW  236

Query  200  MRRRSAGNR  174
            MRR   GNR
Sbjct  237  MRRL-CGNR  244



>ref|XP_002308522.1| YGGT family protein [Populus trichocarpa]
 gb|EEE92045.1| YGGT family protein [Populus trichocarpa]
Length=252

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 174/249 (70%), Gaps = 9/249 (4%)
 Frame = -2

Query  878  PVQSNCLISLPFYA-PPLFHPSFFRHHSKPNLQ---LLR--MAEDSSRAVRRFHSSVVSA  717
            P+  NCL         P+F P+     S   LQ    LR  + ++ S  +   H+S+ SA
Sbjct  3    PLNENCLEKTNSKCQAPIFAPNSMVLLSSSILQNPLFLRPPIKQNPSIFMGELHNSITSA  62

Query  716  ADNCLKSLHSLLSQNPFFKNLLS-LSSHLQDIRQIERRARQNFNT-LSSHNFAAIIPGDS  543
            AD CL+ LHS  S+NP  KN+++  + H+  I+      R+N N  LS+HNFAA++PGDS
Sbjct  63   ADKCLRFLHSFASRNPILKNIVTDFNQHMTRIQCRREYCRRNMNNYLSNHNFAAVLPGDS  122

Query  542  VAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLG  363
            VAG+VV NGI+NFLNIYN+LLVVRLVLTWFPN+PPAIVSPLSTLCDPYLNIFRGIIPPLG
Sbjct  123  VAGLVVANGIINFLNIYNTLLVVRLVLTWFPNSPPAIVSPLSTLCDPYLNIFRGIIPPLG  182

Query  362  GTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSA  183
            GTLDLSPILAFLVLNAFTSTA ALPAELP      R     T+   LT +Q+KWMRR + 
Sbjct  183  GTLDLSPILAFLVLNAFTSTATALPAELPENGASPRSRSSPTLFTHLTTAQKKWMRRLN-  241

Query  182  GNRPKSAGG  156
            GN+ +S+ G
Sbjct  242  GNKSRSSPG  250



>ref|XP_002280034.3| PREDICTED: uncharacterized protein LOC100242172 [Vitis vinifera]
Length=294

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 166/249 (67%), Gaps = 13/249 (5%)
 Frame = -2

Query  908  SDEALQERQKPVQSNCLISLPFYAPPLFHPSF--FRHHSKPNLQLLRMAEDSS--RAVRR  741
            S E+  ER +    N   + P  +      SF  F   +K     L + E S     +R+
Sbjct  47   STESSTERARCAAPNWAANCPLLSSAFLQTSFPPFLRPTK-----LTLPETSGVPDFIRQ  101

Query  740  FHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAA  561
            FHSSV SA   C+  L    SQNPF   L SLS+H     QI  R ++N N LS+ NFAA
Sbjct  102  FHSSVASATQRCVALLQLFASQNPFLNRLSSLSAHFS---QIHCRKQRNLNPLSNQNFAA  158

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRG  381
            I+PGDSVAGIVV NGILNFLNIYN+LL+VRLVLTWFPN+PPAIVSPLSTLCDPYLNIFRG
Sbjct  159  ILPGDSVAGIVVANGILNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTLCDPYLNIFRG  218

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKW  201
            IIPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP      +    HT    LT +Q+KW
Sbjct  219  IIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPMAGVPQQIPSSHTRLFDLTTTQKKW  278

Query  200  MRRRSAGNR  174
            MRR   GNR
Sbjct  279  MRRL-CGNR  286



>ref|XP_011019343.1| PREDICTED: uncharacterized protein LOC105122118 [Populus euphratica]
Length=252

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 158/208 (76%), Gaps = 3/208 (1%)
 Frame = -2

Query  773  MAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLS-LSSHLQDIRQIERRARQ  597
            + ++ S  +   H+S+ SAAD CL+ LHS  S+NP  KN+++  + H+  I+      R+
Sbjct  44   IKQNPSIFMGELHNSITSAADKCLRFLHSFASRNPILKNIITDFNQHMTRIQCRREYCRR  103

Query  596  NFNT-LSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPL  420
            N N  LS+HNFAA++PGDSVAG+VV NGI+NFLNIYN+LLVVRLVLTWFPN+PPAIVSPL
Sbjct  104  NMNNYLSNHNFAAVLPGDSVAGLVVANGIINFLNIYNTLLVVRLVLTWFPNSPPAIVSPL  163

Query  419  STLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPH  240
            STLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP      R     
Sbjct  164  STLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTATALPAELPENGASPRSRSSP  223

Query  239  TMEPXLTMSQRKWMRRRSAGNRPKSAGG  156
             +   LT +Q+KWMRR + GN+ KS+ G
Sbjct  224  NLFTHLTTAQKKWMRRLN-GNKSKSSPG  250



>gb|KHG08512.1| putative ycf19 [Gossypium arboreum]
Length=279

 Score =   249 bits (636),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 142/245 (58%), Positives = 168/245 (69%), Gaps = 25/245 (10%)
 Frame = -2

Query  869  SNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLH  690
            S+  I  PF APP+  PS      KPNL    + E+    +R  H S+VS ADN L SL 
Sbjct  51   SSAFIQTPF-APPILKPS------KPNL----VPEN---LIRDLHHSIVSTADNFLNSLQ  96

Query  689  SLLSQNPFFKNLLSLSSHLQDIRQIERRARQ------NFNTLSSHNFAAIIPGDSVAGIV  528
                QNP FKN++SLS+  Q      +  R       N++ +S+HNFAA++PGDSVAG+V
Sbjct  97   ----QNPVFKNIISLSTEFQSFFNEVKTCRNEYVNIMNYSPVSNHNFAAVLPGDSVAGVV  152

Query  527  VTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDL  348
            V NGILNFLNIYN+LL+VRLVLTWFPN+PPAIVSPLST+CDPYLNIFRGIIPPLGGTLDL
Sbjct  153  VANGILNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTICDPYLNIFRGIIPPLGGTLDL  212

Query  347  SPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSAGNRPK  168
            SPILAFLVLNAFTSTA ALP ELP      R     ++   LT SQ+KWMRR +   R K
Sbjct  213  SPILAFLVLNAFTSTAAALPVELPVAGQPLRRASSPSLFTALTSSQKKWMRRLNES-RSK  271

Query  167  SAGGN  153
            S+  N
Sbjct  272  SSKSN  276



>ref|XP_007012427.1| YGGT family protein [Theobroma cacao]
 gb|EOY30046.1| YGGT family protein [Theobroma cacao]
Length=267

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 167/244 (68%), Gaps = 22/244 (9%)
 Frame = -2

Query  869  SNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLH  690
            S+  I  PF APP   PS      KPNL  +         +R  H +VVS AD       
Sbjct  38   SSAFIQTPF-APPHLRPS------KPNLAPVV----PQNIIRDLHDAVVSTADK----FF  82

Query  689  SLLSQNPFFKNLLSLSSHLQDI------RQIERRARQNFNTLSSHNFAAIIPGDSVAGIV  528
            + L QNP FKNLLSLSS  Q         +I  R   N++ LS+HNFAA++PGDSVAGIV
Sbjct  83   NFLKQNPAFKNLLSLSSDFQSFCNEVTTYRINSRKVNNYSPLSNHNFAAVLPGDSVAGIV  142

Query  527  VTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDL  348
            V NGILNFLNIYN+LL+VRLVLTWFPN+PPAIVSPLST+CDPYLNIFRGIIPPLGGTLDL
Sbjct  143  VANGILNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTICDPYLNIFRGIIPPLGGTLDL  202

Query  347  SPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSAGNRPK  168
            SPILAFLVLNAF+STA ALPAELP      +     ++   LT SQ+KWMRR + G+R K
Sbjct  203  SPILAFLVLNAFSSTAAALPAELPVAGQPPKSASSPSLFTDLTSSQKKWMRRLN-GSRSK  261

Query  167  SAGG  156
            S+ G
Sbjct  262  SSNG  265



>gb|KJB07394.1| hypothetical protein B456_001G019900 [Gossypium raimondii]
Length=278

 Score =   247 bits (630),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/245 (58%), Positives = 167/245 (68%), Gaps = 25/245 (10%)
 Frame = -2

Query  869  SNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLH  690
            S+  I  PF APP+  PS      KPNL    + E+    +R  H S+VS ADN L SL 
Sbjct  50   SSAFIQTPF-APPILKPS------KPNL----VPEN---LIRDLHHSIVSTADNFLNSLQ  95

Query  689  SLLSQNPFFKNLLSLSSHLQDIRQIERRARQ------NFNTLSSHNFAAIIPGDSVAGIV  528
                QNP FKN++SLS+  Q      +  R       N++ +S+HNFAA++PGDSVAG+V
Sbjct  96   ----QNPVFKNIISLSTEFQSFFNEVKTCRNQYVKIMNYSPVSNHNFAAVLPGDSVAGVV  151

Query  527  VTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDL  348
            V NGI NFLNIYN+LL+VRLVLTWFPN+PPAIVSPLST+CDPYLNIFRGIIPPLGGTLDL
Sbjct  152  VANGIQNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTICDPYLNIFRGIIPPLGGTLDL  211

Query  347  SPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSAGNRPK  168
            SPILAFLVLNAFTSTA ALP ELP      R     ++   LT SQ+KWMRR +   R K
Sbjct  212  SPILAFLVLNAFTSTAAALPVELPVAGQPLRRASSPSLFTALTSSQKKWMRRLNES-RSK  270

Query  167  SAGGN  153
            S+  N
Sbjct  271  SSKSN  275



>ref|XP_012077192.1| PREDICTED: uncharacterized protein LOC105638080 [Jatropha curcas]
 gb|KDP34026.1| hypothetical protein JCGZ_07597 [Jatropha curcas]
Length=243

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 148/197 (75%), Gaps = 2/197 (1%)
 Frame = -2

Query  749  VRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQD-IRQIERRARQNFNTLSSH  573
            +   H+S+ S AD CL+ LH   S+NP  K + SL S   + + QI+ + + N  ++S+H
Sbjct  47   IHELHTSLTSTADKCLRFLHLFASENPILKRIFSLPSDFSNHLAQIQCKNKCNGKSVSNH  106

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLN  393
             FAAI+PGDSVAG+VV NGILNFLNIYN+LL+VRLVLTWFPN+PPAIVSPLST+CDPYLN
Sbjct  107  KFAAILPGDSVAGVVVANGILNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTICDPYLN  166

Query  392  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMS  213
            IFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP          P T    LT S
Sbjct  167  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPKTNASQGRCTPQTSFSNLTTS  226

Query  212  QRKWMRRRSAGNRPKSA  162
            Q+KWMRR   GN+  S+
Sbjct  227  QKKWMRRL-YGNKSHSS  242



>gb|KJB07395.1| hypothetical protein B456_001G019900 [Gossypium raimondii]
Length=254

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/245 (58%), Positives = 167/245 (68%), Gaps = 25/245 (10%)
 Frame = -2

Query  869  SNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLH  690
            S+  I  PF APP+  PS      KPNL    + E+    +R  H S+VS ADN L SL 
Sbjct  26   SSAFIQTPF-APPILKPS------KPNL----VPEN---LIRDLHHSIVSTADNFLNSLQ  71

Query  689  SLLSQNPFFKNLLSLSSHLQDIRQIERRARQ------NFNTLSSHNFAAIIPGDSVAGIV  528
                QNP FKN++SLS+  Q      +  R       N++ +S+HNFAA++PGDSVAG+V
Sbjct  72   ----QNPVFKNIISLSTEFQSFFNEVKTCRNQYVKIMNYSPVSNHNFAAVLPGDSVAGVV  127

Query  527  VTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDL  348
            V NGI NFLNIYN+LL+VRLVLTWFPN+PPAIVSPLST+CDPYLNIFRGIIPPLGGTLDL
Sbjct  128  VANGIQNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTICDPYLNIFRGIIPPLGGTLDL  187

Query  347  SPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSAGNRPK  168
            SPILAFLVLNAFTSTA ALP ELP      R     ++   LT SQ+KWMRR +   R K
Sbjct  188  SPILAFLVLNAFTSTAAALPVELPVAGQPLRRASSPSLFTALTSSQKKWMRRLNES-RSK  246

Query  167  SAGGN  153
            S+  N
Sbjct  247  SSKSN  251



>ref|XP_009414813.1| PREDICTED: uncharacterized protein LOC103995830 [Musa acuminata 
subsp. malaccensis]
Length=251

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  737  HSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAI  558
            HSS++SAA+ C+K+L + LS++PFFK LLS  S LQ   Q+  R+ +  +  S H+FAAI
Sbjct  57   HSSLLSAAERCVKTLAAALSEHPFFKPLLSTHSELQRFCQMRFRSPRFVSLPSGHSFAAI  116

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAG+VVTNGI+NFLNIYN+LL+VRLVLTWFPN+PPAIVSPLST+CDPYLNIFRGI
Sbjct  117  LPGDSVAGLVVTNGIINFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTICDPYLNIFRGI  176

Query  377  IPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWM  198
            IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP      R+         LT +Q KW+
Sbjct  177  IPPLGGTLDLSPILAFLVLNAFTSTATALPAELPGAITSQRNTCKQHWSFSLTTTQEKWL  236

Query  197  RR  192
            RR
Sbjct  237  RR  238



>ref|XP_008802450.1| PREDICTED: uncharacterized protein LOC103716288 [Phoenix dactylifera]
Length=250

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  SVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAIIP  552
            S++SAA+  L+SL + +S NP  K LLSL S L+   Q+     +N N L +H FAAI+P
Sbjct  58   SLLSAAERFLRSLGAAVSGNPLLKPLLSLHSDLRSFGQVHCGKHRNHNLLKAHGFAAILP  117

Query  551  GDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIP  372
            GDSVAG+VV NGI NFLNIYN+LLVVRLVLTWFPN+PPAIVSPLSTLCDPYLNIFRGIIP
Sbjct  118  GDSVAGLVVANGITNFLNIYNTLLVVRLVLTWFPNSPPAIVSPLSTLCDPYLNIFRGIIP  177

Query  371  PLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRR  192
            PLGGTLDLSPILAF+VLNAFTSTA ALPAELP  T   ++   H M   LT +Q KWMRR
Sbjct  178  PLGGTLDLSPILAFIVLNAFTSTAAALPAELPVTTTTQQNTLSHPMTANLTTTQEKWMRR  237



>gb|EYU20294.1| hypothetical protein MIMGU_mgv1a012313mg [Erythranthe guttata]
Length=254

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 157/236 (67%), Gaps = 12/236 (5%)
 Frame = -2

Query  851  LPFYAPPLF-----HPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHS  687
            LPF +PPL      +  FFR  S PN   L +   +S  VR    S+    D CL+ L +
Sbjct  24   LPFSSPPLILNFIHNTPFFRQASIPNPNFLPLLAQTSNVVRELQKSIACNVDKCLEMLVN  83

Query  686  LLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILN  507
              SQN     ++S SS+LQ   QI  R R+N   LS  NFAAI+PGD++AG+VV NG+ N
Sbjct  84   FRSQNSVLDKIMSFSSYLQHGCQIPIRHRRNMPLLSDSNFAAILPGDAMAGLVVANGLSN  143

Query  506  FLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  327
            FLNIYN+LLVVRLVLTWFPNAPP +VSPLSTLCDPYLNIFRG+IPPLGG LDLSP+LAFL
Sbjct  144  FLNIYNTLLVVRLVLTWFPNAPPQVVSPLSTLCDPYLNIFRGLIPPLGG-LDLSPVLAFL  202

Query  326  VLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSAGNRPKSAG  159
            VLNAFTSTA ALPAEL P T  S+D     M    T SQ KWM R SA    +  G
Sbjct  203  VLNAFTSTAAALPAEL-PSTEASKD-----MPSRFTASQNKWMTRLSANKSKRHTG  252



>ref|XP_003522302.1| PREDICTED: uncharacterized protein LOC100802756 [Glycine max]
 gb|KHN29677.1| Putative membrane protein ylmG [Glycine soja]
Length=244

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 149/197 (76%), Gaps = 7/197 (4%)
 Frame = -2

Query  740  FHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAA  561
             H+S  +AADN  + +HSL SQNPF   +LSL +    +  ++ R ++N   +SSHNFAA
Sbjct  52   LHTSFTTAADNFFRFVHSLASQNPFLNKVLSLPAEFHTL-CVQIRKQRNVGLVSSHNFAA  110

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRG  381
            ++PG SVAG+VV NG+LNFLNIYN+LL+VRLVLTWFPN PP+IVSPLST+CDPYLNIFRG
Sbjct  111  VLPGGSVAGLVVANGVLNFLNIYNTLLIVRLVLTWFPNTPPSIVSPLSTICDPYLNIFRG  170

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX-LTMSQRK  204
            +IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP    V+         P   T SQ+K
Sbjct  171  LIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELP----VTEQSKQGLAAPLPSTTSQKK  226

Query  203  WMRRRSAGNRPKSAGGN  153
            WMRR   GNR +++G +
Sbjct  227  WMRRFQ-GNRSRTSGDD  242



>ref|XP_006452990.1| hypothetical protein CICLE_v10009264mg [Citrus clementina]
 gb|ESR66230.1| hypothetical protein CICLE_v10009264mg [Citrus clementina]
Length=254

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 166/259 (64%), Gaps = 13/259 (5%)
 Frame = -2

Query  926  MNSHCSSDEALQERQKPVQSNC-LISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRA  750
            M S+ SS E  + R K + S+C L+S  F   P   P F     KP L    +   S   
Sbjct  1    MASNESSAENAECRDKKIVSSCMLLSSAFSQTPFVQPFF-----KPLLARNTVPVASPNI  55

Query  749  VRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSH  573
            +R   +SV+S  D   K L+SL S NP  +  LSLS+       Q+  R     N L +H
Sbjct  56   IRDLQNSVISTTDKVSKFLNSLASHNPLIQKFLSLSTEFHSFCHQVRCRNNVKMNPLGNH  115

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLN  393
            NFAA++PGDSV G+VV NGI++FLNIYN+LL+VRLVLTWFPN+PPAIVSPLSTLCDPYLN
Sbjct  116  NFAAVLPGDSVGGLVVANGIMSFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTLCDPYLN  175

Query  392  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDD----XPHTMEPX  225
            IFRGIIPPLGGTLDLSPILAFLVLNA TS A ALP EL P TG++        P  +   
Sbjct  176  IFRGIIPPLGGTLDLSPILAFLVLNAITSAAAALPCEL-PVTGLASQQAASPAPIPVSTN  234

Query  224  LTMSQRKWMRRRSAGNRPK  168
            LT  Q+KW+RR S  NR K
Sbjct  235  LTTPQKKWIRRLS-NNRGK  252



>ref|XP_010420979.1| PREDICTED: uncharacterized protein LOC104706478 [Camelina sativa]
Length=250

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 158/221 (71%), Gaps = 16/221 (7%)
 Frame = -2

Query  800  SKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH---LQ  630
            SKPNL LL  A DS + ++ FH S+VSA +     +HSL S+NP F+  + LSS    L 
Sbjct  41   SKPNLLLLPQAADSVKMIQDFHRSLVSATEKFSGFVHSLASKNPLFQEAVRLSSEFRVLC  100

Query  629  DIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFP  450
            D  ++   +R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP
Sbjct  101  DEIRLRNTSRVRF-AMSNHGFAAVLPGDSVAGLVVANGLINFLNIYNTILVVRLVLTWFP  159

Query  449  NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPP  270
            +APPAIV+PLSTLCDPYLN+FRG IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP 
Sbjct  160  SAPPAIVNPLSTLCDPYLNVFRGFIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPPA  218

Query  269  TGVSRDDXPHTMEPXLTMSQRKWMRRR--SAGNRPKSAGGN  153
             G +         P  +  + KWMRRR  S  +RP SA  N
Sbjct  219  EGAA---------PSPSSGETKWMRRRRLSKDHRPTSASMN  250



>ref|XP_007136887.1| hypothetical protein PHAVU_009G082300g [Phaseolus vulgaris]
 gb|ESW08881.1| hypothetical protein PHAVU_009G082300g [Phaseolus vulgaris]
Length=245

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  743  RFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFA  564
            + H+S  +AAD+    LH+L SQNPF   ++SL S    +  ++ R   +  ++ +HNFA
Sbjct  50   QLHTSFTTAADHFFTLLHTLASQNPFLNKIISLQSQFHTLC-VQIRKHGSVRSVGNHNFA  108

Query  563  AIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFR  384
            A++PGDSVAG+VV NG+ NFLNIYN+LL+VRLVLTWFPNAPP+IVSPLST+CDPYLNIFR
Sbjct  109  AVLPGDSVAGLVVANGVSNFLNIYNTLLIVRLVLTWFPNAPPSIVSPLSTICDPYLNIFR  168

Query  383  GIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRK  204
            G+IPPLGGTLDLSPILAFLVLNAFTSTA A+PAELP      +           + SQ+K
Sbjct  169  GLIPPLGGTLDLSPILAFLVLNAFTSTAAAIPAELPTTEQSQQGLATPLQASNFSTSQKK  228

