BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12493

Length=972
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK38726.1|AF369706_1  importin alpha 1                              293   5e-91   Capsicum annuum
ref|XP_009796205.1|  PREDICTED: importin subunit alpha-1                288   6e-89   Nicotiana sylvestris
ref|XP_009592620.1|  PREDICTED: importin subunit alpha-1                286   2e-88   Nicotiana tomentosiformis
ref|XP_006344784.1|  PREDICTED: importin subunit alpha-1                286   2e-88   Solanum tuberosum [potatoes]
ref|XP_004230322.1|  PREDICTED: importin subunit alpha-1                283   4e-87   Solanum lycopersicum
ref|XP_007031183.1|  Importin alpha isoform 1                           280   7e-86   Theobroma cacao [chocolate]
ref|XP_007031184.1|  Importin alpha isoform 2                           280   1e-85   
gb|ABB55384.1|  importin alpha 1-like                                   273   3e-84   Solanum tuberosum [potatoes]
ref|XP_007205030.1|  hypothetical protein PRUPE_ppa004046mg             274   1e-83   Prunus persica
ref|XP_002319478.1|  importin alpha-1 subunit family protein            274   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_008246117.1|  PREDICTED: importin subunit alpha-1                274   1e-83   Prunus mume [ume]
gb|KJB26294.1|  hypothetical protein B456_004G235800                    271   2e-82   Gossypium raimondii
ref|XP_011023801.1|  PREDICTED: importin subunit alpha                  270   4e-82   Populus euphratica
ref|XP_010549392.1|  PREDICTED: importin subunit alpha-1                268   3e-81   Tarenaya hassleriana [spider flower]
emb|CAN64716.1|  hypothetical protein VITISV_026717                     266   1e-80   Vitis vinifera
ref|XP_002281670.1|  PREDICTED: importin subunit alpha                  266   1e-80   Vitis vinifera
ref|XP_010674568.1|  PREDICTED: importin subunit alpha-1a               266   2e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012088868.1|  PREDICTED: importin subunit alpha-4 isoform X1     266   2e-80   Jatropha curcas
ref|XP_012088870.1|  PREDICTED: importin subunit alpha-4 isoform X2     265   2e-80   Jatropha curcas
ref|XP_011092170.1|  PREDICTED: importin subunit alpha                  265   3e-80   Sesamum indicum [beniseed]
ref|XP_008453295.1|  PREDICTED: importin subunit alpha                  265   5e-80   Cucumis melo [Oriental melon]
ref|XP_010270837.1|  PREDICTED: importin subunit alpha-like             264   9e-80   Nelumbo nucifera [Indian lotus]
ref|XP_002512528.1|  importin alpha, putative                           261   1e-79   
emb|CDX94988.1|  BnaC05g06830D                                          262   5e-79   
gb|KFK43224.1|  hypothetical protein AALP_AA1G096500                    262   6e-79   Arabis alpina [alpine rockcress]
ref|NP_001275782.1|  importin alpha                                     262   7e-79   Citrus sinensis [apfelsine]
ref|XP_010024140.1|  PREDICTED: importin subunit alpha                  260   4e-78   Eucalyptus grandis [rose gum]
ref|XP_008370371.1|  PREDICTED: importin subunit alpha-like             259   6e-78   
ref|XP_009337642.1|  PREDICTED: importin subunit alpha-like isofo...    259   7e-78   Pyrus x bretschneideri [bai li]
ref|XP_009337641.1|  PREDICTED: importin subunit alpha-like isofo...    259   7e-78   Pyrus x bretschneideri [bai li]
ref|XP_010267916.1|  PREDICTED: importin subunit alpha-like             258   1e-77   Nelumbo nucifera [Indian lotus]
gb|ABO21639.1|  importin alpha-like protein                             258   2e-77   Brassica napus [oilseed rape]
ref|XP_009148181.1|  PREDICTED: importin subunit alpha-1                258   2e-77   Brassica rapa
emb|CDX93514.1|  BnaA06g05340D                                          258   2e-77   
ref|XP_010475758.1|  PREDICTED: importin subunit alpha-1a-like          254   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010544159.1|  PREDICTED: importin subunit alpha-1b-like          254   5e-76   Tarenaya hassleriana [spider flower]
ref|XP_004302281.1|  PREDICTED: importin subunit alpha-4                254   5e-76   Fragaria vesca subsp. vesca
ref|XP_004144743.1|  PREDICTED: importin subunit alpha-4                253   1e-75   Cucumis sativus [cucumbers]
ref|XP_008388467.1|  PREDICTED: importin subunit alpha-1                253   2e-75   
ref|XP_009373302.1|  PREDICTED: importin subunit alpha-1-like           252   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_006417589.1|  hypothetical protein EUTSA_v10007310mg             252   3e-75   Eutrema salsugineum [saltwater cress]
ref|XP_010458212.1|  PREDICTED: importin subunit alpha-1b-like is...    252   5e-75   Camelina sativa [gold-of-pleasure]