Query  203  WMRRRSAGNRPKSAGGNK  150
            WMRR   GN+ +++GG K
Sbjct  229  WMRRL-LGNKSRTSGGAK  245



>ref|XP_006474498.1| PREDICTED: uncharacterized protein LOC102618998 [Citrus sinensis]
 dbj|BAK61878.1| YGGT family protein [Citrus unshiu]
 gb|KDO73633.1| hypothetical protein CISIN_1g025356mg [Citrus sinensis]
Length=254

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 165/259 (64%), Gaps = 13/259 (5%)
 Frame = -2

Query  926  MNSHCSSDEALQERQKPVQSNC-LISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRA  750
            M S+ SS E  + R K + S+C L+S  F   P   P F     KP L    +   S   
Sbjct  1    MASNESSAENAECRDKKIVSSCMLLSSAFSQTPFVQPFF-----KPLLARNTVPVASPNI  55

Query  749  VRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSH  573
            +R   +SV+S  D   K L+SL S NP  +  LSLS+       Q+  R     N L +H
Sbjct  56   IRDLQNSVISITDKVSKFLNSLASHNPLIQKFLSLSAEFHSFCHQVRCRNNVKMNPLGNH  115

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLN  393
            NFAA++PGDSV G+VV NGI++FLNIYN+LL+VRLVLTWFPN+PPAIVSPLSTLCDPYLN
Sbjct  116  NFAAVLPGDSVGGLVVANGIMSFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTLCDPYLN  175

Query  392  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPH----TMEPX  225
            IFRGIIPPLGGTLDLSPILAFLVLNA TS A ALP EL P TG++           +   
Sbjct  176  IFRGIIPPLGGTLDLSPILAFLVLNAITSAAAALPCEL-PVTGLASQQAASPASIPVSTN  234

Query  224  LTMSQRKWMRRRSAGNRPK  168
            LT  Q+KW+RR S  NR K
Sbjct  235  LTTPQKKWIRRLS-NNRGK  252



>ref|XP_010454454.1| PREDICTED: uncharacterized protein LOC104736203 [Camelina sativa]
Length=249

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 155/221 (70%), Gaps = 17/221 (8%)
 Frame = -2

Query  800  SKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH---LQ  630
            SKPNL LL  A DS + ++ FH S+VSA +      HSL S+NP F+  + LSS    L 
Sbjct  41   SKPNLLLLPQAADSVKMIQDFHRSLVSATEKFSGFFHSLASKNPLFQEAVRLSSEFRVLC  100

Query  629  DIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFP  450
            D  ++   +R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP
Sbjct  101  DEIRLRNTSRVRF-AMSNHGFAAVLPGDSVAGLVVANGLINFLNIYNTILVVRLVLTWFP  159

Query  449  NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPP  270
            +APPAIV+PLSTLCDPYLN+FRG IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP 
Sbjct  160  SAPPAIVNPLSTLCDPYLNVFRGFIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPPA  218

Query  269  TGVSRDDXPHTMEPXLTMSQRKWMRRR--SAGNRPKSAGGN  153
             G +      T          KWMRRR  S  +RP SA  N
Sbjct  219  EGAASPSSCET----------KWMRRRRLSKDHRPTSASMN  249



>ref|XP_010939914.1| PREDICTED: uncharacterized protein LOC105058630 [Elaeis guineensis]
Length=250

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 153/226 (68%), Gaps = 8/226 (4%)
 Frame = -2

Query  869  SNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLH  690
            SNCL+S  F   P      F H   P    +     S RA R    S +SAA+  L+SL 
Sbjct  20   SNCLLSSAFRHLP------FSHPLPPPKPSVPDHTASDRAPRPL--SPLSAAERFLRSLG  71

Query  689  SLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGIL  510
            + +S +P  K  LSL S L+   Q+      N + L +H FAAI+PGDSVAG+VV NGI 
Sbjct  72   AAVSGHPLLKPFLSLHSDLRIFLQVRCGNHWNHSMLKAHGFAAILPGDSVAGLVVANGIT  131

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            NFLNIYN+LLVVRLVLTWFPN+PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF
Sbjct  132  NFLNIYNTLLVVRLVLTWFPNSPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  191

Query  329  LVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRR  192
            +VLN FTSTA ALPAELP  T   ++   H M   LT +Q KWMRR
Sbjct  192  IVLNVFTSTAAALPAELPVTTTTQQNTLSHPMTTNLTTTQEKWMRR  237



>ref|XP_010669316.1| PREDICTED: uncharacterized protein LOC104886561 [Beta vulgaris 
subsp. vulgaris]
Length=249

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 135/228 (59%), Positives = 160/228 (70%), Gaps = 11/228 (5%)
 Frame = -2

Query  866  NCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHS  687
            N L   P  AP      FF   SKP      +A      +  FH ++ S AD CL+ LH 
Sbjct  19   NLLAIFPVIAPTFSPQQFF---SKPTS---NVALSPVEVLHNFHKTIASTADKCLQFLHF  72

Query  686  LLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILN  507
              +QNPF   LLS SS++ +  Q+  R+ ++ N+LSSHNFAA++PGDSVAGIVVTNGILN
Sbjct  73   SATQNPFLNKLLSFSSYIHNFSQVHCRSHKSLNSLSSHNFAAVLPGDSVAGIVVTNGILN  132

Query  506  FLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  327
            FLNIYN+LLVVRLVLTWFP+APP IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL
Sbjct  133  FLNIYNTLLVVRLVLTWFPSAPPQIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  192

Query  326  VLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX---LTMSQRKWMRR  192
            +LNAFTS A ALPAEL  P  +   +   +++P    LT SQ+KW  R
Sbjct  193  LLNAFTSAAAALPAEL--PPAMVSHEGSQSLKPGLSDLTSSQKKWQTR  238



>ref|NP_001240890.1| uncharacterized protein LOC100791676 [Glycine max]
 gb|ACU19765.1| unknown [Glycine max]
 gb|KHN32169.1| Putative membrane protein ylmG [Glycine soja]
Length=234

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 145/198 (73%), Gaps = 2/198 (1%)
 Frame = -2

Query  746  RRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNF  567
            +  H+S  +AADN  + LHSL S N F   +LSL S    +  ++   ++N   +S HNF
Sbjct  37   QHLHTSFTTAADNFFRFLHSLASHNSFLNKILSLPSEFHTL-CVQIGKQRNVRLVSGHNF  95

Query  566  AAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIF  387
            AA++PGDSVAG+VV NG+LNFLNIYN+LL+VRLVLTWFPN PP+IVSPLST+CDPYLNIF
Sbjct  96   AAVLPGDSVAGLVVANGVLNFLNIYNTLLIVRLVLTWFPNTPPSIVSPLSTICDPYLNIF  155

Query  386  RGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQR  207
            RG+IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP      +          LT SQ+
Sbjct  156  RGLIPPLGGTLDLSPILAFLVLNAFTSTASALPAELPVTEQSKQGLAAPLHSTNLTTSQK  215

Query  206  KWMRRRSAGNRPKSAGGN  153
            KW+ R   GNR +++G +
Sbjct  216  KWLTRFQ-GNRSRTSGAD  232



>ref|XP_006288523.1| hypothetical protein CARUB_v10001794mg [Capsella rubella]
 gb|EOA21421.1| hypothetical protein CARUB_v10001794mg [Capsella rubella]
Length=251

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 155/223 (70%), Gaps = 19/223 (9%)
 Frame = -2

Query  800  SKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH---LQ  630
            SKPNL LL  A DS + ++ FH S+VSA +     +HSL S+NP F+  + LSS    L 
Sbjct  41   SKPNLLLLPQAADSVKMIQDFHRSLVSATEKFSGFVHSLASKNPLFQEAVRLSSEFRVLC  100

Query  629  DIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFP  450
            D  ++   +R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP
Sbjct  101  DEIRLRNTSRVRF-AMSNHGFAAVLPGDSVAGLVVANGLINFLNIYNTILVVRLVLTWFP  159

Query  449  NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPP  270
            +APPAIV+PLSTLCDPYLNIFRG IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP 
Sbjct  160  SAPPAIVNPLSTLCDPYLNIFRGFIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPPA  218

Query  269  TGVSRDDXPHTMEPXLTMSQRKWMRRRS----AGNRPKSAGGN  153
             G +      T          KWMRRR       +RP SA  N
Sbjct  219  EGAASPSSGET----------KWMRRRRLSSHKDHRPSSASMN  251



>ref|XP_010493251.1| PREDICTED: uncharacterized protein LOC104770515 [Camelina sativa]
Length=252

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 153/221 (69%), Gaps = 19/221 (9%)
 Frame = -2

Query  800  SKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQ---  630
            SKPNL LL  A DS + ++ FH S+VSA +      HSL S+NP F+  + LSS  +   
Sbjct  41   SKPNLLLLPQAADSVKMIQDFHRSLVSATEKFSGFFHSLASKNPLFQEAVRLSSEFRVLC  100

Query  629  -DIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWF  453
             +IR   + A +    +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWF
Sbjct  101  DEIRLKNQDATRVRFAMSNHGFAAVLPGDSVAGLVVANGLINFLNIYNTILVVRLVLTWF  160

Query  452  PNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPP  273
            P+APPAIV+PLSTLCDPYLN+FRG IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP
Sbjct  161  PSAPPAIVNPLSTLCDPYLNVFRGFIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPP  219

Query  272  PTGVSRDDXPHTMEPXLTMSQRKWMRRRS----AGNRPKSA  162
              G +      T          KWMRRR       +RP SA
Sbjct  220  AEGAASPSSGET----------KWMRRRRLSSHKDHRPSSA  250



>ref|XP_006400697.1| hypothetical protein EUTSA_v10014336mg [Eutrema salsugineum]
 gb|ESQ42150.1| hypothetical protein EUTSA_v10014336mg [Eutrema salsugineum]
Length=279

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 156/222 (70%), Gaps = 19/222 (9%)
 Frame = -2

Query  797  KPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH---LQD  627
            KP+L LL+ A D+ ++++ FH  +VSA++  +   HSL S+NP F+  + LSS    L D
Sbjct  70   KPSLLLLQPASDAVKSIQDFHRCLVSASEKFVGLFHSLASRNPLFQEAVRLSSEFRVLCD  129

Query  626  IRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPN  447
              ++    R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP 
Sbjct  130  ESRLRNTTRVRF-AMSNHGFAAVLPGDSVAGMVVANGLINFLNIYNTILVVRLVLTWFPT  188

Query  446  APPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT  267
            APPAIVSPLSTLCDPYLNIFRG+IPPLGG LDLSPILAFLVLNAFTSTA ALP ELPP  
Sbjct  189  APPAIVSPLSTLCDPYLNIFRGVIPPLGG-LDLSPILAFLVLNAFTSTAMALPCELPPAD  247

Query  266  GVSRDDXPHTMEPXLTMSQRKWMRRRS----AGNRPKSAGGN  153
            G +    P + E        KWMRRR       +RP S   N
Sbjct  248  GAA---SPSSCE-------TKWMRRRRLSSHKDHRPSSTSMN  279



>gb|KFK26355.1| hypothetical protein AALP_AA8G237700 [Arabis alpina]
Length=251

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 154/222 (69%), Gaps = 19/222 (9%)
 Frame = -2

Query  797  KPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH---LQD  627
            KP+L LL    DS + ++ FH S+VSA +      HSL S+NP F+  + LSS    L D
Sbjct  42   KPSLLLLPPIADSVKLIQEFHRSMVSATEKFSGFFHSLASKNPLFQEAVRLSSEFHVLCD  101

Query  626  IRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPN  447
              ++    R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP+
Sbjct  102  EIRMRNATRVRF-AMSNHGFAAVLPGDSVAGMVVANGLINFLNIYNTILVVRLVLTWFPS  160

Query  446  APPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT  267
            APPAIVSPLSTLCDPYLNIFRG IPPLGG LDLSPILAFLVLNAFTSTA ALP ELPP  
Sbjct  161  APPAIVSPLSTLCDPYLNIFRGFIPPLGG-LDLSPILAFLVLNAFTSTAMALPCELPPAE  219

Query  266  GVSRDDXPHTMEPXLTMSQRKWMRRRS----AGNRPKSAGGN  153
            G        T  P  + S+ KWMRRR       +RP SA  N
Sbjct  220  G--------TASP--SSSETKWMRRRRLNSHKDHRPSSASTN  251



>ref|XP_002874035.1| YGGT family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50294.1| YGGT family protein [Arabidopsis lyrata subsp. lyrata]
Length=251

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 154/222 (69%), Gaps = 19/222 (9%)
 Frame = -2

Query  797  KPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH---LQD  627
            KPNL LL    DS + ++ FH S+VSA +      HSL S+NP F+  + LSS    L D
Sbjct  42   KPNLLLLPPVADSVKLIQDFHRSLVSATEKFSGFFHSLASKNPLFQEAVRLSSEFRLLCD  101

Query  626  IRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPN  447
              +++   R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP+
Sbjct  102  EIRLKNTTRVRF-AMSNHGFAAVLPGDSVAGLVVANGLINFLNIYNTILVVRLVLTWFPS  160

Query  446  APPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT  267
            APPAIV+PLSTLCDPYLNIFRG IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP  
Sbjct  161  APPAIVNPLSTLCDPYLNIFRGFIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPPAE  219

Query  266  GVSRDDXPHTMEPXLTMSQRKWMRRRS----AGNRPKSAGGN  153
            G             L+ S+ KWMRRR       +RP SA  N
Sbjct  220  GAV----------SLSSSETKWMRRRRLSSHKDHRPSSASMN  251



>ref|NP_001142613.1| uncharacterized protein LOC100274882 [Zea mays]
 gb|ACG25490.1| hypothetical protein [Zea mays]
 emb|CDX92395.1| BnaA10g14340D [Brassica napus]
Length=248

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 148/206 (72%), Gaps = 15/206 (7%)
 Frame = -2

Query  797  KPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQ  618
            KP+L+LL  A DS + ++ FH S++SA +      HSL ++NP F+  + LSS  + +  
Sbjct  42   KPSLRLLPPASDSVKLIQDFHRSLLSATEKFAGFFHSLAAENPLFQEAVRLSSEFRGVCD  101

Query  617  IERRARQNFNT---LSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPN  447
             E R R        +S H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP 
Sbjct  102  -EIRLRNTTRVRLAMSDHGFAAVLPGDSVAGMVVANGLINFLNIYNTVLVVRLVLTWFPT  160

Query  446  APPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT  267
            APPAIV+PLSTLCDPYLNIFRG+IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP  
Sbjct  161  APPAIVNPLSTLCDPYLNIFRGVIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPPAE  219

Query  266  GVSRDDXPHTMEPXLTMSQRKWMRRR  189
            GV+    P + E        KWMRRR
Sbjct  220  GVT---SPSSCE-------TKWMRRR  235



>ref|XP_008445540.1| PREDICTED: uncharacterized protein LOC103488523 [Cucumis melo]
Length=253

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 151/219 (69%), Gaps = 1/219 (0%)
 Frame = -2

Query  827  FHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLS  648
            F P+F +  S P+ +           +R  H S  S  ++C++  HS  S+NPF   LLS
Sbjct  28   FSPAFSQTPSGPSRRRQPEFASPCNFLRDLHESFASTTESCIRLFHSFASENPFLHKLLS  87

Query  647  LSSHLQDIR-QIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVR  471
            L S  Q  R QI     +NF  LSSHNFAA++PGDS+AG+VV NGI NFL++YN+LLVVR
Sbjct  88   LPSEFQSFRFQIHSMNSRNFRALSSHNFAAVLPGDSMAGLVVANGIQNFLSLYNTLLVVR  147

Query  470  LVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFAL  291
            LVLTWFPN PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTA AL
Sbjct  148  LVLTWFPNTPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAAAL  207

Query  290  PAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSAGNR  174
            PAELP P     +  P      LT SQ+KWMRR     +
Sbjct  208  PAELPAPNSSLANPNPLEGSVDLTSSQKKWMRRLQGSGK  246



>ref|XP_009362782.1| PREDICTED: uncharacterized protein LOC103952817 [Pyrus x bretschneideri]
Length=252

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 141/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  740  FHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSHNFA  564
              +S+ SAAD C + LHSL++QNP    L+SL    Q I  QI  R  +    LS+HNFA
Sbjct  52   IQASIASAADKCSQLLHSLVTQNPLLSKLISLRCEFQSICHQIGCRKNKQVKALSAHNFA  111

Query  563  AIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFR  384
            A++PGDSVAG+VV NGI NFLN+YN+LLVVRLVLTWFPN+PPAIV PLST+CDPYLNIFR
Sbjct  112  AVLPGDSVAGLVVANGISNFLNLYNTLLVVRLVLTWFPNSPPAIVGPLSTICDPYLNIFR  171

Query  383  GIIPPLGGTLDLSPILAFLVLNAFTST-AFALPAELPPPTGVSRDDXPH--TMEPXLTMS  213
            G+IPPLGG+LDLSPILAFLVLNAFTST A         P+ V+  +     T    L++ 
Sbjct  172  GLIPPLGGSLDLSPILAFLVLNAFTSTAAALPAELPASPSSVASQELTASPTGIANLSIC  231

Query  212  QRKWMRRRSAGNRPKSAGG  156
            Q+KWM R    N  KS+GG
Sbjct  232  QKKWMTRLQGHNSTKSSGG  250



>emb|CDY16604.1| BnaC09g36690D [Brassica napus]
Length=265

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 147/207 (71%), Gaps = 17/207 (8%)
 Frame = -2

Query  797  KPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQ----  630
            KP+ QLL  A DS + ++ FH S++SA +      HSL ++NP F+  + LSS  +    
Sbjct  59   KPSSQLLAPASDSVKLIQDFHRSLLSATEKFAGFFHSLAAKNPLFQEAVRLSSGFRGVCD  118

Query  629  DIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFP  450
            DIR +    R  F  +S H FAA++PGDSVAG VV NG++NFLNIYN++LVVRLVLTWFP
Sbjct  119  DIR-LRNTTRVRF-AMSDHGFAAVLPGDSVAGTVVANGLINFLNIYNTVLVVRLVLTWFP  176

Query  449  NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPP  270
             APPAIV+PLSTLCDPYLNIFRG+IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP 
Sbjct  177  TAPPAIVNPLSTLCDPYLNIFRGVIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPPA  235

Query  269  TGVSRDDXPHTMEPXLTMSQRKWMRRR  189
             G +    P + E        KWMRRR
Sbjct  236  EGAA---SPSSCE-------TKWMRRR  252



>ref|XP_008220572.1| PREDICTED: uncharacterized protein LOC103320643 [Prunus mume]
Length=246

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 146/201 (73%), Gaps = 20/201 (10%)
 Frame = -2

Query  734  SSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSHNFAAI  558
            +S+ SA D CL+ LHSL SQNPF   LLSL S  Q +  QI  R  +    LS+HNFAA+
Sbjct  54   ASIASATDKCLQLLHSLASQNPFLSKLLSLRSEFQSLCHQIRCRKHRQVEILSAHNFAAV  113

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAG+VV NGI NFLN+YN+LLVVRLVLTWFPN+PPAIV PLST+CDPYLNIFRG+
Sbjct  114  LPGDSVAGLVVANGISNFLNLYNTLLVVRLVLTWFPNSPPAIVGPLSTICDPYLNIFRGL  173

Query  377  IPPLGGTLDLSPILAFLVLNAFTSTAFALPAEL--------PPPTGVSRDDXPHTMEPXL  222
            IPPLGGTLDLSPILAFLVLNAFTSTA ALPAEL          P G++           L
Sbjct  174  IPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPASSQQVTASPAGITN----------L  223

Query  221  TMSQRKWMRRRSAGNRPKSAG  159
            + SQ+KWM R   GN  KS+G
Sbjct  224  STSQKKWMTRLQ-GNNTKSSG  243



>ref|XP_002516142.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46144.1| conserved hypothetical protein [Ricinus communis]
Length=216

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 133/194 (69%), Gaps = 35/194 (18%)
 Frame = -2

Query  752  AVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSH  573
            A+R  H+S+ S AD C K LH                            A  N N LS+H
Sbjct  50   ALRELHTSLASTADKCFKILH---------------------------LAYSNSNYLSNH  82

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLN  393
            NFAA++PGDSVAGIVV NGILNFLNIYN+LL+VRLVLTWFPN+PPAIVSPLSTLCDPYLN
Sbjct  83   NFAAVLPGDSVAGIVVANGILNFLNIYNTLLIVRLVLTWFPNSPPAIVSPLSTLCDPYLN  142

Query  392  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMS  213
            IFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP            T+    T S
Sbjct  143  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELP-------GKGASTLHTRFTTS  195

Query  212  QRKWMRRRSAGNRP  171
            Q+KWMRR   GN+P
Sbjct  196  QQKWMRRL-YGNKP  208



>ref|XP_010520479.1| PREDICTED: uncharacterized protein LOC104799578 [Tarenaya hassleriana]
Length=246

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = -2

Query  800  SKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-  624
            +KPNL LL  A +SS  +   H S+V A +     +HSL S+NP F+  + LSS LQ + 
Sbjct  41   TKPNLLLLPPACESSNVIHDLHRSLVKATEKFSGFVHSLASRNPLFQKAVLLSSELQALC  100

Query  623  RQIERRARQNFN-TLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPN  447
             +I  +  +     LS+H FAA++PGDSVAG+VV NG++NF NIYNSLLVVRLVLTWFPN
Sbjct  101  HEIRSKNPKMVRLQLSNHGFAAVLPGDSVAGMVVANGLMNFFNIYNSLLVVRLVLTWFPN  160

Query  446  APPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT  267
             PPAIVSPLST+CDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALP ELPP  
Sbjct  161  TPPAIVSPLSTICDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAAALPCELPPAE  220

Query  266  G  264
            G
Sbjct  221  G  221



>emb|CDX88822.1| BnaA03g08270D [Brassica napus]
Length=251

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 162/242 (67%), Gaps = 25/242 (10%)
 Frame = -2

Query  857  ISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLS  678
            +S  F   PL  P+      KP+L LL  A DS + ++  H S+VS  +      HSL S
Sbjct  28   LSSAFTQTPLVRPN------KPSLLLLPPASDSVKLIQDLHRSLVSVTEKFSGFFHSLAS  81

Query  677  QNPFFKNLLSLSSH---LQDIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILN  507
            +NP F+  + LSS    L D  ++    R +F  +++H FAA++PGDSVAG+VV NG++N
Sbjct  82   RNPLFQEAVRLSSQFRGLCDEIRLRNTTRVSF-AMANHGFAAVLPGDSVAGLVVANGLIN  140

Query  506  FLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  327
            FLNIY+++LVVRLVLTWFP APPAIVSPLSTLCDPYLNIFRG+IPPLGG LDLSPILAFL
Sbjct  141  FLNIYSNVLVVRLVLTWFPTAPPAIVSPLSTLCDPYLNIFRGVIPPLGG-LDLSPILAFL  199

Query  326  VLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRR----SAGNRPKSAG  159
            VLNAFTS+A ALP ELPP  G +    P ++E        KWMRRR    +  +RP SA 
Sbjct  200  VLNAFTSSAMALPCELPPAEGAA---SPSSLE-------TKWMRRRRLTSNKDHRPSSAS  249

Query  158  GN  153
             N
Sbjct  250  TN  251



>ref|XP_010047396.1| PREDICTED: uncharacterized protein LOC104436351 [Eucalyptus grandis]
 gb|KCW79308.1| hypothetical protein EUGRSUZ_C00730 [Eucalyptus grandis]
Length=262

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 152/221 (69%), Gaps = 5/221 (2%)
 Frame = -2

Query  821  PSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLS  642
            PS F    KP+    R +      +     SV SAAD CL  LH+  S++P  + +LSL 
Sbjct  40   PSSFSPAIKPHHHRRRHSHSHLLGLDALRQSVASAADGCLGFLHAFASRSPVVRKVLSLH  99

Query  641  SHLQDI-RQIERRARQNFNTLSSHNFAAIIPG-DSVAGIVVTNGILNFLNIYNSLLVVRL  468
            S  + I R+I  R   N    S HNFAA++PG DS+AG+VV NGI NFLNIYN+LLV RL
Sbjct  100  SDFRSICREIHCRNFGNVILPSGHNFAAVLPGGDSMAGLVVANGISNFLNIYNTLLVARL  159

Query  467  VLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALP  288
            VLTWFPNAPP IVSPLSTLCDPYLNIFRGIIPPLGG+LD SPILAFLVLN FTSTA ALP
Sbjct  160  VLTWFPNAPPVIVSPLSTLCDPYLNIFRGIIPPLGGSLDFSPILAFLVLNVFTSTAAALP  219

Query  287  AELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRRSAGNRPKS  165
            AEL PPT  S+++    +    T SQ+KWMRR   G++ KS
Sbjct  220  AEL-PPTLASQENAASCISSA-TTSQKKWMRRLH-GHKQKS  257



>emb|CDX70968.1| BnaC03g10520D [Brassica napus]
Length=251

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 161/242 (67%), Gaps = 25/242 (10%)
 Frame = -2

Query  857  ISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLS  678
            +S  F   PL  P+      KP+L LL  A DS + ++ FH S+VS  +      H L S
Sbjct  28   LSSAFTQTPLVRPN------KPSLLLLPPASDSVKLIQDFHRSLVSVTEKFTGFFHLLAS  81

Query  677  QNPFFKNLLSLSSH---LQDIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILN  507
            +NP F+  + LSS    L D  ++    R +F  +++H FAA++PGDSVAG+VV NG++N
Sbjct  82   RNPLFQEAVRLSSEFRGLCDEIRLRNTTRVSF-AIANHGFAAVLPGDSVAGLVVANGLIN  140

Query  506  FLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  327
            FLNIY+++LVVRLVLTWFP APPAIVSPLSTLCDPYLNIFRG+IPPLGG LDLSPILAFL
Sbjct  141  FLNIYSNVLVVRLVLTWFPTAPPAIVSPLSTLCDPYLNIFRGVIPPLGG-LDLSPILAFL  199

Query  326  VLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRR----SAGNRPKSAG  159
            VLNAFTS+A A+P ELPP  G      P ++E        KWMRRR    +  NRP SA 
Sbjct  200  VLNAFTSSAMAIPCELPPAEGAV---SPSSLE-------TKWMRRRRLTSNKENRPSSAS  249

Query  158  GN  153
             N
Sbjct  250  MN  251



>ref|XP_009131841.1| PREDICTED: uncharacterized protein LOC103856483 isoform X2 [Brassica 
rapa]
Length=251

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 162/242 (67%), Gaps = 25/242 (10%)
 Frame = -2

Query  857  ISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLS  678
            +S  F   PL  P+      KP+L LL  A DS + ++  H S+VS  +      HSL S
Sbjct  28   LSSAFTQTPLVRPN------KPSLLLLPPASDSVKLIQDLHRSLVSVTEKFSGFFHSLAS  81

Query  677  QNPFFKNLLSLSSH---LQDIRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILN  507
            +NP F+  + LSS    L D  ++    R +F  +++H FAA++PGDSVAG+VV NG++N
Sbjct  82   RNPLFQEAVRLSSEFRCLCDEIRLRNTTRVSF-AMANHGFAAVLPGDSVAGLVVANGLIN  140

Query  506  FLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  327
            FLNIY+++LVVRLVLTWFP APPAIVSPLSTLCDPYLNIFRG+IPPLGG LDLSPILAFL
Sbjct  141  FLNIYSNVLVVRLVLTWFPTAPPAIVSPLSTLCDPYLNIFRGVIPPLGG-LDLSPILAFL  199

Query  326  VLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRR----SAGNRPKSAG  159
            VLNAFTS+A ALP ELPP  G +    P ++E        KWMRRR    +  +RP SA 
Sbjct  200  VLNAFTSSAMALPCELPPAEGAA---SPSSLE-------TKWMRRRRLTSNKDHRPSSAS  249

Query  158  GN  153
             N
Sbjct  250  TN  251



>ref|XP_004144214.1| PREDICTED: uncharacterized protein LOC101210772 [Cucumis sativus]
 gb|KGN47583.1| hypothetical protein Csa_6G362410 [Cucumis sativus]
Length=253

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 141/193 (73%), Gaps = 1/193 (1%)
 Frame = -2

Query  749  VRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIR-QIERRARQNFNTLSSH  573
            +R  H S  S  ++C++  HSL S+NPF   LLSL S     R QI      NF  LSSH
Sbjct  54   LRHLHESFASTTESCIRLFHSLASENPFLHKLLSLPSEFHRFRYQIHGMNSMNFRALSSH  113

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLN  393
            NFAA++PGDS+AG+VV NGI NFL++YN+LLVVRLVLTWFPN PPAIVSPLSTLCDPYLN
Sbjct  114  NFAAVLPGDSMAGLVVANGIQNFLSLYNTLLVVRLVLTWFPNTPPAIVSPLSTLCDPYLN  173

Query  392  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMS  213
            IFRGIIPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP P     +  P      LT S
Sbjct  174  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPAPNSSLANPNPLKGSVDLTSS  233

Query  212  QRKWMRRRSAGNR  174
            Q+KWM+R     +
Sbjct  234  QKKWMKRLQGSEK  246



>ref|XP_003603213.1| hypothetical protein MTR_3g105100 [Medicago truncatula]
 gb|AES73464.1| YGGT family protein [Medicago truncatula]
Length=245

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 140/197 (71%), Gaps = 4/197 (2%)
 Frame = -2

Query  734  SSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQD-IRQIERRARQNFNTLSSH-NFAA  561
            +S+ +A DNC K LHSL SQNPF   LLSLSS   D   QI      N   +S+H NFAA
Sbjct  50   TSISNAVDNCSKLLHSLASQNPFLNKLLSLSSQFHDTCVQIRCSNYSNSRWVSNHHNFAA  109

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRG  381
            ++PGDSVAG+VV NG+ NFL++YN+LLV RLVLTWFPNAPPAIV+PLST+CDPYLN+FRG
Sbjct  110  VLPGDSVAGLVVANGLNNFLSLYNTLLVARLVLTWFPNAPPAIVAPLSTVCDPYLNVFRG  169

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX-LTMSQRK  204
            +IPPLGG LDLSPILAFLVLNAFTSTA ALPAELP      +       +P  +T SQ K
Sbjct  170  LIPPLGG-LDLSPILAFLVLNAFTSTAAALPAELPVTEQSKQGLEARLQQPTDVTSSQNK  228

Query  203  WMRRRSAGNRPKSAGGN  153
            WMRR        S   N
Sbjct  229  WMRRLQGIGSKTSTSAN  245



>ref|XP_009120708.1| PREDICTED: uncharacterized protein LOC103845594 [Brassica rapa]
Length=245

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 143/200 (72%), Gaps = 15/200 (8%)
 Frame = -2

Query  779  LRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRAR  600
            LR A DS + ++ FH S++SA +      HSL ++NP F+  + LSS  + +   E R R
Sbjct  45   LRPASDSVKLIQDFHRSLLSATEKFAGFFHSLAAENPLFQEAVRLSSEFRGVCD-EIRLR  103

Query  599  QNFNT---LSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIV  429
                    +S H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP APPAIV
Sbjct  104  NTTRVRLAMSDHGFAAVLPGDSVAGMVVANGLINFLNIYNTVLVVRLVLTWFPTAPPAIV  163

Query  428  SPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDD  249
            +PLSTLCDPYLNIFRG+IPPLGG LDLSPILAFLVLNAFTS+A ALP ELPP  GV+   
Sbjct  164  NPLSTLCDPYLNIFRGVIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPPAEGVT---  219

Query  248  XPHTMEPXLTMSQRKWMRRR  189
             P + E        KWMRRR
Sbjct  220  SPSSCE-------TKWMRRR  232



>ref|XP_008360949.1| PREDICTED: uncharacterized protein LOC103424631 [Malus domestica]
Length=252

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 138/197 (70%), Gaps = 4/197 (2%)
 Frame = -2

Query  734  SSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSHNFAAI  558
            +S+ SAA+ C + LHSL SQNP    L+SL    Q I  QI  R       LS+HNFAA+
Sbjct  54   ASIASAANKCSQLLHSLASQNPLLSKLISLRCEFQSICHQIGCRKNNQVKALSAHNFAAV  113

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAG+VV NGI NFLN+YN+LLVVRLVLTWFPN+PPAIV PLST+CDPYLNIFRG+
Sbjct  114  LPGDSVAGLVVANGISNFLNLYNTLLVVRLVLTWFPNSPPAIVGPLSTICDPYLNIFRGL  173

Query  377  IPPLGGTLDLSPILAFLVLNAFTST-AFALPAELPPPTGVSRDDXPH--TMEPXLTMSQR  207
            IPPLGG+LDLSPILAFLVLNAFTST A         P+ V+  +     T    L+  Q+
Sbjct  174  IPPLGGSLDLSPILAFLVLNAFTSTAAALPAELPASPSSVASQELTASPTEIANLSTCQK  233

Query  206  KWMRRRSAGNRPKSAGG  156
            KWM R    N  KS+GG
Sbjct  234  KWMTRLQGNNNTKSSGG  250



>ref|XP_004501430.1| PREDICTED: uncharacterized protein LOC101500659 [Cicer arietinum]
Length=242

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = -2

Query  734  SSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSHNFAAI  558
            +S+ +AA +    LHSL SQNPF   LLSLSS   +   QI     +N   L +HNFAA+
Sbjct  48   ASISNAAHHFSTLLHSLASQNPFLNKLLSLSSQFHNTCFQIRCSNFRNRRLLVNHNFAAV  107

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAG+VV NG+ NFL++YN+L++VRLVLTWFPNAPPAIV+PLST+CDPYLNIFRG+
Sbjct  108  LPGDSVAGLVVANGLQNFLSLYNTLIIVRLVLTWFPNAPPAIVTPLSTVCDPYLNIFRGL  167

Query  377  IPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWM  198
            IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP      +          +T SQ+KWM
Sbjct  168  IPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPVAEQSKQGLEARLQSTDVTSSQKKWM  227

Query  197  RR-RSAGNR  174
            RR R  G++
Sbjct  228  RRIREIGSK  236



>gb|ACJ84760.1| unknown [Medicago truncatula]
Length=245

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 140/197 (71%), Gaps = 4/197 (2%)
 Frame = -2

Query  734  SSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQD-IRQIERRARQNFNTLSSH-NFAA  561
            +S+ +A DNC K LHSL SQNPF   LLSLSS   D   QI      N   +S+H NFAA
Sbjct  50   TSISNAVDNCSKLLHSLASQNPFLNKLLSLSSQFHDTCVQIRCSNYSNSRWVSNHHNFAA  109

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRG  381
            ++PGDSVAG+VV NG+ NFL++YN+LLV RLVLTWFPNAPPAIV+PLST+CDPYLN+FRG
Sbjct  110  VLPGDSVAGLVVANGLNNFLSLYNTLLVARLVLTWFPNAPPAIVAPLSTVCDPYLNVFRG  169

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX-LTMSQRK  204
            +IPPLGG LDLSPILAFLVLNAFTSTA ALPAELP      +       +P  +T SQ K
Sbjct  170  LIPPLGG-LDLSPILAFLVLNAFTSTAAALPAELPVTEQSKQGLEARLQQPTDVTSSQNK  228

Query  203  WMRRRSAGNRPKSAGGN  153
            WMRR        S   N
Sbjct  229  WMRRLQGIGSKTSTSAN  245



>ref|NP_680180.1| protein YLMG2 [Arabidopsis thaliana]
 emb|CAC34485.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43053.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63329.1| At5g21920 [Arabidopsis thaliana]
 gb|AAO73904.1| expressed protein [Arabidopsis thaliana]
 gb|AED92954.1| YGGT family protein [Arabidopsis thaliana]
Length=251

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 152/219 (69%), Gaps = 19/219 (9%)
 Frame = -2

Query  797  KPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH---LQD  627
            KPNL LL    DS + ++ FH S++SA +     LHSL S+NP F+  + LSS    L D
Sbjct  42   KPNLLLLPPVADSVKLIQDFHQSLISATEKFKGFLHSLASKNPLFQEAVRLSSEFHILCD  101

Query  626  IRQIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPN  447
              ++    R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP+
Sbjct  102  EIRLRNTTRVRF-AMSNHGFAAVLPGDSVAGLVVANGLINFLNIYNTILVVRLVLTWFPS  160

Query  446  APPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPT  267
            APPAIV+PLSTLCDPYLNIFRG IPPLGG LDLSPILAFLVLNAFTS+A ALP ELP   
Sbjct  161  APPAIVNPLSTLCDPYLNIFRGFIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPSAD  219

Query  266  GVSRDDXPHTMEPXLTMSQRKWMRRRS----AGNRPKSA  162
            G         + P    S+ KW+RRR       +RP SA
Sbjct  220  G--------AVSP--ASSETKWVRRRRLSSHKDHRPSSA  248



>ref|XP_009131840.1| PREDICTED: uncharacterized protein LOC103856483 isoform X1 [Brassica 
rapa]
Length=258

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 165/249 (66%), Gaps = 32/249 (13%)
 Frame = -2

Query  857  ISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLS  678
            +S  F   PL  P+      KP+L LL  A DS + ++  H S+VS  +      HSL S
Sbjct  28   LSSAFTQTPLVRPN------KPSLLLLPPASDSVKLIQDLHRSLVSVTEKFSGFFHSLAS  81

Query  677  QNPFFKNLLSLSSHLQ----DIR----QIERR--ARQNFNTLSSHNFAAIIPGDSVAGIV  528
            +NP F+  + LSS  +    +++    QI  R   R +F  +++H FAA++PGDSVAG+V
Sbjct  82   RNPLFQEAVRLSSEFRCLCDEVKEPFFQIRLRNTTRVSF-AMANHGFAAVLPGDSVAGLV  140

Query  527  VTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDL  348
            V NG++NFLNIY+++LVVRLVLTWFP APPAIVSPLSTLCDPYLNIFRG+IPPLGG LDL
Sbjct  141  VANGLINFLNIYSNVLVVRLVLTWFPTAPPAIVSPLSTLCDPYLNIFRGVIPPLGG-LDL  199

Query  347  SPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKWMRRR----SAG  180
            SPILAFLVLNAFTS+A ALP ELPP  G +    P ++E        KWMRRR    +  
Sbjct  200  SPILAFLVLNAFTSSAMALPCELPPAEGAA---SPSSLE-------TKWMRRRRLTSNKD  249

Query  179  NRPKSAGGN  153
            +RP SA  N
Sbjct  250  HRPSSASTN  258



>ref|XP_007224287.1| hypothetical protein PRUPE_ppa019472mg, partial [Prunus persica]
 gb|EMJ25486.1| hypothetical protein PRUPE_ppa019472mg, partial [Prunus persica]
Length=177

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = -2

Query  734  SSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSHNFAAI  558
            +S+ SA D CL+ LHSL SQNPF   LLSL S  Q +  QI  R  +   TLS+HNFAA+
Sbjct  19   ASIASATDKCLQLLHSLASQNPFLSKLLSLRSEFQSLCHQIRCRKHRQVETLSAHNFAAV  78

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            +PGDSVAG+VV NGI NFLN+YN+LLVVRLVLTWFPN+PPAIV PLST+CDPYLNIFRG+
Sbjct  79   LPGDSVAGLVVANGISNFLNLYNTLLVVRLVLTWFPNSPPAIVGPLSTICDPYLNIFRGL  138

Query  377  IPPLGGTLDLSPILAFLVLNAFTST  303
            IPPLGGTLDLSPILAFLVLNAFTST
Sbjct  139  IPPLGGTLDLSPILAFLVLNAFTST  163



>ref|XP_010098371.1| Uncharacterized protein ycf19 [Morus notabilis]
 gb|EXB74895.1| Uncharacterized protein ycf19 [Morus notabilis]
Length=249

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -2

Query  737  HSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDI-RQIERRARQNFNTLSSHNFAA  561
             SS+ SAA  CL+  HS  SQNP  +  LSL         QI  R+ +N N++SSHNFAA
Sbjct  60   QSSIASAATKCLRFFHSFASQNPLLQKALSLPHEFHSFCHQIRCRSYRNVNSISSHNFAA  119

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRG  381
            ++PGDSVAG+VV NGI+NFLNIYN++L+VRLVLTWFPN PP IVSPLST+CDPYLNIFRG
Sbjct  120  VLPGDSVAGLVVANGIINFLNIYNTVLIVRLVLTWFPNVPPFIVSPLSTICDPYLNIFRG  179

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRKW  201
            IIPPLGGTLDLSPILAFLVLNAFTSTA ALPAEL  P   S      +    LT S++KW
Sbjct  180  IIPPLGGTLDLSPILAFLVLNAFTSTAAALPAEL--PAAESNQQTCSSSFSDLTSSEKKW  237

Query  200  MRRRSAGNRPKS  165
            MRR   GN  KS
Sbjct  238  MRRLHGGNGTKS  249



>ref|NP_001190356.1| protein YLMG2 [Arabidopsis thaliana]
 gb|AED92955.1| YGGT family protein [Arabidopsis thaliana]
Length=238

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 147/216 (68%), Gaps = 26/216 (12%)
 Frame = -2

Query  797  KPNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQ  618
            KPNL LL    DS + ++ FH S++SA +     LHSL S+NP F          Q+  +
Sbjct  42   KPNLLLLPPVADSVKLIQDFHQSLISATEKFKGFLHSLASKNPLF----------QEAIR  91

Query  617  IERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPP  438
            +    R  F  +S+H FAA++PGDSVAG+VV NG++NFLNIYN++LVVRLVLTWFP+APP
Sbjct  92   LRNTTRVRF-AMSNHGFAAVLPGDSVAGLVVANGLINFLNIYNTILVVRLVLTWFPSAPP  150

Query  437  AIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVS  258
            AIV+PLSTLCDPYLNIFRG IPPLGG LDLSPILAFLVLNAFTS+A ALP ELP   G  
Sbjct  151  AIVNPLSTLCDPYLNIFRGFIPPLGG-LDLSPILAFLVLNAFTSSAMALPCELPSADG--  207

Query  257  RDDXPHTMEPXLTMSQRKWMRRRS----AGNRPKSA  162
                   + P    S+ KW+RRR       +RP SA
Sbjct  208  ------AVSP--ASSETKWVRRRRLSSHKDHRPSSA  235



>gb|ADE76935.1| unknown [Picea sitchensis]
Length=253

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 142/209 (68%), Gaps = 7/209 (3%)
 Frame = -2

Query  794  PNLQLLRMAEDSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSH--LQDIR  621
            P +   R A+      + F S++        +S  +++  NPFF+ L+ LS     Q I 
Sbjct  35   PKVSPQRAAQGCQDLKKLFGSAIAECIQTIERSFKAIVVDNPFFQRLIFLSKQNPYQTIC  94

Query  620  QIERRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAP  441
            Q   + R+  + LSS NFAAI+PGD+VAG+VVTNGILNFLNIYN+LL+ RLVLTWFPN+P
Sbjct  95   QGHCQRRKRISPLSSCNFAAILPGDAVAGLVVTNGILNFLNIYNTLLIARLVLTWFPNSP  154

Query  440  PAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGV  261
            P IV+PLSTLCDPYLNIFRGIIPPLGGTLDLSPI+AF +LNA TS A ALPAEL  P G 
Sbjct  155  PIIVNPLSTLCDPYLNIFRGIIPPLGGTLDLSPIIAFFLLNAVTSAASALPAEL--PKGA  212

Query  260  SRDDXPHTM---EPXLTMSQRKWMRRRSA  183
                   +M      L+M Q+ W++R+S+
Sbjct  213  ESKGGLASMPSQYSKLSMQQKLWLKRQSS  241



>ref|XP_006849690.1| PREDICTED: uncharacterized protein LOC18439463 [Amborella trichopoda]
 gb|ERN11271.1| hypothetical protein AMTR_s00024p00238310 [Amborella trichopoda]
Length=240

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 155/242 (64%), Gaps = 15/242 (6%)
 Frame = -2

Query  908  SDEALQERQKPVQSNCLISLPFYAPPLFHPSFFRHHSKPNLQLLRMAEDSSRAVRRFHSS  729
            S E  ++   P    CLI+      PL           P        E + + +++   S
Sbjct  3    SKEPREQESAPRTITCLIASAINHFPLL----------PQTSKTSCHESTLQKLKKLQES  52

Query  728  VVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAIIPG  549
               AAD   + L++L SQNP  +   ++S+ LQ   +I  ++ +  +++S++NFAAI+PG
Sbjct  53   AAVAAD---QWLNALASQNPLIQRFAAISADLQSFSKIHLQSPKKLDSISNNNFAAILPG  109

Query  548  DSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPP  369
            DSVAGIVV NGI NFLNIY+++LVVRLVLTWFPN+PPAIV+PLSTLCDPYLNIFRG+IPP
Sbjct  110  DSVAGIVVANGISNFLNIYSTVLVVRLVLTWFPNSPPAIVNPLSTLCDPYLNIFRGLIPP  169

Query  368  LGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQRK-WMRR  192
            LGG LDLSPILAF+VLN FTSTA ALPAELP      +     +++     S+ K W++R
Sbjct  170  LGG-LDLSPILAFMVLNIFTSTAAALPAELPMDMANPKATTASSVQYWNLNSRGKLWLKR  228

Query  191  RS  186
             S
Sbjct  229  FS  230



>ref|XP_004303461.1| PREDICTED: uncharacterized protein LOC101299599 [Fragaria vesca 
subsp. vesca]
Length=245

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 138/192 (72%), Gaps = 11/192 (6%)
 Frame = -2

Query  737  HSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQN-FNTLSSHNFAA  561
            HSS+ SA +     LHSL S+NPF   L S  +  +      +  RQN   +LS+HNFAA
Sbjct  57   HSSIASATE----LLHSLASRNPFLNKLFSFHAEFRTFCHQVQSTRQNKLKSLSTHNFAA  112

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRG  381
            ++PGDSVAG+VV NG+ NFLN+YN+LLV RLVLTWFPN+PPAIV PLST+CDPYLNIFRG
Sbjct  113  VLPGDSVAGLVVANGVSNFLNLYNTLLVCRLVLTWFPNSPPAIVGPLSTICDPYLNIFRG  172

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRD----DXPHTMEPXLTMS  213
            +IPPLGGTLDLSPILAFLVLNAFTSTA ALPAELP  +  S++      P   +  LT  
Sbjct  173  LIPPLGGTLDLSPILAFLVLNAFTSTAAALPAELPASSAASQELGASSTPGITQ--LTTL  230

Query  212  QRKWMRRRSAGN  177
            Q+KWM R    N
Sbjct  231  QKKWMTRLQGSN  242



>ref|XP_004985502.1| PREDICTED: uncharacterized protein LOC101785923 [Setaria italica]
Length=240

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 129/182 (71%), Gaps = 13/182 (7%)
 Frame = -2

Query  704  LKSLHSLLSQNPFFKNLLSLSSHLQDIRQIER---RARQNFNTLSSHNFAAIIPGDSVAG  534
            L+ L S  + +P  K L ++ SHL    Q  R    AR++      H FAA++ GDSVAG
Sbjct  49   LEELASAAAAHPLLKPLFAVHSHLSSFSQSRRLLVAARRDALLSGEHCFAAVL-GDSVAG  107

Query  533  IVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTL  354
            +VV NGI NFL++YN++LVVRLVLTWFPN PPAIV+PLST+CDPYLNIFRGIIPPLGGTL
Sbjct  108  VVVANGINNFLSLYNTVLVVRLVLTWFPNTPPAIVAPLSTICDPYLNIFRGIIPPLGGTL  167

Query  353  DLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX--------LTMSQRKWM  198
            DLSPILAFLVLNAFTSTA ALPAEL P +  + +   H+            LT +QRKWM
Sbjct  168  DLSPILAFLVLNAFTSTAAALPAEL-PDSAAAPEHHRHSSAATSSCSAPLDLTANQRKWM  226

Query  197  RR  192
            +R
Sbjct  227  QR  228



>ref|XP_003558678.1| PREDICTED: uncharacterized protein LOC100838421 [Brachypodium 
distachyon]
Length=224

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 129/191 (68%), Gaps = 14/191 (7%)
 Frame = -2

Query  704  LKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERR----ARQNFNTLSSHN--FAAIIPGDS  543
            L  L S  + +P  K L     HL    Q  R+     RQ    ++     FAA++ G S
Sbjct  41   LDELASAAAAHPLLKPLFDFHHHLSTFSQSRRQRMVAMRQAACPMAGGEGCFAAVL-GGS  99

Query  542  VAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLG  363
            VAG+VV+NG+ +FL++YN++LV+RLVLTWFPN PPAIVSPLST+CDPYLNIFRGIIPPLG
Sbjct  100  VAGMVVSNGVNSFLSLYNTVLVIRLVLTWFPNTPPAIVSPLSTICDPYLNIFRGIIPPLG  159

Query  362  GTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX-LTMSQRKWMRRRS  186
            GTLDLSPILAFLVLNA T TA ALPAELP P          +++P  LT +QRKWMRR  
Sbjct  160  GTLDLSPILAFLVLNALTGTAAALPAELPGPASSG------SVQPGDLTANQRKWMRRIC  213

Query  185  AGNRPKSAGGN  153
            +G R ++ G  
Sbjct  214  SGKRQETDGAQ  224



>ref|XP_002468404.1| hypothetical protein SORBIDRAFT_01g045330 [Sorghum bicolor]
 gb|EER95402.1| hypothetical protein SORBIDRAFT_01g045330 [Sorghum bicolor]
Length=240

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 127/192 (66%), Gaps = 10/192 (5%)
 Frame = -2

Query  704  LKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTL----SSHNFAAIIPGDSVA  537
            L+ L S  + +P  K L +  SHL    Q  RR              H FAA++ GDSVA
Sbjct  50   LEELASAAAAHPLLKPLFAAHSHLSSFSQGRRRLVAARRATMLLSGEHCFAAVL-GDSVA  108

Query  536  GIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            G+VV+NGI NFLN+YN++LVVRLVLTWFPN PPAIV+PLST+CDPYLNIFRGIIPPLGGT
Sbjct  109  GMVVSNGINNFLNLYNTVLVVRLVLTWFPNTPPAIVAPLSTICDPYLNIFRGIIPPLGGT  168

Query  356  LDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX----LTMSQRKWMRRR  189
            LDLSPILAFLVLNAFTSTA ALPAELP             +        T +QRKWMRR 
Sbjct  169  LDLSPILAFLVLNAFTSTAAALPAELPSSAAAQHHQRTAALSSSAPLEATSNQRKWMRRM  228

Query  188  SAGNRPKSAGGN  153
             +  + +  GG+
Sbjct  229  RS-QKSQGEGGD  239



>ref|NP_001150770.1| YGGT family protein [Zea mays]
 gb|ACG40322.1| YGGT family protein [Zea mays]
 tpg|DAA43679.1| TPA: YGGT family protein [Zea mays]
Length=236

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 127/189 (67%), Gaps = 6/189 (3%)
 Frame = -2

Query  704  LKSLHSLLSQNPFFKNLLSLSSHLQDIRQ--IERRARQNFNTLSS-HNFAAIIPGDSVAG  534
            L+ L S  + +P  K L +  SHL    Q      A +    LS  H FAA++ G+SVAG
Sbjct  49   LEELASAATSHPLLKPLFAAHSHLSSFSQGRRRLVAARRATVLSGGHCFAAVL-GNSVAG  107

Query  533  IVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTL  354
            +VV+NGI NFLN+YN++LVVRLVLTWFPN PPAIV+PLST+CDPYLNIFRGIIPPLGGTL
Sbjct  108  LVVSNGINNFLNLYNTVLVVRLVLTWFPNTPPAIVAPLSTICDPYLNIFRGIIPPLGGTL  167

Query  353  DLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDD--XPHTMEPXLTMSQRKWMRRRSAG  180
            DLSPILAFLVLNAFTSTA ALPAELP              +     + +QRKWMRR  + 
Sbjct  168  DLSPILAFLVLNAFTSTAAALPAELPSSAAAQHHQRTAASSSSATPSPNQRKWMRRMRSK  227

Query  179  NRPKSAGGN  153
                  GG+
Sbjct  228  TSQGEDGGH  236



>gb|EPS61278.1| hypothetical protein M569_13520, partial [Genlisea aurea]
Length=99

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = -2

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLN  393
            NFAAIIPGDSVAG+VV+NGILNFLNIYN++L+VRLVLTWFPNAPP +VSPLSTLCDPYLN
Sbjct  1    NFAAIIPGDSVAGLVVSNGILNFLNIYNTMLIVRLVLTWFPNAPPVVVSPLSTLCDPYLN  60

Query  392  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELP  276
            IFRGIIPPLGG+LDLSPILAFLVLNAF+STA ALPAELP
Sbjct  61   IFRGIIPPLGGSLDLSPILAFLVLNAFSSTAAALPAELP  99



>gb|AAO13463.1| Hypothetical protein [Oryza sativa Japonica Group]
Length=157

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 112/143 (78%), Gaps = 8/143 (6%)
 Frame = -2

Query  611  RRARQNFNTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI  432
            RR          H FAA++ GDSVAG+VV++GI NFL++YN++LVVRLVLTWFPN PPAI
Sbjct  7    RRTTGECPLSGEHCFAAVL-GDSVAGVVVSSGINNFLSLYNTVLVVRLVLTWFPNTPPAI  65

Query  431  VSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELP---PPTGV  261
            V+PLST+CDPYLNIFRGIIPPLGGTLDLSPILAFLVLNA +STA ALPAELP   PPT  
Sbjct  66   VAPLSTICDPYLNIFRGIIPPLGGTLDLSPILAFLVLNALSSTAAALPAELPDPAPPT--  123

Query  260  SRDDXPHTMEPXLTMSQRKWMRR  192
            SR     +    LT ++RKWMRR
Sbjct  124  SRGATSSSS--VLTANRRKWMRR  144



>ref|XP_006649495.1| PREDICTED: uncharacterized protein LOC102707940 [Oryza brachyantha]
Length=234

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = -2

Query  581  SSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDP  402
              H FAA++ G SVAG+VV+NGI NFL++YN++LVVRLVLTWFPN PPAIV+PLST+CDP
Sbjct  92   GEHCFAAVL-GGSVAGVVVSNGINNFLSLYNTVLVVRLVLTWFPNTPPAIVAPLSTICDP  150

Query  401  YLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTG-VSRDDXPHTMEPX  225
            YLNIFRGIIPPLGGTLDLSPILAFLVLNA +STA ALPAELP P    SR          
Sbjct  151  YLNIFRGIIPPLGGTLDLSPILAFLVLNALSSTAAALPAELPDPAAPTSRRGASSAGSAV  210

Query  224  LTMSQRKWMRR  192
            LT S+RKW RR
Sbjct  211  LTASRRKWARR  221



>gb|EEC74625.1| hypothetical protein OsI_10244 [Oryza sativa Indica Group]
Length=238

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 110/133 (83%), Gaps = 8/133 (6%)
 Frame = -2

Query  581  SSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDP  402
              H FAA++ GDSVAG+VV++GI NFL++YN++LVVRLVLTWFPN PPAIV+PLST+CDP
Sbjct  98   GEHCFAAVL-GDSVAGVVVSSGINNFLSLYNTVLVVRLVLTWFPNTPPAIVAPLSTICDP  156

Query  401  YLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELP---PPTGVSRDDXPHTME  231
            YLNIFRGIIPPLGGTLDLSPILAFLVLNA +STA ALPAELP   PPT  SR     +  
Sbjct  157  YLNIFRGIIPPLGGTLDLSPILAFLVLNALSSTAAALPAELPDPAPPT--SRGAT--SSS  212

Query  230  PXLTMSQRKWMRR  192
              LT ++RKWMRR
Sbjct  213  SVLTANRRKWMRR  225



>ref|NP_001049150.1| Os03g0178200 [Oryza sativa Japonica Group]
 gb|ABF94280.1| YGGT family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF11064.1| Os03g0178200 [Oryza sativa Japonica Group]
 dbj|BAG92675.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97516.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97649.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87270.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58432.1| hypothetical protein OsJ_09637 [Oryza sativa Japonica Group]
Length=238

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 110/133 (83%), Gaps = 8/133 (6%)
 Frame = -2

Query  581  SSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDP  402
              H FAA++ GDSVAG+VV++GI NFL++YN++LVVRLVLTWFPN PPAIV+PLST+CDP
Sbjct  98   GEHCFAAVL-GDSVAGVVVSSGINNFLSLYNTVLVVRLVLTWFPNTPPAIVAPLSTICDP  156

Query  401  YLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELP---PPTGVSRDDXPHTME  231
            YLNIFRGIIPPLGGTLDLSPILAFLVLNA +STA ALPAELP   PPT  SR     +  
Sbjct  157  YLNIFRGIIPPLGGTLDLSPILAFLVLNALSSTAAALPAELPDPAPPT--SRGAT--SSS  212

Query  230  PXLTMSQRKWMRR  192
              LT ++RKWMRR
Sbjct  213  SVLTANRRKWMRR  225



>gb|EMT09865.1| Putative protein ycf19 [Aegilops tauschii]
Length=148

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 6/126 (5%)
 Frame = -2

Query  569  FAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNI  390
            FAA++ G SVAG+VV+NG+ +FL++YN++LV+RLVLTWFPN PPAIVSPLST+CDPYLNI
Sbjct  15   FAAVL-GGSVAGMVVSNGVNSFLSLYNTVLVIRLVLTWFPNTPPAIVSPLSTVCDPYLNI  73

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMSQ  210
            FRGIIPPLGG LDLSPILAFLVLNA T TA ALPAELP     S    P      LT +Q
Sbjct  74   FRGIIPPLGG-LDLSPILAFLVLNALTGTAAALPAELPSQKTASGSVHPDE----LTANQ  128

Query  209  RKWMRR  192
            RKW RR
Sbjct  129  RKWTRR  134



>dbj|BAJ98539.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=231

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 133/210 (63%), Gaps = 13/210 (6%)
 Frame = -2

Query  761  SSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERR----ARQN  594
             S+  R  H   ++     L  L +  + +P  K L  L  HL    Q  R+     RQ 
Sbjct  29   GSQRPRALHGPDLAPLARRLDELAASAAAHPLLKPLFDLHHHLSTFSQSRRQRMVAMRQA  88

Query  593  FNTLSSHN--FAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPL  420
               L+     FAA++ G SVAG+VV+NG+ +FL++YN++LV+RLVLTWFPN PPAIVSPL
Sbjct  89   ACPLAGGEGCFAAVL-GGSVAGMVVSNGVNSFLSLYNTVLVIRLVLTWFPNTPPAIVSPL  147

Query  419  STLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPH  240
            ST+CDPYLNIFRGIIPPLGG LDLSPILAFLVLNA T TA ALPAELP  T  S    P 
Sbjct  148  STVCDPYLNIFRGIIPPLGG-LDLSPILAFLVLNALTGTAAALPAELPAQTAASGSVHPD  206

Query  239  TMEPXLTMSQRKWMRRRSAGNRPKSAGGNK  150
                 LT +QRKWMRR   G +P+   G +
Sbjct  207  E----LTSNQRKWMRRFRPG-KPQVEDGAR  231



>gb|ABR25393.1| yggt family protein [Oryza sativa Indica Group]
Length=169

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 105/130 (81%), Gaps = 2/130 (2%)
 Frame = -2

Query  581  SSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDP  402
              H FAA++ GDSVAG+VV++GI NFL++YN++LVVRLVLTWFPN PPAIV+PLST+CDP
Sbjct  29   GEHCFAAVL-GDSVAGVVVSSGINNFLSLYNTVLVVRLVLTWFPNTPPAIVAPLSTICDP  87

Query  401  YLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXL  222
            YLN FRGI+PPLGGTLDLSPILAFLVL A +ST  ALPA+LP P   +    P +    L
Sbjct  88   YLNFFRGILPPLGGTLDLSPILAFLVLYALSSTVAALPADLPDPPPPTSRGAPSS-SSVL  146

Query  221  TMSQRKWMRR  192
            T ++RKWMRR
Sbjct  147  TANRRKWMRR  156



>ref|XP_001785227.1| predicted protein [Physcomitrella patens]
 gb|EDQ49968.1| predicted protein [Physcomitrella patens]
Length=138

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 101/141 (72%), Gaps = 16/141 (11%)
 Frame = -2

Query  584  LSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCD  405
            L S NFAAIIPGDSVA +V+++ + NFLN+YN++L+ RLVLTWFP+AP  IV+PLST+CD
Sbjct  12   LRSRNFAAIIPGDSVAEMVISSSVYNFLNLYNTVLIARLVLTWFPSAPEVIVNPLSTICD  71

Query  404  PYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPX  225
            PYLN+FRGIIPPL GT+DLSPILAF VLN FTSTA ALP EL               +P 
Sbjct  72   PYLNVFRGIIPPL-GTIDLSPILAFTVLNVFTSTAQALPCEL-------------DHKPQ  117

Query  224  LTMSQRKWMRRRSA--GNRPK  168
              +  R+ ++RR    G  PK
Sbjct  118  QKLGWRQLVQRRKGLKGPEPK  138



>ref|XP_002946335.1| hypothetical protein VOLCADRAFT_79012 [Volvox carteri f. nagariensis]
 gb|EFJ52262.1| hypothetical protein VOLCADRAFT_79012 [Volvox carteri f. nagariensis]
Length=221

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 103/139 (74%), Gaps = 6/139 (4%)
 Frame = -2

Query  680  SQNPFFKNLLSLSSHLQDIRQIERRARQNF----NTLSSHN-FAAIIPGDSVAGIVVTNG  516
             Q+PF +N  SL+      + +E+R+          L  H   AAIIPGDS A +V+TNG
Sbjct  23   QQHPFAQNA-SLALKRFQAKHMEQRSEARLPPRIVVLPRHAAVAAIIPGDSTAELVLTNG  81

Query  515  ILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
            I NFLN+YN+ L+VRLVLTWFPN P AIVSPL+T+CDPYLN+FRG+IPPLGGTLD SPIL
Sbjct  82   INNFLNLYNTALIVRLVLTWFPNPPAAIVSPLATVCDPYLNLFRGLIPPLGGTLDFSPIL  141

Query  335  AFLVLNAFTSTAFALPAEL  279
            AF+VLN FT+TA ALP EL
Sbjct  142  AFVVLNLFTNTAAALPCEL  160



>ref|XP_002500318.1| fanciful K+ uptake-b family transporter [Micromonas sp. RCC299]
 gb|ACO61576.1| fanciful K+ uptake-b family transporter [Micromonas sp. RCC299]
Length=180

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = -2

Query  590  NTLSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTL  411
            N L    FAA+IPGDS    V+T+GI + LNIYN+LL+ RL+LTWFPN P  IV PL+TL
Sbjct  38   NPLRHGKFAAMIPGDSAVETVITSGIFSTLNIYNTLLIGRLILTWFPNPPRQIVYPLATL  97

Query  410  CDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTG  264
            CDPYLN+FRGIIPP+GGT+DLSPILAF VLN FT+TA ALP E+ P TG
Sbjct  98   CDPYLNLFRGIIPPIGGTIDLSPILAFTVLNVFTNTAAALPCEIDPETG  146



>ref|XP_002980605.1| hypothetical protein SELMODRAFT_38262, partial [Selaginella moellendorffii]
 gb|EFJ18256.1| hypothetical protein SELMODRAFT_38262, partial [Selaginella moellendorffii]
Length=117

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 97/127 (76%), Gaps = 11/127 (9%)
 Frame = -2

Query  569  FAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNI  390
            FAAIIPGDS+A +VVT GI NF ++YN+LL+VR++ TWFP+AP AIV+P+ST+ DPYLN+
Sbjct  1    FAAIIPGDSLAELVVTRGITNFFSLYNTLLIVRIICTWFPDAPRAIVNPISTVTDPYLNL  60

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPP-TGVSRDDXPHTMEPXLTMS  213
            FRG+IPPLGGTLD SPILAFL+L+AF + A ALPAELP P  G+S              S
Sbjct  61   FRGLIPPLGGTLDFSPILAFLLLDAFGNAATALPAELPKPEAGIS----------AAAAS  110

Query  212  QRKWMRR  192
            +R W +R
Sbjct  111  RRNWRQR  117



>ref|XP_001762561.1| predicted protein [Physcomitrella patens]
 gb|EDQ72684.1| predicted protein, partial [Physcomitrella patens]
Length=96

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  569  FAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNI  390
            FAAI+PGDSVA +++++ +LNFLN+YN++L+ RLVLTWFPNAP AIV+PLST+CDPYLN+
Sbjct  1    FAAIVPGDSVAEVLISSSVLNFLNLYNTVLIARLVLTWFPNAPEAIVNPLSTICDPYLNV  60

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAEL  279
            FRGIIPPL GT+DLSPILAF VL+ FTSTA ALP EL
Sbjct  61   FRGIIPPL-GTIDLSPILAFTVLDVFTSTAQALPCEL  96



>ref|XP_002976887.1| hypothetical protein SELMODRAFT_38265, partial [Selaginella moellendorffii]
 gb|EFJ21997.1| hypothetical protein SELMODRAFT_38265, partial [Selaginella moellendorffii]
Length=110

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = -2

Query  569  FAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNI  390
            FAAIIPGDS+A +VVT GI NF ++YN+LL+VR++ TWFP+AP AIV+P+ST+ DPYLN+
Sbjct  1    FAAIIPGDSLAELVVTRGITNFFSLYNTLLIVRIICTWFPDAPRAIVNPISTVTDPYLNL  60

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPP-TGVS  258
            FRG+IPPLGGTLD SPILAFL+L+AF + A ALPAELP P  G+S
Sbjct  61   FRGLIPPLGGTLDFSPILAFLLLDAFGNAATALPAELPKPEAGIS  105



>ref|XP_005849508.1| hypothetical protein CHLNCDRAFT_20845 [Chlorella variabilis]
 gb|EFN57406.1| hypothetical protein CHLNCDRAFT_20845 [Chlorella variabilis]
Length=154

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (74%), Gaps = 11/130 (8%)
 Frame = -2

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLN  393
             FAAIIPGD VA +V+T+G+ +FL +YN+ L+ RL+L+WFP AP AIVSPL+T+ DPYLN
Sbjct  19   QFAAIIPGDGVAEVVLTSGLSSFLQLYNAALIGRLILSWFPAAPQAIVSPLATVVDPYLN  78

Query  392  IFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEPXLTMS  213
            +FRGIIPPLGG +DLSPILAF+VL+ FT+TA ALPAE+        D+     +P    +
Sbjct  79   LFRGIIPPLGG-IDLSPILAFIVLDLFTNTAAALPAEV--------DEQGQLRKP--AAA  127

Query  212  QRKWMRRRSA  183
            +  W RR +A
Sbjct  128  KNAWQRRMAA  137



>ref|XP_003078529.1| putative protein (ISS) [Ostreococcus tauri]
 emb|CAL51409.1| Uncharacterised protein family Ycf19 [Ostreococcus tauri]
Length=209

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -2

Query  584  LSSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCD  405
            L     AA+IPGDS    V+T+GI + LNIYN+L++ RL+LTWFPN P  +  PL+TLCD
Sbjct  82   LRGKFLAAMIPGDSAVESVITSGIFSTLNIYNTLIIGRLILTWFPNPPRQLAYPLATLCD  141

Query  404  PYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTG  264
            PYLN+FRGIIPPLGG +DLSPILAF VLN F  TA ALP E    TG
Sbjct  142  PYLNLFRGIIPPLGG-IDLSPILAFTVLNVFQGTAAALPCEYDEKTG  187



>ref|XP_007512897.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16455.1| predicted protein [Bathycoccus prasinos]
Length=220

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -2

Query  566  AAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIF  387
             A+IPGDS   +V+T+G+ + LNIYN+LL+ RL++TWFP AP  IV PL+T+CDPYLN+F
Sbjct  99   GAMIPGDSAVEVVLTSGLFSTLNIYNTLLIGRLIVTWFPAAPQQIVYPLATICDPYLNLF  158

Query  386  RGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAEL  279
            RGIIPPLGG +DLSPILAF  LN FTSTA ALPA++
Sbjct  159  RGIIPPLGG-IDLSPILAFTALNFFTSTAAALPAQI  193



>ref|XP_003603214.1| hypothetical protein MTR_3g105100 [Medicago truncatula]
Length=165

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 80/107 (75%), Gaps = 2/107 (2%)
 Frame = -2

Query  734  SSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQD-IRQIERRARQNFNTLSSH-NFAA  561
            +S+ +A DNC K LHSL SQNPF   LLSLSS   D   QI      N   +S+H NFAA
Sbjct  50   TSISNAVDNCSKLLHSLASQNPFLNKLLSLSSQFHDTCVQIRCSNYSNSRWVSNHHNFAA  109

Query  560  IIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPL  420
            ++PGDSVAG+VV NG+ NFL++YN+LLV RLVLTWFPNAPPAIV+PL
Sbjct  110  VLPGDSVAGLVVANGLNNFLSLYNTLLVARLVLTWFPNAPPAIVAPL  156



>ref|XP_008660483.1| PREDICTED: uncharacterized protein LOC103639519 [Zea mays]
Length=219

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 108/193 (56%), Gaps = 35/193 (18%)
 Frame = -2

Query  704  LKSLHSLLSQNPFFKNLLSLSSHLQDIRQ--IERRARQNFNTLSSHN--FAAIIPGDSVA  537
            L+ L S  + +P  K L +  SHL    Q      A +    LSS    FAA++ GDSVA
Sbjct  52   LEELASAAAAHPLLKPLFAAHSHLSSFSQGRRRLVAARRATVLSSGELCFAAVL-GDSVA  110

Query  536  GIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            G VV +GI NFLN+YN++LVVRLVLTWFPN PPAIV+PLST                   
Sbjct  111  GTVVASGINNFLNLYNTVLVVRLVLTWFPNTPPAIVAPLST-------------------  151

Query  356  LDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTMEP-----XLTMSQRKWMRR  192
                 ILAFLVLNAFTSTA ALPAELP  +  ++      + P       T+SQRKWMRR
Sbjct  152  -----ILAFLVLNAFTSTAAALPAELPSCSATAQHHQRTAVSPCSAPHEATLSQRKWMRR  206

Query  191  RSAGNRPKSAGGN  153
              +  +P+   G+
Sbjct  207  MRS-QKPQGDDGD  218



>ref|XP_008678606.1| PREDICTED: YGGT family protein isoform X1 [Zea mays]
Length=212

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 103/189 (54%), Gaps = 30/189 (16%)
 Frame = -2

Query  704  LKSLHSLLSQNPFFKNLLSLSSHLQDIRQ--IERRARQNFNTLSS-HNFAAIIPGDSVAG  534
            L+ L S  + +P  K L +  SHL    Q      A +    LS  H FAA++ G+SVAG
Sbjct  49   LEELASAATSHPLLKPLFAAHSHLSSFSQGRRRLVAARRATVLSGGHCFAAVL-GNSVAG  107

Query  533  IVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTL  354
            +VV+NGI NFLN+YN++LVVRLVLTWFPN PPAIV+PLST                    
Sbjct  108  LVVSNGINNFLNLYNTVLVVRLVLTWFPNTPPAIVAPLST--------------------  147

Query  353  DLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDD--XPHTMEPXLTMSQRKWMRRRSAG  180
                ILAFLVLNAFTSTA ALPAELP              +     + +QRKWMRR  + 
Sbjct  148  ----ILAFLVLNAFTSTAAALPAELPSSAAAQHHQRTAASSSSATPSPNQRKWMRRMRSK  203

Query  179  NRPKSAGGN  153
                  GG+
Sbjct  204  TSQGEDGGH  212



>gb|AFW89486.1| hypothetical protein ZEAMMB73_425125 [Zea mays]
Length=237

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 110/211 (52%), Gaps = 53/211 (25%)
 Frame = -2

Query  704  LKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERR--------------------ARQNFNT  585
            L+ L S  + +P  K L +  SHL    Q  RR                    A +    
Sbjct  52   LEELASAAAAHPLLKPLFAAHSHLSSFSQRSRREPTPLWFDGASHEQGRRRLVAARRATV  111

Query  584  LSSHN--FAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTL  411
            LSS    FAA++ GDSVAG VV +GI NFLN+YN++LVVRLVLTWFPN PPAIV+PLST 
Sbjct  112  LSSGELCFAAVL-GDSVAGTVVASGINNFLNLYNTVLVVRLVLTWFPNTPPAIVAPLST-  169

Query  410  CDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRDDXPHTME  231
                                   ILAFLVLNAFTSTA ALPAELP  +  ++      + 
Sbjct  170  -----------------------ILAFLVLNAFTSTAAALPAELPSCSATAQHHQRTAVS  206

Query  230  P-----XLTMSQRKWMRRRSAGNRPKSAGGN  153
            P       T+SQRKWMRR  +  +P+   G+
Sbjct  207  PCSAPHEATLSQRKWMRRMRS-QKPQGDDGD  236



>ref|XP_001702829.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96874.1| predicted protein [Chlamydomonas reinhardtii]
Length=174

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -2

Query  500  NIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVL  321
            N+YN+ L+VRLVLTWFPN P  +V+PLST+CDPYLN+FRG+IPPLGG+LD SPILAF+VL
Sbjct  45   NLYNTALIVRLVLTWFPNPPEFLVTPLSTVCDPYLNLFRGLIPPLGGSLDFSPILAFVVL  104

Query  320  NAFTSTAFALPAELPPPTG  264
            N FT+TA ALP E+    G
Sbjct  105  NLFTNTAAALPCEVKRSGG  123



>ref|XP_005644916.1| hypothetical protein COCSUDRAFT_8690, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20372.1| hypothetical protein COCSUDRAFT_8690, partial [Coccomyxa subellipsoidea 
C-169]
Length=88

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -2

Query  500  NIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVL  321
            ++YN++++VR++LTWFPN P  I  PLSTLCDPYLN+FRG+IP +GGTLDLSPILAF+VL
Sbjct  2    SLYNTIIIVRILLTWFPNPPQVIAGPLSTLCDPYLNLFRGLIPTIGGTLDLSPILAFIVL  61

Query  320  NAFTSTAFALPAELPP  273
            + F++TA ALPAEL P
Sbjct  62   DLFSNTAAALPAELGP  77



>ref|XP_003061862.1| fanciful K+ uptake-b family, partial [Micromonas pusilla CCMP1545]
 gb|EEH53574.1| fanciful K+ uptake-b family, partial [Micromonas pusilla CCMP1545]
Length=67

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLV  324
            LNIYN+LL+ RL+LTWFP+ P  IV PL+TLCDPYLN+FRGIIPP+GGT+DLSPILAF V
Sbjct  2    LNIYNTLLIGRLILTWFPSPPRQIVYPLATLCDPYLNLFRGIIPPIGGTIDLSPILAFTV  61

Query  323  LNAFTS  306
            LN FT+
Sbjct  62   LNVFTN  67



>emb|CCI61384.1| hypothetical protein (GL-P13hh marker), partial [Lens orientalis]
Length=59

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -2

Query  554  PGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGI  378
            PGDS+AG+VV NG+ NFLN+YN+L+V RLVLTWFPNAPPAIV+PLST+CDPYLN+FRG+
Sbjct  1    PGDSMAGLVVANGLQNFLNLYNTLIVCRLVLTWFPNAPPAIVAPLSTVCDPYLNVFRGL  59



>ref|XP_001417118.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95411.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=76

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 1/72 (1%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLD  351
            V+T+GI + LNIYN+L++ RL+LTWFPN P  I+ PL+T+CDPYLN+FRGIIPPLGG +D
Sbjct  6    VITSGIFSTLNIYNTLIIGRLILTWFPNPPRQIMYPLATICDPYLNLFRGIIPPLGG-ID  64

Query  350  LSPILAFLVLNA  315
            LSPILAF VLN 
Sbjct  65   LSPILAFTVLNV  76



>ref|XP_005705095.1| YggT family protein [Galdieria sulphuraria]
 gb|EME28575.1| YggT family protein [Galdieria sulphuraria]
Length=157

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -2

Query  566  AAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA-IVSPLSTLCDPYLNI  390
            A+++PGDS+ G V   G LNF ++Y++LL+VR++L+WFP A    I+ PL TLCDPYLN+
Sbjct  45   ASVLPGDSIVGGVFVGGFLNFFSLYSNLLIVRVLLSWFPAAQNQPILRPLFTLCDPYLNL  104

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAE  282
            FR ++PP+ G +D SPILAF  L  F++   AL AE
Sbjct  105  FRSVVPPVFG-IDFSPILAFTALQFFSTATIALGAE  139



>ref|XP_002180626.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48034.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=237

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = -2

Query  581  SSHNFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPP-AIVSPLSTLCD  405
            ++ N A  IPG  VA  V   G LNFL+IYN ++  R++L+WFP A   A++ P+  + D
Sbjct  99   TTSNAAMAIPGYGVAEQVFVGGFLNFLSIYNIVITARILLSWFPQAQGVALLQPVYAITD  158

Query  404  PYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPP  273
            PYLNIFRGIIPP+ G LDLSP+LAF +LN  T +  A+  E+PP
Sbjct  159  PYLNIFRGIIPPIFG-LDLSPLLAFFLLNVVTKSTAAIGYEIPP  201



>gb|EJK55210.1| hypothetical protein THAOC_25079 [Thalassiosira oceanica]
Length=2057

 Score =   108 bits (271),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 68/155 (44%), Positives = 94/155 (61%), Gaps = 14/155 (9%)
 Frame = -2

Query  737  HSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAI  558
            HSS  S  D    S  S LS++ F +   S++  LQ+ R++    R        H  A  
Sbjct  25   HSSATSLPD----SARSSLSEHAFHQTR-SINRALQN-RRLTNDGRLR------HPLAIA  72

Query  557  IPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPP-AIVSPLSTLCDPYLNIFRG  381
            IPG+SVA  VV  G  NF++IYN+++  R++L+WFP A     + P+  + DPYLN+FRG
Sbjct  73   IPGNSVAEQVVVGGFGNFISIYNTVITARILLSWFPQAQGIGALQPVYQITDPYLNLFRG  132

Query  380  IIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELP  276
            IIPP+ G LDLSPILAF+ LN   S+A +L AE+P
Sbjct  133  IIPPIFG-LDLSPILAFVTLNLLQSSAVSLAAEIP  166



>ref|XP_005824684.1| hypothetical protein GUITHDRAFT_165419 [Guillardia theta CCMP2712]
 gb|EKX37704.1| hypothetical protein GUITHDRAFT_165419 [Guillardia theta CCMP2712]
Length=173

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 64/98 (65%), Gaps = 2/98 (2%)
 Frame = -2

Query  566  AAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPP-AIVSPLSTLCDPYLNI  390
            A  IPGDSV   V   G  NFL +Y +LLV R++L+WFP+A     + PL  +CDPYLN 
Sbjct  49   AVAIPGDSVGEEVFVRGFQNFLTLYQNLLVARVLLSWFPSAQSIGALQPLYNVCDPYLNT  108

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELP  276
            FRGIIPP+GG +DLSPILAF +L        +L AE P
Sbjct  109  FRGIIPPIGG-IDLSPILAFTLLQVSAGAMVSLGAETP  145



>ref|XP_005535261.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM78975.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=152

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = -2

Query  572  NFAAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPP-AIVSPLSTLCDPYL  396
              A +IPGDS A  V  +G + FLN+Y +LL  R++L+WFP A   +++ PL  +CDP+L
Sbjct  46   RLAMVIPGDSQAEFVFLSGTVTFLNVYQNLLFARIILSWFPAASQLSLLQPLYVVCDPFL  105

Query  395  NIFRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPPTGVSRD  252
              F+GI+PP+ G +D SPIL F +L        AL  E P     SRD
Sbjct  106  RFFQGILPPVAG-IDFSPILGFTLLQLGARLTAALGQECP-----SRD  147



>ref|WP_002763635.1| MULTISPECIES: hypothetical protein [Microcystis]
 dbj|BAG00552.1| hypothetical protein MAE_07300 [Microcystis aeruginosa NIES-843]
 emb|CCI00105.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
 emb|CCI27547.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
 emb|CCI21550.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
 emb|CCI31606.1| conserved hypothetical protein [Microcystis sp. T1-4]
 emb|CCI37859.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=95

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
            NFL IY+ +L+VR++LTWF NA  A  I+S LS + DPYLN+FR IIPPLGG +DLSPIL
Sbjct  13   NFLQIYSVILIVRVLLTWFQNAGWAYQIMSFLSPITDPYLNLFRSIIPPLGG-MDLSPIL  71

Query  335  AFLVLNAFTSTA  300
            AFL+LN   S  
Sbjct  72   AFLLLNVVQSVV  83



>ref|WP_002733084.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO90593.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH91851.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
 gb|ELP56278.1| hypothetical protein Ycf19 [Microcystis aeruginosa TAIHU98]
 gb|ELS49380.1| putative protein Ycf19 [Microcystis aeruginosa DIANCHI905]
Length=95

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
            NFL IY+ +L+VR++LTWF NA  A  I+S LS + DPYLN+FR IIPPLGG +DLSPIL
Sbjct  13   NFLQIYSVILIVRVLLTWFQNAGWAYQIMSFLSPITDPYLNLFRSIIPPLGG-MDLSPIL  71

Query  335  AFLVLNAFTSTA  300
            AFL+LN   S  
Sbjct  72   AFLLLNVVQSVV  83



>ref|WP_002766817.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI01491.1| Similar to tr|Q7NFI5|Q7NFI5 [Microcystis aeruginosa PCC 9443]
 emb|CCI12310.1| Similar to tr|Q7NFI5|Q7NFI5 [Microcystis aeruginosa PCC 9806]
 emb|CCI20609.1| Similar to tr|Q7NFI5|Q7NFI5 [Microcystis aeruginosa PCC 9807]
Length=95

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
            NFL IY+ +L+VR++LTWF NA  A  I+S LS + DPYLN+FR IIPPLGG +DLSPIL
Sbjct  13   NFLQIYSVILIVRVLLTWFQNAGWAYQIMSFLSPITDPYLNLFRSIIPPLGG-MDLSPIL  71

Query  335  AFLVLNAFTSTA  300
            AFL+LN   S  
Sbjct  72   AFLLLNVVQSVV  83



>ref|XP_005718586.1| unnamed protein product [Chondrus crispus]
 emb|CDF38681.1| unnamed protein product [Chondrus crispus]
Length=192

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = -2

Query  566  AAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA-IVSPLSTLCDPYLNI  390
            A IIPGDSV       G + F NIY +++V R++L+WFP      IV PL T+CDPYLN+
Sbjct  40   AVIIPGDSVLESTTIGGTVTFFNIYQNVIVARILLSWFPGVQSNPIVRPLITVCDPYLNL  99

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFAL  291
            FR  +PP+ G LDLSPILA L+L AF S + A+
Sbjct  100  FRQTVPPIFG-LDLSPILALLLLQAFGSVSHAV  131



>ref|WP_016516829.1| YGGT family protein [Microcystis aeruginosa]
 gb|EPF18836.1| YGGT family protein [Microcystis aeruginosa SPC777]
Length=95

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 3/72 (4%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
            NFL IY+ +L+VR++LTWF NA  A  I+S LS + DPYLN+FR IIPPLGG +DLSPIL
Sbjct  13   NFLQIYSVILIVRVLLTWFQNAGWAYQIMSFLSPITDPYLNLFRSIIPPLGG-IDLSPIL  71

Query  335  AFLVLNAFTSTA  300
            AFL+LN   S  
Sbjct  72   AFLLLNVVQSVV  83



>ref|XP_010054052.1| PREDICTED: uncharacterized protein LOC104442347 [Eucalyptus grandis]
Length=250

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 92/165 (56%), Gaps = 19/165 (12%)
 Frame = -2

Query  764  DSSRAVRRFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNT  585
            DS R V    SSV++ A     S+  L+   PF K L  LS  +   ++I   AR+   +
Sbjct  84   DSIRTV----SSVLALAVGVSVSIAKLVQTLPFDKALALLSKLVPGPQEIAA-ARELGGS  138

Query  584  LSSHN----FAAIIPGDSVAG------IVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA  435
            LS       FAA+   D  +G       VV  G+  +L+IY+ +L+VR++L+WFPN P  
Sbjct  139  LSHAAGPLFFAAL--RDRPSGHLNTPLTVVAAGLAKWLDIYSGVLMVRVLLSWFPNIPWE  196

Query  434  I--VSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTS  306
               +S +  LCDPYLN+FR IIPP+  TLD+SP+LAF VL    S
Sbjct  197  RQPLSAIRDLCDPYLNLFRNIIPPIFDTLDVSPLLAFAVLGTLGS  241



>gb|KGG12495.1| Cell division protein YlmG/Ycf19 [Prochlorococcus sp. MIT 0601]
Length=102

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%), Gaps = 6/84 (7%)
 Frame = -2

Query  542  VAGIVVTN--GILN-FLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGI  378
            +A  +++N  G+LN  L IY+ +L++R++LTWFPN      I+S +S + DPYLN+FRGI
Sbjct  1    MAATIISNIFGVLNQTLLIYSYILIIRVLLTWFPNLDWTNPILSNISAITDPYLNMFRGI  60

Query  377  IPPLGGTLDLSPILAFLVLNAFTS  306
            IPPLGG LD+SPILAFLVLN  TS
Sbjct  61   IPPLGG-LDISPILAFLVLNLSTS  83



>ref|WP_045356251.1| hypothetical protein [Microcystis aeruginosa]
 dbj|GAL91340.1| cell division protein YlmG/Ycf19 (putative), YggT family [Microcystis 
aeruginosa NIES-44]
Length=95

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
            NFL IY+ +L++R++LTWF NA  A  I+S LS + DPYLN+FR IIPPLGG +D SPIL
Sbjct  13   NFLQIYSVILIIRVLLTWFQNAGWAYQIMSFLSPITDPYLNLFRSIIPPLGG-MDFSPIL  71

Query  335  AFLVLNAFTSTA  300
            AFL+LN   S  
Sbjct  72   AFLLLNVVQSVV  83



>gb|ABK26868.1| unknown [Picea sitchensis]
Length=247

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G++ +L +Y+ +L VR++L+WFPN P     +S +  +CDPYLN+FR IIPP+   
Sbjct  161  VVASGMVKWLELYSGVLTVRIMLSWFPNIPWDRQPLSAIRDMCDPYLNLFRNIIPPIRNA  220

Query  356  LDLSPILAFLVLNAFTST  303
            LD+SPILAF+VL A  S 
Sbjct  221  LDVSPILAFIVLGALVSV  238



>ref|WP_036903716.1| membrane protein [Prochlorococcus sp. MIT 0601]
Length=98

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = -2

Query  518  GILN-FLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDL  348
            G+LN  L IY+ +L++R++LTWFPN      I+S +S + DPYLN+FRGIIPPLGG LD+
Sbjct  7    GVLNQTLLIYSYILIIRVLLTWFPNLDWTNPILSNISAITDPYLNMFRGIIPPLGG-LDI  65

Query  347  SPILAFLVLNAFTS  306
            SPILAFLVLN  TS
Sbjct  66   SPILAFLVLNLSTS  79



>ref|XP_001772465.1| predicted protein [Physcomitrella patens]
 gb|EDQ62747.1| predicted protein, partial [Physcomitrella patens]
Length=87

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L IY+ +L+VR++L+WFPN P     +  +  +CDPYLN+FR IIPPL   
Sbjct  4    VVASGMAKWLEIYSGVLMVRVLLSWFPNIPWERQPLQAVRDMCDPYLNLFRNIIPPLFNA  63

Query  356  LDLSPILAFLVLNAFTS  306
            LDLSP+LAF+VL   TS
Sbjct  64   LDLSPMLAFIVLGVLTS  80



>ref|XP_010923462.1| PREDICTED: uncharacterized protein LOC105046547 [Elaeis guineensis]
Length=223

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+ GT
Sbjct  138  VVASGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFGT  197

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  198  LDVSPLLAFAVLGTLGS  214



>ref|WP_002777308.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI07639.1| Similar to tr|Q7NFI5|Q7NFI5 [Microcystis aeruginosa PCC 7941]
Length=94

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
            NFL IY  +L+VR++LTWF NA  A  I+S LS + DPYLN+FR IIPPLGG +DLSPIL
Sbjct  13   NFLQIYLVILIVRVLLTWFQNAGWAYQIMSFLSPITDPYLNLFRSIIPPLGG-MDLSPIL  71

Query  335  AFLVLNAFTSTA  300
            AFL+L    S  
Sbjct  72   AFLLLQVVQSVV  83



>ref|XP_001781061.1| predicted protein [Physcomitrella patens]
 gb|EDQ54170.1| predicted protein, partial [Physcomitrella patens]
Length=131

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L +Y+ +L+VR++L+WFPN P     +  +  +CDPYLN+FR IIPPL   
Sbjct  48   VVASGMAKWLELYSGVLMVRVLLSWFPNIPWERQPLQAVRDMCDPYLNLFRNIIPPLFNA  107

Query  356  LDLSPILAFLVLNAFTS  306
            LDLSP+LAF+VL   TS
Sbjct  108  LDLSPMLAFMVLGVLTS  124



>ref|WP_012195402.1| membrane protein [Prochlorococcus marinus]
 gb|ABX08780.1| Predicted integral membrane protein [Prochlorococcus marinus 
str. MIT 9211]
Length=102

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 3/66 (5%)
 Frame = -2

Query  497  IYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLV  324
            IY+ +L++R++LTWFPN   +  I+S +S + DPYLN+FRGIIPPLGG LD+SPILAFLV
Sbjct  19   IYSYILIIRVLLTWFPNLDWSNPILSNISAITDPYLNLFRGIIPPLGG-LDISPILAFLV  77

Query  323  LNAFTS  306
            +N  TS
Sbjct  78   INFSTS  83



>ref|XP_006849595.1| PREDICTED: uncharacterized protein LOC18439366 [Amborella trichopoda]
 gb|ERN11176.1| hypothetical protein AMTR_s00024p00200150 [Amborella trichopoda]
Length=262

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  175  VVASGMARWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  234

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SPILAF VL +  S
Sbjct  235  LDVSPILAFAVLGSLGS  251



>ref|XP_010250069.1| PREDICTED: uncharacterized protein LOC104592405 [Nelumbo nucifera]
Length=254

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 76/128 (59%), Gaps = 11/128 (9%)
 Frame = -2

Query  665  FKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFAAIIPGDSVAG------IVVTNGILNF  504
             K + S  SH +++ +I+        T+    FAA+   D  +G       VV +G+  +
Sbjct  121  LKQICSTPSH-EELARIQTIKESLVCTIGPLFFAAL--RDRPSGYLNTPLTVVASGMAKW  177

Query  503  LNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  TLD+SP+LAF
Sbjct  178  LDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDTLDVSPLLAF  237

Query  329  LVLNAFTS  306
             VL    S
Sbjct  238  AVLGTLGS  245



>gb|AFG52305.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52313.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
Length=135

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI+ +L +Y+ +L VR++L+WFPN P     +S +  +CDPYLN+FR IIPP+   
Sbjct  49   VVAAGIVKWLELYSGVLTVRIMLSWFPNIPWDRQPLSAIRDMCDPYLNLFRNIIPPIRNA  108

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SPILAF+V+    S
Sbjct  109  LDVSPILAFMVIGTLMS  125



>gb|AFG52301.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52302.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52304.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52306.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52307.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52308.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52310.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52311.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52312.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52314.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
Length=135

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI+ +L +Y+ +L VR++L+WFPN P     +S +  +CDPYLN+FR IIPP+   
Sbjct  49   VVAAGIVKWLELYSGVLTVRIMLSWFPNIPWDRQPLSAIRDMCDPYLNLFRNIIPPIRNA  108

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SPILAF+V+    S
Sbjct  109  LDVSPILAFMVIGTLMS  125



>ref|XP_004242431.1| PREDICTED: uncharacterized protein LOC101255803 [Solanum lycopersicum]
Length=222

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 7/95 (7%)
 Frame = -2

Query  569  FAAIIPGDSVAGI-----VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTL  411
            FAA+    +  G+     VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  L
Sbjct  119  FAALRNQSTTGGLNTPFTVVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDL  178

Query  410  CDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTS  306
            CDPYLN+FR IIPP+  TLD+SP+LAF VL    S
Sbjct  179  CDPYLNLFRNIIPPIFDTLDVSPLLAFAVLGTLGS  213



>ref|XP_002882528.1| hypothetical protein ARALYDRAFT_478063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58787.1| hypothetical protein ARALYDRAFT_478063 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  149  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  208

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  209  LDVSPLLAFAVLGTLGS  225



>gb|AFG52303.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
 gb|AFG52309.1| hypothetical protein 2_9683_02, partial [Pinus taeda]
Length=135

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI+ +L +Y+ +L VR++L+WFPN P     +S +  +CDPYLN+FR IIPP+   
Sbjct  49   VVAAGIVKWLELYSGVLTVRIMLSWFPNIPWDRQPLSAIRDMCDPYLNLFRNIIPPIRNA  108

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SPILAF+V+    S
Sbjct  109  LDVSPILAFMVIGTLMS  125



>ref|WP_009455432.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC18079.1| protein of unknown function YGGT [Fischerella sp. JSC-11]
Length=94

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = -2

Query  506  FLNIYNSLLVVRLVLTWFPNA-----PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSP  342
            F+NIY++LL++R++LTWFPN      P A    LS + DPYLNIFR IIPPLGG +D SP
Sbjct  11   FINIYSTLLIIRVLLTWFPNINWYNQPFA---ALSQITDPYLNIFRNIIPPLGG-MDFSP  66

Query  341  ILAFLVLNAFTS  306
            ILAFLVLN   S
Sbjct  67   ILAFLVLNIIGS  78



>ref|XP_011080524.1| PREDICTED: uncharacterized protein LOC105163765 isoform X2 [Sesamum 
indicum]
Length=231

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L++Y+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  146  VVAAGMAKWLDLYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  205

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL A  S
Sbjct  206  LDVSPLLAFGVLGALGS  222



>gb|EPS74141.1| hypothetical protein M569_00615, partial [Genlisea aurea]
Length=150

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  66   VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  125

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  126  LDVSPLLAFAVLGTLGS  142



>ref|WP_017300298.1| hypothetical protein [Nodosilinea nodulosa]
Length=94

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 7/75 (9%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPN----APPAIVSPLSTLCDPYLNIFRGIIPPLG  363
            ++   +  FL+IY  LL+VR++L+WFPN    +PP   S LS L DPYLN+FR IIPPLG
Sbjct  3    ILVQTLTTFLSIYTILLIVRILLSWFPNVDWFSPP--FSVLSQLTDPYLNLFRSIIPPLG  60

Query  362  GTLDLSPILAFLVLN  318
            G +DLSPILAFL+L+
Sbjct  61   G-IDLSPILAFLLLS  74



>ref|XP_011080523.1| PREDICTED: uncharacterized protein LOC105163765 isoform X1 [Sesamum 
indicum]
Length=254

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L++Y+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  169  VVAAGMAKWLDLYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  228

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL A  S
Sbjct  229  LDVSPLLAFGVLGALGS  245



>ref|WP_016869431.1| hypothetical protein [Fischerella muscicola]
Length=94

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = -2

Query  506  FLNIYNSLLVVRLVLTWFPNA-----PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSP  342
            F+NIY++LL++R++LTWFPN      P A    LS + DPYLNIFR IIPPLGG +D SP
Sbjct  11   FINIYSTLLIIRVLLTWFPNINWYNQPFA---ALSQITDPYLNIFRNIIPPLGG-IDFSP  66

Query  341  ILAFLVLNAFTS  306
            ILAFLVLN   S
Sbjct  67   ILAFLVLNIIGS  78



>gb|AFK49498.1| unknown [Medicago truncatula]
Length=50

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  340  MGERSRVPPSGGIMPRNIFKYGSHKVLRGLTMAGGALGNQVKTSLTTSNEL  492
            MGERS  PP GGI PRN FKYGSH VLRG TMAGGALGNQV+TSL TS  L
Sbjct  1    MGERSS-PPRGGISPRNTFKYGSHTVLRGATMAGGALGNQVRTSLATSKVL  50



>ref|XP_011024561.1| PREDICTED: uncharacterized protein LOC105125696 [Populus euphratica]
Length=246

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  161  VVAAGLAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  220

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  221  LDVSPLLAFAVLGTLGS  237



>gb|AFK43466.1| unknown [Lotus japonicus]
Length=219

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  136  VVAAGLGKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPVFDT  195

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  196  LDVSPLLAFAVLGTLGS  212



>ref|WP_016861183.1| MULTISPECIES: hypothetical protein [Fischerella]
Length=94

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = -2

Query  506  FLNIYNSLLVVRLVLTWFPNA-----PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSP  342
            F+NIY++LL++R++LTWFPN      P A    LS + DPYLN+FR IIPPLGG +D SP
Sbjct  11   FINIYSTLLIIRVLLTWFPNINWYNQPFA---ALSQITDPYLNVFRNIIPPLGG-IDFSP  66

Query  341  ILAFLVLNAFTS  306
            ILAFLVLN   S
Sbjct  67   ILAFLVLNIVGS  78



>ref|NP_566307.1| protein YLMG1-1 [Arabidopsis thaliana]
 gb|AAF02150.1|AC009853_10 unknown protein [Arabidopsis thaliana]
 gb|AAM20698.1| unknown protein [Arabidopsis thaliana]
 gb|AAP13371.1| At3g07430 [Arabidopsis thaliana]
 gb|AEE74542.1| YGGT family protein [Arabidopsis thaliana]
Length=232

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  149  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  208

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  209  LDVSPLLAFAVLGTLGS  225



>ref|XP_003531773.1| PREDICTED: uncharacterized protein LOC100819562 [Glycine max]
Length=204

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  122  VVAAGLGKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPVFDT  181

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  182  LDVSPLLAFAVLGTLGS  198



>ref|XP_004144422.1| PREDICTED: uncharacterized protein LOC101222332 [Cucumis sativus]
 ref|XP_011651705.1| PREDICTED: uncharacterized protein LOC101222332 [Cucumis sativus]
 ref|XP_011651706.1| PREDICTED: uncharacterized protein LOC101222332 [Cucumis sativus]
 gb|KGN58431.1| hypothetical protein Csa_3G642720 [Cucumis sativus]
Length=228

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  143  VVAVGLAKWLDIYSGVLMVRVLLSWFPNVPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  202

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL A  +
Sbjct  203  LDVSPLLAFAVLGALGA  219



>emb|CDP03954.1| unnamed protein product [Coffea canephora]
Length=223

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  139  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  198

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  199  LDISPLLAFAVLGTLGS  215



>ref|WP_017309436.1| hypothetical protein [Fischerella sp. PCC 9339]
 gb|KIY10980.1| membrane protein [Mastigocladus laminosus UU774]
Length=94

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 9/73 (12%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNA-----PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLS  345
             F+ IY++LL++R++LTWFPN      P A    LS + DPYLNIFR IIPPLGG +D S
Sbjct  10   TFIQIYSTLLIIRVLLTWFPNINWYNQPFA---ALSQITDPYLNIFRNIIPPLGG-IDFS  65

Query  344  PILAFLVLNAFTS  306
            PILAFLVLN  +S
Sbjct  66   PILAFLVLNIVSS  78



>ref|XP_009799559.1| PREDICTED: uncharacterized protein LOC104245629 [Nicotiana sylvestris]
 ref|XP_009799560.1| PREDICTED: uncharacterized protein LOC104245629 [Nicotiana sylvestris]
Length=231

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  146  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  205

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  206  LDVSPLLAFAVLGTLGS  222



>ref|XP_009620301.1| PREDICTED: uncharacterized protein LOC104112161 [Nicotiana tomentosiformis]
Length=231

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  146  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  205

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  206  LDVSPLLAFAVLGTLGS  222



>ref|XP_004303819.1| PREDICTED: uncharacterized protein LOC101314968 [Fragaria vesca 
subsp. vesca]
Length=213

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  128  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  187

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  188  LDVSPLLAFAVLGTLGS  204



>gb|AAM66973.1| unknown [Arabidopsis thaliana]
Length=234

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  151  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  210

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  211  LDVSPLLAFAVLGTLGS  227



>ref|WP_017662674.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=92

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 7/82 (9%)
 Frame = -2

Query  533  IVVTNGILNFLNIYNSLLVVRLVLTWFPNA----PPAIVSPLSTLCDPYLNIFRGIIPPL  366
            +++T  ++ FLNIY +LL++R++L+WFPN     PP   S LS L DPYLN+FR IIPPL
Sbjct  6    LLLTQTLVTFLNIYFALLIIRILLSWFPNVNWYDPPF--SILSQLTDPYLNLFRSIIPPL  63

Query  365  GGTLDLSPILAFLVLNAFTSTA  300
            GG LD SPI+A L+L    S  
Sbjct  64   GG-LDFSPIIAILLLQVVQSLV  84



>ref|XP_010092852.1| Uncharacterized protein ycf19 [Morus notabilis]
 gb|EXB52670.1| Uncharacterized protein ycf19 [Morus notabilis]
Length=309

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  225  VVAAGLAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  284

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  285  LDVSPLLAFAVLGTLGS  301



>ref|XP_002301821.2| YGGT family protein [Populus trichocarpa]
 gb|EEE81094.2| YGGT family protein [Populus trichocarpa]
Length=251

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  166  VVAAGLAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  225

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  226  LDVSPLLAFAVLGTLGS  242



>ref|XP_009387199.1| PREDICTED: uncharacterized protein LOC103974162 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  139  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  198

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  199  LDVSPLLAFAVLGTLGS  215



>ref|XP_002263900.1| PREDICTED: uncharacterized protein LOC100253131 [Vitis vinifera]
 emb|CBI22471.3| unnamed protein product [Vitis vinifera]
Length=195

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+   
Sbjct  110  VVAAGMAKWLDIYSGVLMVRVMLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPVFDA  169

Query  356  LDLSPILAFLVLNAFTS  306
            LDLSP+LAF VL    S
Sbjct  170  LDLSPLLAFSVLGVLGS  186



>ref|XP_006352658.1| PREDICTED: uncharacterized protein LOC102587508 isoform X1 [Solanum 
tuberosum]
 ref|XP_006352659.1| PREDICTED: uncharacterized protein LOC102587508 isoform X2 [Solanum 
tuberosum]
Length=222

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  137  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  196

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  197  LDVSPLLAFAVLGTLGS  213



>ref|XP_010673289.1| PREDICTED: uncharacterized protein LOC104889701 [Beta vulgaris 
subsp. vulgaris]
Length=228

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 76/148 (51%), Gaps = 18/148 (12%)
 Frame = -2

Query  743  RFHSSVVSAADNCLKSLHSLLSQNPFFKNLLSLSSHLQDIRQIERRARQNFNTLSSHNFA  564
            +FHS   S + +   +L  L   N    NLL     L     +  R R + NT       
Sbjct  91   KFHSIATSISTSASPTLEELQKLNSLKSNLLCSVGPLF-FAALTDRPRGSLNT-------  142

Query  563  AIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNI  390
                       VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+
Sbjct  143  --------PLTVVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNL  194

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTS  306
            FR IIPP+  TLD+SP+LAF VL    S
Sbjct  195  FRNIIPPVFDTLDVSPLLAFAVLGVLGS  222



>gb|EYU40657.1| hypothetical protein MIMGU_mgv1a013023mg [Erythranthe guttata]
Length=232

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L++Y+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  147  VVAAGMAKWLDLYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  206

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  207  LDVSPLLAFAVLGTLGS  223



>ref|WP_008317950.1| putative integral membrane protein [Leptolyngbya sp. PCC 6406]
Length=97

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 7/75 (9%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNA----PPAIVSPLSTLCDPYLNIFRGIIPPLG  363
            +V + +  FLNIY  LLV+R++L+WFPN     PP   S +S L DPYLN+FR IIPPLG
Sbjct  8    LVASTLSTFLNIYFILLVIRVLLSWFPNVDWLNPP--FSVISQLTDPYLNLFRSIIPPLG  65

Query  362  GTLDLSPILAFLVLN  318
            G LDLSP+LAF+VL 
Sbjct  66   G-LDLSPLLAFIVLQ  79



>ref|XP_009587816.1| PREDICTED: uncharacterized protein LOC104085478 [Nicotiana tomentosiformis]
Length=219

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  134  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  193

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  194  LDVSPLLAFAVLGTLGS  210



>ref|XP_010486296.1| PREDICTED: uncharacterized protein LOC104764458 [Camelina sativa]
Length=226

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  144  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  203

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  204  LDVSPLLAFSVLGTLGS  220



>ref|XP_002527246.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35090.1| conserved hypothetical protein [Ricinus communis]
Length=226

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  141  VVAAGLAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  200

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  201  LDVSPLLAFAVLGMLGS  217



>ref|XP_011089625.1| PREDICTED: uncharacterized protein LOC105170526 [Sesamum indicum]
Length=231

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L++Y+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  146  VVAAGMAKWLDLYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  205

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+ AF VL A  S
Sbjct  206  LDVSPLFAFAVLGALGS  222



>gb|KJB42572.1| hypothetical protein B456_007G159100 [Gossypium raimondii]
Length=227

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 78/131 (60%), Gaps = 17/131 (13%)
 Frame = -2

Query  653  LSLSSHLQDIRQIERRA----RQNFNTLSSHN---FAAIIPGDSVAG------IVVTNGI  513
            L+LS+ +   + I+  A     QN N LS+     FA++   D  +G       VV  G+
Sbjct  90   LALSATIVFTKMIQNYALKTISQNPNALSTVGPLFFASL--KDRPSGYLNTPLTVVAAGL  147

Query  512  LNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPI  339
              +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  TLD+SP+
Sbjct  148  AKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDTLDVSPL  207

Query  338  LAFLVLNAFTS  306
            LAF VL    S
Sbjct  208  LAFAVLGTLGS  218



>ref|XP_010438523.1| PREDICTED: uncharacterized protein LOC104722113 [Camelina sativa]
Length=220

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  137  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  196

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  197  LDVSPLLAFAVLGTLGS  213



>ref|XP_010438522.1| PREDICTED: uncharacterized protein LOC104722112 [Camelina sativa]
Length=220

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  137  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  196

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  197  LDVSPLLAFAVLGTLGS  213



>ref|XP_008786168.1| PREDICTED: platelet glycoprotein Ib alpha chain-like [Phoenix 
dactylifera]
Length=274

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  189  VVASGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  248

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  249  LDVSPLLAFAVLGTLGS  265



>ref|XP_007049612.1| YGGT family protein [Theobroma cacao]
 gb|EOX93769.1| YGGT family protein [Theobroma cacao]
Length=226

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  141  VVAAGLAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  200

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  201  LDVSPLLAFAVLGTLGS  217



>ref|XP_002265251.1| PREDICTED: uncharacterized protein LOC100251416 [Vitis vinifera]
 emb|CBI39425.3| unnamed protein product [Vitis vinifera]
Length=233

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  148  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  207

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  208  LDVSPLLAFAVLGTLGS  224



>ref|XP_006437216.1| hypothetical protein CICLE_v10033520mg [Citrus clementina]
 gb|ESR50456.1| hypothetical protein CICLE_v10033520mg [Citrus clementina]
Length=156

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  72   VVAAGLAKWLDIYSGVLLVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  131

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  132  LDVSPLLAFAVLGTLGS  148



>ref|XP_010433280.1| PREDICTED: uncharacterized protein LOC104717425 [Camelina sativa]
Length=220

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  137  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  196

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  197  LDVSPLLAFAVLGTLGS  213



>ref|XP_006407837.1| hypothetical protein EUTSA_v10021454mg [Eutrema salsugineum]
 gb|ESQ49290.1| hypothetical protein EUTSA_v10021454mg [Eutrema salsugineum]
Length=228

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  145  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  204

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  205  LDVSPLLAFAVLGTLGS  221



>ref|XP_006298360.1| hypothetical protein CARUB_v10014430mg, partial [Capsella rubella]
 gb|EOA31258.1| hypothetical protein CARUB_v10014430mg, partial [Capsella rubella]
Length=260

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR +IPP+  T
Sbjct  177  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNVIPPIFDT  236

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  237  LDVSPLLAFAVLGTLGS  253



>ref|XP_010448050.1| PREDICTED: uncharacterized protein LOC104730562 [Camelina sativa]
Length=220

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  137  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  196

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  197  LDVSPLLAFAVLGTLGS  213



>gb|AAM64721.1| unknown [Arabidopsis thaliana]
Length=218

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  135  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDGQPLSAIRDLCDPYLNLFRNIIPPVFDT  194

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  195  LDVSPLLAFAVLGTLGS  211



>ref|WP_015205556.1| hypothetical protein [Crinalium epipsammum]
 gb|AFZ15466.1| protein of unknown function YGGT [Crinalium epipsammum PCC 9333]
Length=95

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGT  357
            ++T  I  FL IY  LLVVR++LTWFP       I + LS L DPYL++FR  IPPLGGT
Sbjct  7    LLTTSIYYFLQIYIFLLVVRILLTWFPTVEWMNQITATLSPLTDPYLDLFRSFIPPLGGT  66

Query  356  LDLSPILAFLVLN  318
            LD+SP+LA  +L 
Sbjct  67   LDISPMLAIFLLQ  79



>ref|NP_194528.1| YGGT family protein [Arabidopsis thaliana]
 emb|CAB36768.1| putative protein [Arabidopsis thaliana]
 emb|CAB79601.1| putative protein [Arabidopsis thaliana]
 dbj|BAE98662.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85417.1| YGGT family protein [Arabidopsis thaliana]
Length=218

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  135  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  194

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  195  LDVSPLLAFAVLGTLGS  211



>ref|XP_010936393.1| PREDICTED: uncharacterized protein LOC105056026 [Elaeis guineensis]
Length=238

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  153  VVASGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  212

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  213  LDVSPLLAFAVLGTLGS  229



>ref|XP_009758250.1| PREDICTED: uncharacterized protein LOC104210966 [Nicotiana sylvestris]
Length=219

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  134  VVAAGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  193

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  194  LDVSPLLAFAVLGTLGS  210



>ref|XP_008227970.1| PREDICTED: uncharacterized protein LOC103327420 [Prunus mume]
 ref|XP_008227971.1| PREDICTED: uncharacterized protein LOC103327420 [Prunus mume]
 ref|XP_008227972.1| PREDICTED: uncharacterized protein LOC103327420 [Prunus mume]
Length=224

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 10/96 (10%)
 Frame = -2

Query  569  FAAIIPGDSVAG------IVVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLST  414
            FAA+  GD  +G       VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  
Sbjct  122  FAAL--GDRPSGYLNTPLTVVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRD  179

Query  413  LCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTS  306
            LCDPYLN+FR IIPP+  TLD+SP+LAF VL    S
Sbjct  180  LCDPYLNLFRNIIPPIFDTLDVSPLLAFAVLGTLGS  215



>gb|AHA84186.1| YGGT family protein [Phaseolus vulgaris]
Length=204

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  122  VVAAGLGKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPVFDT  181

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  182  LDVSPLLAFAVLGTLGS  198



>ref|XP_007215935.1| hypothetical protein PRUPE_ppa011088mg [Prunus persica]
 gb|EMJ17134.1| hypothetical protein PRUPE_ppa011088mg [Prunus persica]
Length=224

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 10/96 (10%)
 Frame = -2

Query  569  FAAIIPGDSVAG------IVVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLST  414
            FAA+  GD  +G       VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  
Sbjct  122  FAAL--GDRPSGYLNTPLTVVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRD  179

Query  413  LCDPYLNIFRGIIPPLGGTLDLSPILAFLVLNAFTS  306
            LCDPYLN+FR IIPP+  TLD+SP+LAF VL    S
Sbjct  180  LCDPYLNLFRNIIPPIFDTLDVSPLLAFAVLGTLGS  215



>ref|WP_015955324.1| hypothetical protein [Cyanothece sp. PCC 7424]
 gb|ACK71728.1| protein of unknown function YGGT [Cyanothece sp. PCC 7424]
Length=98

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 3/68 (4%)
 Frame = -2

Query  515  ILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSP  342
            ++NFL IY+ LL+ R++L+WF  A  A  I+S LS + DPYLNIFR IIPPLGG +D SP
Sbjct  13   LINFLQIYSILLIARILLSWFQGASWAYGIISFLSPITDPYLNIFRSIIPPLGG-MDFSP  71

Query  341  ILAFLVLN  318
            ILAF++L+
Sbjct  72   ILAFILLS  79



>ref|WP_035985781.1| membrane protein [Leptolyngbya sp. KIOST-1]
Length=94

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 7/75 (9%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPN----APPAIVSPLSTLCDPYLNIFRGIIPPLG  363
            ++   +  FL+IY  LL+VR++L+WFPN    +PP   S LS L DPYLN+FR IIPPLG
Sbjct  3    ILVQTLTTFLSIYTILLIVRILLSWFPNVDWFSPP--FSVLSQLTDPYLNLFRSIIPPLG  60

Query  362  GTLDLSPILAFLVLN  318
            G +DLSPILAFL+L+
Sbjct  61   G-IDLSPILAFLLLS  74



>ref|XP_009145744.1| PREDICTED: uncharacterized protein LOC103869420 [Brassica rapa]
Length=217

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  135  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  194

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  195  LDVSPLLAFAVLGTLGS  211



>ref|XP_002867475.1| YGGT family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43734.1| YGGT family protein [Arabidopsis lyrata subsp. lyrata]
Length=210

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  128  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  187

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  188  LDVSPLLAFAVLGTLGS  204



>ref|XP_007135850.1| hypothetical protein PHAVU_010G163400g [Phaseolus vulgaris]
 gb|ESW07844.1| hypothetical protein PHAVU_010G163400g [Phaseolus vulgaris]
Length=204

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  122  VVAAGLGKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPVFDT  181

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  182  LDVSPLLAFAVLGTLGS  198



>ref|XP_010241669.1| PREDICTED: uncharacterized protein LOC104586206 [Nelumbo nucifera]
Length=255

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+   
Sbjct  170  VVASGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDA  229

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  230  LDVSPLLAFAVLGTLGS  246



>ref|WP_011432695.1| membrane protein [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD02041.1| conserved hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
Length=109

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
             F+ IYN+LL+VR++L+WFP  N    I+S LS L DPYLN+FRGIIPP+GG LD SP L
Sbjct  35   QFIVIYNALLIVRILLSWFPQLNWSNPILSVLSQLTDPYLNLFRGIIPPIGG-LDFSPWL  93

Query  335  AFLVLN  318
            AF++L+
Sbjct  94   AFILLS  99



>ref|XP_008805970.1| PREDICTED: uncharacterized protein LOC103718780 [Phoenix dactylifera]
Length=238

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  153  VVASGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  212

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  213  LDVSPLLAFAVLGTLGS  229



>ref|XP_012084994.1| PREDICTED: uncharacterized protein LOC105644299 [Jatropha curcas]
 gb|KDP45256.1| hypothetical protein JCGZ_15121 [Jatropha curcas]
Length=253

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  168  VVAAGLAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  227

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  228  LDVSPLLAFAVLGTLGS  244



>ref|XP_008805971.1| PREDICTED: uncharacterized protein LOC103718781 [Phoenix dactylifera]
Length=238

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV +G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  153  VVASGMAKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  212

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  213  LDVSPLLAFAVLGTLGS  229



>ref|XP_010527281.1| PREDICTED: uncharacterized protein LOC104804641 [Tarenaya hassleriana]
 ref|XP_010527282.1| PREDICTED: uncharacterized protein LOC104804641 [Tarenaya hassleriana]
Length=229

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  145  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  204

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  205  LDVSPLLAFAVLGTLGS  221



>ref|XP_010451956.1| PREDICTED: uncharacterized protein LOC104734111 [Camelina sativa]
Length=235

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  153  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  212

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  213  LDVSPLLAFSVLGILGS  229



>ref|XP_006414996.1| hypothetical protein EUTSA_v10026192mg [Eutrema salsugineum]
 gb|ESQ56449.1| hypothetical protein EUTSA_v10026192mg [Eutrema salsugineum]
Length=221

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  138  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  197

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  198  LDVSPLLAFAVLGTLGS  214



>gb|KFK29324.1| hypothetical protein AALP_AA7G118600 [Arabis alpina]
Length=215

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  132  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPVFDT  191

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  192  LDVSPLLAFAVLGTLGS  208



>ref|XP_008342639.1| PREDICTED: uncharacterized protein LOC103405417, partial [Malus 
domestica]
Length=259

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  174  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  233

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  234  LDVSPLLAFAVLGTLGS  250



>ref|XP_010464364.1| PREDICTED: uncharacterized protein LOC104744930 [Camelina sativa]
Length=235

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  GI  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  153  VVAVGIKKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPIFDT  212

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  213  LDVSPLLAFSVLGILGS  229



>ref|XP_006468566.1| PREDICTED: uncharacterized protein LOC102630904 [Citrus sinensis]
 gb|KDO77235.1| hypothetical protein CISIN_1g028405mg [Citrus sinensis]
Length=209

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  125  VVAAGLAKWLDIYSGVLLVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPVFDT  184

Query  356  LDLSPILAFLVLNAF  312
            LD+SP+LAF VL   
Sbjct  185  LDVSPLLAFAVLGTL  199



>ref|XP_006448610.1| hypothetical protein CICLE_v10016703mg [Citrus clementina]
 gb|ESR61850.1| hypothetical protein CICLE_v10016703mg [Citrus clementina]
Length=209

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  125  VVAAGLAKWLDIYSGVLLVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLFRNIIPPVFDT  184

Query  356  LDLSPILAFLVLNAF  312
            LD+SP+LAF VL   
Sbjct  185  LDVSPLLAFAVLGTL  199



>gb|KJB08761.1| hypothetical protein B456_001G102300 [Gossypium raimondii]
Length=222

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  137  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  196

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  197  LDVSPLLAFAVLGTLGS  213



>ref|XP_002989440.1| hypothetical protein SELMODRAFT_447668 [Selaginella moellendorffii]
 gb|EFJ09531.1| hypothetical protein SELMODRAFT_447668 [Selaginella moellendorffii]
Length=207

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP----PAIVSPLSTLCDPYLNIFRGIIPPLG  363
            VV +G+  +L +Y++++++R++L+WFPN P    P +   +  +CDPYLN+FR IIPP+ 
Sbjct  123  VVASGMAKWLELYSAVMMIRVLLSWFPNIPWEKQPFMA--IRDMCDPYLNLFRNIIPPVF  180

Query  362  GTLDLSPILAFLVLNAFTS  306
              LDLSP+LAF+VL   +S
Sbjct  181  NALDLSPLLAFMVLGTMSS  199



>ref|XP_008380376.1| PREDICTED: uncharacterized protein LOC103443337 [Malus domestica]
Length=223

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  141  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  200

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  201  LDVSPLLAFAVLGTLGS  217



>ref|XP_006284355.1| hypothetical protein CARUB_v10005528mg [Capsella rubella]
 gb|EOA17253.1| hypothetical protein CARUB_v10005528mg [Capsella rubella]
Length=261

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR +IPP+  T
Sbjct  178  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNVIPPVFDT  237

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  238  LDVSPLLAFAVLGTLGS  254



>ref|XP_009346313.1| PREDICTED: uncharacterized protein LOC103938040 [Pyrus x bretschneideri]
Length=224

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  139  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  198

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  199  LDVSPLLAFAVLGTLGS  215



>ref|XP_009345352.1| PREDICTED: uncharacterized protein LOC103937165 [Pyrus x bretschneideri]
Length=224

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  139  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  198

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  199  LDVSPLLAFAVLGTLGS  215



>gb|AJK93583.1| YGGT family protein [Suaeda glauca]
Length=219

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR IIPP+  T
Sbjct  134  VVAAGMSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIIPPIFDT  193

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  194  LDVSPLLAFAVLGTLGS  210



>ref|WP_036000850.1| membrane protein [Leptolyngbya sp. JSC-1]
Length=96

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 9/80 (11%)
 Frame = -2

Query  545  SVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNA----PPAIVSPLSTLCDPYLNIFRGI  378
            S+A I +  G   FL IY+ LL+VR++L+WFPN     PP  +S LS + DPYLN+FR I
Sbjct  4    SIALIAIALG--QFLQIYSVLLIVRILLSWFPNIDLYNPP--LSFLSQITDPYLNLFRSI  59

Query  377  IPPLGGTLDLSPILAFLVLN  318
            IPPLGG +D SPILA  VLN
Sbjct  60   IPPLGG-IDFSPILAIFVLN  78



>ref|XP_010557753.1| PREDICTED: uncharacterized protein LOC104826649 [Tarenaya hassleriana]
Length=227

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP--PAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+FR I+PP+  T
Sbjct  143  VVAAGLSKWLDIYSGVLMVRVLLSWFPNIPWDRQPLSAIRDLCDPYLNLFRNIVPPVFDT  202

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  203  LDVSPLLAFAVLGTLGS  219



>ref|WP_011430407.1| membrane protein [Synechococcus sp. JA-3-3Ab]
 gb|ABC99729.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
Length=109

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
             F+ IYN+LL+VR++L+WFP  N    I+S LS L DPYLN+FRG+IPP+GG LD SP L
Sbjct  35   QFIVIYNALLIVRILLSWFPQLNWSNPILSVLSQLTDPYLNLFRGLIPPIGG-LDFSPWL  93

Query  335  AFLVLN  318
            AF++L+
Sbjct  94   AFILLS  99



>ref|XP_008460284.1| PREDICTED: uncharacterized protein LOC103499156 [Cucumis melo]
 ref|XP_008460286.1| PREDICTED: uncharacterized protein LOC103499156 [Cucumis melo]
 ref|XP_008460287.1| PREDICTED: uncharacterized protein LOC103499156 [Cucumis melo]
Length=229

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 7/87 (8%)
 Frame = -2

Query  545  SVAGI-----VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIF  387
            SV G+     VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+F
Sbjct  135  SVGGLNTPLTVVAVGLAKWLDIYSGILMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLF  194

Query  386  RGIIPPLGGTLDLSPILAFLVLNAFTS  306
            R IIPP+  TLD+SP+LAF VL    S
Sbjct  195  RNIIPPVFDTLDVSPLLAFAVLGTLGS  221



>ref|XP_002962858.1| hypothetical protein SELMODRAFT_438165 [Selaginella moellendorffii]
 gb|EFJ36321.1| hypothetical protein SELMODRAFT_438165 [Selaginella moellendorffii]
Length=203

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAP----PAIVSPLSTLCDPYLNIFRGIIPPLG  363
            VV +G+  +L +Y++++++R++L+WFPN P    P +   +  +CDPYLN+FR IIPP+ 
Sbjct  119  VVASGMAKWLELYSAVMMIRVLLSWFPNIPWEKQPFMA--IRDMCDPYLNLFRNIIPPVF  176

Query  362  GTLDLSPILAFLVLNAFTS  306
              LDLSP+LAF+VL   +S
Sbjct  177  NALDLSPLLAFMVLGTMSS  195



>ref|NP_001238520.1| uncharacterized protein LOC100500209 [Glycine max]
 gb|ACU15204.1| unknown [Glycine max]
Length=192

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LC PYLN+FR IIPP+  T
Sbjct  110  VVAAGLGKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCGPYLNLFRNIIPPVFDT  169

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  170  LDVSPLLAFAVLGTLGS  186



>ref|WP_011293831.1| MULTISPECIES: membrane protein [Prochlorococcus]
 gb|AAZ57789.1| uncharacterized YGGT family conserved membrane protein [Prochlorococcus 
marinus str. NATL2A]
 gb|ABM75527.1| conserved hypothetical membrane protein [Prochlorococcus marinus 
str. NATL1A]
 gb|AIQ97077.1| Cell division protein YlmG/Ycf19 [Prochlorococcus sp. MIT 0801]
Length=100

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 5/68 (7%)
 Frame = -2

Query  515  ILNFLNIYNSLLVVRLVLTWFPN---APPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLS  345
            +L  L IY+++L++R++LTWFPN   + P +V+ L  + DPYLN FRGIIPPL G LDLS
Sbjct  13   LLKTLGIYSTILIIRVLLTWFPNLDMSNPILVN-LCAITDPYLNFFRGIIPPLAG-LDLS  70

Query  344  PILAFLVL  321
            PILAF+V+
Sbjct  71   PILAFVVI  78



>emb|CBJ31375.1| conserved unknown protein [Ectocarpus siliculosus]
Length=237

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 2/100 (2%)
 Frame = -2

Query  566  AAIIPGDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA-IVSPLSTLCDPYLNI  390
            AA +PGDS    VV  G+LNFL+IYN L+  R++L+W P       + P+  L DPYLN 
Sbjct  72   AAALPGDSFTSEVVVGGVLNFLSIYNLLITGRVLLSWVPQLQGVQALEPVYLLTDPYLNA  131

Query  389  FRGIIPPLGGTLDLSPILAFLVLNAFTSTAFALPAELPPP  270
            FR +   +GG LDLS + AF +L+  T+   +L AE+P P
Sbjct  132  FRRLNLTIGG-LDLSVLPAFFLLSFATNAVASLGAEMPAP  170



>ref|XP_004507553.1| PREDICTED: uncharacterized protein LOC101511801 [Cicer arietinum]
Length=215

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYL++FR +IPP+  T
Sbjct  133  VVAAGLKKWLDIYSGVLLVRVLLSWFPNIPWERQPLSAIRDLCDPYLSLFRNVIPPVFDT  192

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  193  LDISPLLAFAVLGTLAS  209



>gb|KGF87526.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
EQPAC1]
Length=91

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    I+S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  12   LSIYSFILIIRILLTWFPGIDWSNGILSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  70

Query  329  LVLNA  315
            L+LN 
Sbjct  71   LLLNV  75



>ref|WP_011125077.1| MULTISPECIES: membrane protein [Prochlorococcus]
 ref|NP_875317.1| Uncharacterized YGGT family conserved membrane protein [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|AAP99969.1| Uncharacterized YGGT family conserved membrane protein [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|KGG11687.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
LG]
Length=101

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L IY+ +L++R++LTWFPN   +  I+S +S + DPYLN+FRGIIP +GG LD+SPILAF
Sbjct  16   LFIYSYILILRVLLTWFPNLDWSNPILSNISAITDPYLNLFRGIIPAIGG-LDISPILAF  74

Query  329  LVLN  318
            +VLN
Sbjct  75   IVLN  78



>ref|WP_025926473.1| membrane protein [Prochlorococcus sp. scB241_528J8]
Length=92

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    I+S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGILSALASITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_011132543.1| membrane protein [Prochlorococcus marinus]
 emb|CAE19369.1| conserved hypothetical membrane protein [Prochlorococcus marinus 
subsp. pastoris str. CCMP1986]
 gb|ABM72200.1| conserved hypothetical membrane protein [Prochlorococcus marinus 
str. MIT 9515]
Length=92

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    I+S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGILSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_044151357.1| membrane protein [Aphanocapsa montana]
Length=97

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = -2

Query  551  GDSVAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGI  378
            G S  G+        FLNIY  LL++R++L+WFPN        + LS L DPYLN+FR +
Sbjct  2    GSSFVGMF-AQAFATFLNIYFVLLIIRILLSWFPNVDWMSQPFATLSQLTDPYLNLFRSL  60

Query  377  IPPLGGTLDLSPILAFLVLNA  315
            IPPLGG +D SPIL FLVL  
Sbjct  61   IPPLGG-IDFSPILGFLVLQV  80



>ref|WP_025947338.1| membrane protein [Prochlorococcus sp. scB241_528N8]
Length=92

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPP--AIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP+      ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPDIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>gb|KHN39369.1| Hypothetical protein glysoja_018141 [Glycine soja]
Length=192

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYLN+ R IIPP+  T
Sbjct  110  VVAAGLGKWLDIYSGVLMVRVLLSWFPNIPWERQPLSAIRDLCDPYLNLSRNIIPPVFDT  169

Query  356  LDLSPILAFLVLNAFTS  306
            LD+SP+LAF VL    S
Sbjct  170  LDVSPLLAFAVLGTLGS  186



>ref|WP_032526167.1| membrane protein [Prochlorococcus marinus]
 gb|KGF98578.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9302]
Length=92

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_011862920.1| membrane protein [Prochlorococcus marinus]
 gb|ABO17572.1| conserved hypothetical membrane protein [Prochlorococcus marinus 
str. MIT 9301]
Length=92

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 53/65 (82%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +   +++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNSVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_025941637.1| membrane protein [Prochlorococcus sp. scB245a_518O7]
Length=92

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 53/65 (82%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +   +++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNSVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_025973296.1| membrane protein [Prochlorococcus sp. scB241_528P18]
Length=92

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_025962929.1| membrane protein [Prochlorococcus sp. scB245a_521O20]
Length=92

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_025881389.1| MULTISPECIES: membrane protein [Prochlorococcus]
Length=92

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_002807500.1| MULTISPECIES: membrane protein [Prochlorococcus]
 gb|ABB49950.1| conserved hypothetical membrane protein [Prochlorococcus marinus 
str. MIT 9312]
 gb|ABM70235.1| conserved hypothetical membrane protein [Prochlorococcus marinus 
str. AS9601]
 gb|ABV50596.1| Predicted integral membrane protein [Prochlorococcus marinus 
str. MIT 9215]
 gb|EEE40679.1| putative YGGT family protein [Prochlorococcus marinus str. MIT 
9202]
 gb|AIQ95001.1| Cell division protein YlmG/Ycf19 [Prochlorococcus sp. MIT 0604]
 gb|KGF99054.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9311]
 gb|KGG02182.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9314]
 gb|KGG09657.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
SB]
Length=92

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_025970194.1| membrane protein [Prochlorococcus sp. scB243_498G3]
Length=92

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_025943806.1| membrane protein [Prochlorococcus sp. scB241_527E15]
Length=92

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>gb|KGF89596.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9107]
 gb|KGF90395.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9116]
Length=93

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    I+S ++++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  14   LSIYSFILIIRILLTWFPGIDWSNGILSAITSITDPYLNIFRGIIPPIGG-FDISSLLAF  72

Query  329  LVLNA  315
            L+LN 
Sbjct  73   LLLNV  77



>ref|WP_036917632.1| MULTISPECIES: membrane protein [Prochlorococcus]
Length=101

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = -2

Query  497  IYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFLV  324
            IY+ +L++R++LTWFPN   +  ++S +S + DPYLN+FRGIIP +GG LD+SPILAF+V
Sbjct  18   IYSYILILRVLLTWFPNLDWSNPVLSNISAITDPYLNLFRGIIPAIGG-LDISPILAFIV  76

Query  323  LNA  315
            LN 
Sbjct  77   LNV  79



>ref|WP_011364402.1| membrane protein [Synechococcus sp. CC9605]
 gb|ABB35187.1| conserved hypothetical membrane protein [Synechococcus sp. CC9605]
Length=98

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 3/68 (4%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L IY+ +L+VR++L+WFPN      ++S LS + DPYLN FRG+IPPLGG +DLS ILAF
Sbjct  16   LQIYSLVLIVRVLLSWFPNLDWGNPVLSSLSAITDPYLNAFRGLIPPLGG-IDLSAILAF  74

Query  329  LVLNAFTS  306
            L LN   S
Sbjct  75   LALNLLQS  82



>ref|WP_026733210.1| membrane protein [Fischerella sp. PCC 9605]
Length=90

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 9/77 (12%)
 Frame = -2

Query  506  FLNIYNSLLVVRLVLTWFPNA-----PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSP  342
            F+ IY++LL++R++L+WFPN      P A    LS + DPYLNIFR IIPPLGG +D SP
Sbjct  11   FIQIYSTLLIIRVLLSWFPNINWYNQPFA---ALSQITDPYLNIFRNIIPPLGG-MDFSP  66

Query  341  ILAFLVLNAFTSTAFAL  291
            ILAF+VLN  ++  ++L
Sbjct  67   ILAFVVLNIVSNLLYSL  83



>gb|EYU46125.1| hypothetical protein MIMGU_mgv1a022784mg, partial [Erythranthe 
guttata]
Length=147

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPN--APPAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L++Y+ +L VR +L+WFPN       +S +  LCDPYL +FR IIPP+GG 
Sbjct  64   VVAAGMAKWLDLYSGILTVRCMLSWFPNIQWDKQPLSAIRDLCDPYLGLFRNIIPPIGGV  123

Query  356  LDLSPILAFLVLNAFTS  306
            LD + +LAF VL A  S
Sbjct  124  LDPASLLAFGVLGALGS  140



>ref|WP_011619336.1| membrane protein [Synechococcus sp. CC9311]
 gb|ABI47905.1| conserved hypothetical protein [Synechococcus sp. CC9311]
Length=100

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L IY+ +L+VR++LTWFPN      ++S +S++ DPYLN FRG+IPPLGG LDLS ILAF
Sbjct  17   LQIYSFVLIVRVLLTWFPNVDMGNPVLSTVSSITDPYLNAFRGLIPPLGG-LDLSAILAF  75

Query  329  LVLN  318
            + L+
Sbjct  76   IALS  79



>ref|WP_032524419.1| membrane protein [Prochlorococcus marinus]
 gb|KGF87887.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
GP2]
Length=92

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_032514354.1| membrane protein [Prochlorococcus marinus]
 gb|KGF92874.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9123]
Length=92

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    I+S ++++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGILSAITSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>gb|KEH28534.1| YGGT family protein [Medicago truncatula]
Length=214

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGT  357
            VV  G+  +L+IY+ +L+VR++L+WFPN P     +S +  LCDPYL++FR I+PP+  T
Sbjct  132  VVAAGLKKWLDIYSGVLLVRVLLSWFPNIPWERQPLSAIRDLCDPYLSLFRNIVPPVFDT  191

Query  356  LDLSPILAFLVLNAF  312
            LD+SP+LAF VL + 
Sbjct  192  LDISPLLAFAVLGSL  206



>gb|ABE11457.1| conserved hypothetical protein membrane protein [uncultured Prochlorococcus 
marinus clone HOT0M-7B6]
Length=85

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_015141301.1| hypothetical protein [Nostoc sp. PCC 7524]
 gb|AFY50897.1| putative integral membrane protein [Nostoc sp. PCC 7524]
Length=92

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 9/71 (13%)
 Frame = -2

Query  515  ILNFLNIYNSLLVVRLVLTWFPNA-----PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLD  351
            ++ FL+IY+ LL++R++LTWFPN      P A    LS + DPYLN+FR IIPPLGG +D
Sbjct  8    LVTFLSIYSYLLIIRVLLTWFPNVNWYNQPFA---ALSQITDPYLNLFRSIIPPLGG-MD  63

Query  350  LSPILAFLVLN  318
             SPILAFLVL 
Sbjct  64   FSPILAFLVLT  74



>ref|WP_010996222.1| MULTISPECIES: hypothetical protein [Nostocaceae]
 dbj|BAB73760.1| asl2061 [Nostoc sp. PCC 7120]
 gb|ABA22717.1| Protein of unknown function YGGT [Anabaena variabilis ATCC 29413]
Length=92

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 52/71 (73%), Gaps = 9/71 (13%)
 Frame = -2

Query  515  ILNFLNIYNSLLVVRLVLTWFP-----NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLD  351
            ++ F+ IY+ LL++R++LTWFP     N P A    LS + DPYLN+FR IIPPLGG +D
Sbjct  8    LVTFVTIYSYLLIIRVLLTWFPQIDWYNQPFA---ALSQITDPYLNLFRSIIPPLGG-MD  63

Query  350  LSPILAFLVLN  318
             SPILAFLVLN
Sbjct  64   FSPILAFLVLN  74



>ref|WP_039728523.1| membrane protein [Lyngbya confervoides]
 gb|KIF16153.1| membrane protein [Aphanocapsa montana BDHKU210001]
 gb|KIF41073.1| membrane protein [Lyngbya confervoides BDU141951]
Length=90

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNAPPAI--VSPLSTLCDPYLNIFRGIIPPLGGTLDLSPIL  336
             FLNIY  LL++R++L+WFPN        + LS L DPYLN+FR +IPPLGG +D SPIL
Sbjct  8    TFLNIYFVLLIIRILLSWFPNVDWMSQPFATLSQLTDPYLNLFRSLIPPLGG-IDFSPIL  66

Query  335  AFLVLNA  315
             FLVL  
Sbjct  67   GFLVLQV  73



>ref|WP_032517080.1| membrane protein [Prochlorococcus marinus]
 gb|KGG04378.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9322]
 gb|KGG05169.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9321]
 gb|KGG07058.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9401]
Length=92

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_025969814.1| membrane protein, partial [Prochlorococcus sp. scB245a_520E22]
Length=84

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_036907516.1| membrane protein [Prochlorococcus marinus]
 gb|KGG19721.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
PAC1]
Length=100

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = -2

Query  515  ILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSP  342
            +L  L IY+++L++R++LTWFPN   +  I+  L  + DPYLN FRGIIPPL G LDLSP
Sbjct  13   LLKTLGIYSTILIIRVLLTWFPNLDMSNPILLNLCAITDPYLNFFRGIIPPLAG-LDLSP  71

Query  341  ILAFLVL  321
            ILAF+V+
Sbjct  72   ILAFVVI  78



>ref|WP_015173198.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 gb|AFY67634.1| protein of unknown function YGGT [Geitlerinema sp. PCC 7407]
Length=95

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNA----PPAIVSPLSTLCDPYLNIFRGIIPPLG  363
            ++T+ +  FLNIY  LL++R++LTWFPN     PP   S LS L DPYLN+FR IIPPLG
Sbjct  7    LLTSTLATFLNIYFILLIIRVLLTWFPNVNWFDPP--FSILSQLTDPYLNLFRSIIPPLG  64

Query  362  GTLDLSPILAFLVLN  318
            G LDLSP+LA  +L 
Sbjct  65   G-LDLSPVLAIFLLQ  78



>ref|WP_032521445.1| membrane protein [Prochlorococcus marinus]
 gb|KGF97737.1| Cell division protein YlmG/Ycf19 [Prochlorococcus marinus str. 
MIT 9201]
Length=92

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    I+S L ++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGILSALCSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_006852627.1| membrane protein [Synechococcus sp. WH 8016]
 gb|EHA63445.1| protein of unknown function YGGT [Synechococcus sp. WH 8016]
Length=100

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L IY+ +L+VR++LTWFPN      ++S +S++ DPYLN FRG+IPPLGG LDLS ILAF
Sbjct  17   LQIYSFVLIVRVLLTWFPNVDMGNPVLSTVSSITDPYLNAFRGLIPPLGG-LDLSAILAF  75

Query  329  LVLN  318
            + L+
Sbjct  76   VALS  79



>ref|WP_015185263.1| hypothetical protein [Microcoleus sp. PCC 7113]
 gb|AFZ21130.1| putative integral membrane protein [Microcoleus sp. PCC 7113]
Length=87

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 9/77 (12%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFP-----NAPPAIVSPLSTLCDPYLNIFRGIIPPL  366
            +VT+ + NFLNIY  L+V+R++LTWF      N   A +SP++   DPYLNIFR  IPPL
Sbjct  7    LVTSTLGNFLNIYLVLIVIRILLTWFSTVDWVNQVAAFLSPIT---DPYLNIFRAFIPPL  63

Query  365  GGTLDLSPILAFLVLNA  315
            GG LDLSP+LA LVL  
Sbjct  64   GG-LDLSPMLAILVLQV  79



>ref|WP_038332645.1| hypothetical protein, partial [filamentous cyanobacterium ESFC-1]
Length=80

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 3/72 (4%)
 Frame = -2

Query  527  VTNGILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTL  354
            VT  + +FL+IY  LL+VR++LTWF     A  + S LS + DPYLN+FR  IPPLGG +
Sbjct  3    VTQVLYSFLSIYQLLLIVRILLTWFQGMEWASQVASFLSPVTDPYLNVFRSFIPPLGG-I  61

Query  353  DLSPILAFLVLN  318
            DLSPILAF  L+
Sbjct  62   DLSPILAFFALS  73



>ref|WP_040944227.1| hypothetical protein [Prochloron didemni]
Length=93

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = -2

Query  542  VAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPP  369
            +A  ++ N I++F+ IY  LL+VR++LTWF  A  A  I+S LS + DPYLN+FR  IPP
Sbjct  1    MATALLINTIVSFIQIYTVLLIVRVLLTWFQGADWAYQIMSFLSPITDPYLNVFRSFIPP  60

Query  368  LGGTLDLSPILAFLVLN  318
            LGG +D SPILA ++L 
Sbjct  61   LGG-MDFSPILAIILLQ  76



>ref|WP_036921035.1| membrane protein [Prochlorococcus marinus]
Length=93

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++LTWFP  +    I+S L ++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLTWFPGIDWSNGILSALCSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_006454770.1| membrane protein [Synechococcus sp. PCC 7335]
 gb|EDX85027.1| YGGT family, putative [Synechococcus sp. PCC 7335]
Length=101

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = -2

Query  527  VTNGILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTL  354
            +  G+  FL+IY  L+ +R++L+WFPN   +  + S LS L DPYLNIFRGIIPP+GG L
Sbjct  9    IIQGVSTFLSIYLVLIFIRILLSWFPNIDWSNSVFSTLSQLTDPYLNIFRGIIPPIGG-L  67

Query  353  DLSPILAFLVLNAFTS  306
            DLS I+A   L   + 
Sbjct  68   DLSAIIAIFALQILSG  83



>dbj|BAD79232.1| hypothetical protein YCF19 [Synechococcus elongatus PCC 6301]
 gb|ABB56509.1| conserved hypothetical protein YCF19 [Synechococcus elongatus 
PCC 7942]
Length=99

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPA-IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  327
            LNIY  LL++R++L+WFPN   +  +  L  L DPYLN+FR +IPPLGG +D SPILAF 
Sbjct  17   LNIYFVLLIIRVLLSWFPNFQSSQFMLILGQLTDPYLNLFRRVIPPLGG-MDFSPILAFF  75

Query  326  VLNAFTSTAFALPAE  282
            +L A T     L  +
Sbjct  76   ILQAVTQAVQQLAVQ  90



>ref|WP_012162044.1| hypothetical protein [Acaryochloris marina]
 gb|ABW26516.1| YGGT family conserved hypothetical protein [Acaryochloris marina 
MBIC11017]
Length=91

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNA--PPAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            ++ + +  FL IY +LL++R++L+WFPN     A  S LS L DPYLNIFR IIPPLGG 
Sbjct  9    LIASSLATFLQIYFALLIIRILLSWFPNIDWSSAPFSVLSQLTDPYLNIFRSIIPPLGG-  67

Query  356  LDLSPILAFLVLN  318
            +D SPILA  +L 
Sbjct  68   IDFSPILAIFLLQ  80



>ref|WP_029315503.1| membrane protein [Acaryochloris sp. CCMEE 5410]
Length=91

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -2

Query  530  VVTNGILNFLNIYNSLLVVRLVLTWFPNA--PPAIVSPLSTLCDPYLNIFRGIIPPLGGT  357
            ++ + +  FL IY +LL++R++L+WFPN     A  S LS L DPYLNIFR IIPPLGG 
Sbjct  9    LIASSLATFLQIYFALLIIRILLSWFPNIDWSSAPFSVLSQLTDPYLNIFRSIIPPLGG-  67

Query  356  LDLSPILAFLVLN  318
            +D SPILA  +L 
Sbjct  68   IDFSPILAIFLLQ  80



>ref|WP_039755419.1| MULTISPECIES: membrane protein [Synechococcus]
 gb|AJD56448.1| membrane protein [Synechococcus sp. UTEX 2973]
Length=98

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPA-IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAFL  327
            LNIY  LL++R++L+WFPN   +  +  L  L DPYLN+FR +IPPLGG +D SPILAF 
Sbjct  16   LNIYFVLLIIRVLLSWFPNFQSSQFMLILGQLTDPYLNLFRRVIPPLGG-MDFSPILAFF  74

Query  326  VLNAFTSTAFALPAE  282
            +L A T     L  +
Sbjct  75   ILQAVTQAVQQLAVQ  89



>ref|WP_040932409.1| hypothetical protein [Prochloron didemni]
Length=93

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 3/77 (4%)
 Frame = -2

Query  542  VAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPP  369
            +A  ++ N I++F+ IY  LL+VR++LTWF  A  A  I+S LS + DPYLN+FR  IPP
Sbjct  1    MATALLINTIVSFIQIYTVLLIVRVLLTWFQGADWAYQIMSFLSPITDPYLNVFRSFIPP  60

Query  368  LGGTLDLSPILAFLVLN  318
            LGG +D SPILA  +L 
Sbjct  61   LGG-MDFSPILAIFLLQ  76



>ref|WP_006911009.1| membrane protein [Cyanobium sp. PCC 7001]
 gb|EDY39096.1| YGGT family, putative [Cyanobium sp. PCC 7001]
Length=95

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L IY+ +L+VR++L+WFPN   +  ++S +S++ DPYLN+FRG+IPP+GG LDLS ILAF
Sbjct  15   LEIYSLILLVRVLLSWFPNLDWSNPVLSSVSSITDPYLNVFRGLIPPIGG-LDLSAILAF  73

Query  329  LVLN  318
            L L+
Sbjct  74   LALS  77



>gb|AGY57339.1| YggT family protein [Gloeobacter kilaueensis JS1]
Length=91

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 49/70 (70%), Gaps = 9/70 (13%)
 Frame = -2

Query  509  NFLNIYNSLLVVRLVLTWFPNA-----PPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLS  345
            NF+ IY  LL VR++L+WFPN      P AI   LS L DPYLN+FR IIPPLGG +DLS
Sbjct  12   NFIQIYIVLLFVRVLLSWFPNIDWSRNPWAI---LSQLTDPYLNLFRSIIPPLGG-IDLS  67

Query  344  PILAFLVLNA  315
            PILAFL L  
Sbjct  68   PILAFLALQV  77



>ref|WP_025975046.1| membrane protein [Prochlorococcus sp. scB241_529O19]
Length=92

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ +L++R++L+WFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFILIIRILLSWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVLNA  315
            L+LN 
Sbjct  72   LLLNV  76



>ref|WP_040939420.1| hypothetical protein [Prochloron didemni]
Length=93

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = -2

Query  542  VAGIVVTNGILNFLNIYNSLLVVRLVLTWFPNAPPA--IVSPLSTLCDPYLNIFRGIIPP  369
            +A  ++ N I+ F+ IY  LL+VR++LTWF  A  A  I+S LS + DPYLN+FR  IPP
Sbjct  1    MATALLINTIVRFIQIYTVLLIVRVLLTWFQGADWAYQIMSFLSPITDPYLNVFRSFIPP  60

Query  368  LGGTLDLSPILAFLVLN  318
            LGG +D SPILA  +L 
Sbjct  61   LGG-MDFSPILAIFLLQ  76



>ref|WP_025940641.1| membrane protein [Prochlorococcus sp. scB245a_518K17]
Length=92

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = -2

Query  503  LNIYNSLLVVRLVLTWFP--NAPPAIVSPLSTLCDPYLNIFRGIIPPLGGTLDLSPILAF  330
            L+IY+ LL++R++LTWFP  +    ++S L+++ DPYLNIFRGIIPP+GG  D+S +LAF
Sbjct  13   LSIYSFLLIIRILLTWFPGIDWSNGVLSALTSITDPYLNIFRGIIPPIGG-FDISSLLAF  71

Query  329  LVL  321
            L+L
Sbjct  72   LLL  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2706586640309