emb|CDY31102.1|  BnaA08g26520D                                          251   5e-75   Brassica napus [oilseed rape]
ref|XP_006304709.1|  hypothetical protein CARUB_v10011976mg             251   7e-75   Capsella rubella
ref|XP_002889740.1|  hypothetical protein ARALYDRAFT_888168             251   9e-75   Arabidopsis lyrata subsp. lyrata
emb|CDY32165.1|  BnaCnng06740D                                          250   2e-74   Brassica napus [oilseed rape]
ref|XP_010458211.1|  PREDICTED: importin subunit alpha-1b-like is...    249   6e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008801729.1|  PREDICTED: importin subunit alpha-1a isoform X2    249   6e-74   Phoenix dactylifera
ref|XP_010914627.1|  PREDICTED: importin subunit alpha isoform X2       248   7e-74   Elaeis guineensis
gb|EYU38410.1|  hypothetical protein MIMGU_mgv1a004192mg                248   1e-73   Erythranthe guttata [common monkey flower]
ref|XP_009110839.1|  PREDICTED: importin subunit alpha-1-like iso...    248   1e-73   Brassica rapa
ref|XP_010914626.1|  PREDICTED: importin subunit alpha isoform X1       248   2e-73   Elaeis guineensis
ref|XP_003554623.1|  PREDICTED: importin subunit alpha-1-like           246   4e-73   Glycine max [soybeans]
ref|XP_003521670.1|  PREDICTED: importin subunit alpha-1-like           246   7e-73   Glycine max [soybeans]
gb|KHN03948.1|  Importin subunit alpha                                  246   8e-73   Glycine soja [wild soybean]
ref|XP_006488809.1|  PREDICTED: importin subunit alpha-1b-like          245   1e-72   Citrus sinensis [apfelsine]
ref|XP_008806746.1|  PREDICTED: importin subunit alpha-1-like           235   1e-72   
ref|XP_002519178.1|  importin alpha, putative                           244   1e-72   
gb|KDO72000.1|  hypothetical protein CISIN_1g009700mg                   244   3e-72   Citrus sinensis [apfelsine]
ref|XP_010931776.1|  PREDICTED: importin subunit alpha-like             244   3e-72   Elaeis guineensis
emb|CAA74966.1|  Importin alpha-like protein                            244   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031011.1|  importin alpha isoform 4                           242   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172398.1|  importin alpha isoform 4                              243   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801728.1|  PREDICTED: importin subunit alpha-1a isoform X1    243   1e-71   Phoenix dactylifera
ref|XP_006842676.1|  PREDICTED: importin subunit alpha-1                242   2e-71   Amborella trichopoda
ref|XP_012084020.1|  PREDICTED: importin subunit alpha-2 isoform X2     241   3e-71   Jatropha curcas
ref|XP_012084019.1|  PREDICTED: importin subunit alpha-2 isoform X1     241   3e-71   Jatropha curcas
ref|XP_003536050.1|  PREDICTED: importin subunit alpha-1-like           241   3e-71   Glycine max [soybeans]
gb|KHN16078.1|  Importin subunit alpha-1                                241   4e-71   Glycine soja [wild soybean]
gb|AES82394.2|  importin subunit alpha-1b                               241   4e-71   Medicago truncatula
ref|XP_003556535.1|  PREDICTED: importin subunit alpha-1-like iso...    241   6e-71   Glycine max [soybeans]
ref|XP_003626176.1|  Importin subunit alpha                             241   8e-71   
ref|XP_011023747.1|  PREDICTED: importin subunit alpha-1-like iso...    240   9e-71   Populus euphratica
ref|XP_010095558.1|  Importin subunit alpha                             243   1e-70   
ref|XP_011023748.1|  PREDICTED: importin subunit alpha-1-like iso...    240   1e-70   Populus euphratica
ref|XP_007144986.1|  hypothetical protein PHAVU_007G199900g             240   1e-70   Phaseolus vulgaris [French bean]
ref|XP_010684628.1|  PREDICTED: importin subunit alpha                  239   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004494548.1|  PREDICTED: importin subunit alpha-like             239   2e-70   Cicer arietinum [garbanzo]
gb|ACF86631.1|  unknown                                                 231   2e-70   Zea mays [maize]
ref|XP_003591197.1|  Importin subunit alpha-1                           239   2e-70   Medicago truncatula
ref|XP_002318966.1|  Importin alpha-1 subunit family protein            239   2e-70   Populus trichocarpa [western balsam poplar]
ref|XP_012088940.1|  PREDICTED: importin subunit alpha-2                239   3e-70   Jatropha curcas
ref|XP_009781700.1|  PREDICTED: importin subunit alpha-1-like iso...    237   3e-70   Nicotiana sylvestris
ref|XP_006380207.1|  hypothetical protein POPTR_0008s22930g             238   4e-70   Populus trichocarpa [western balsam poplar]
ref|XP_006382424.1|  Importin alpha-1 subunit family protein            238   5e-70   Populus trichocarpa [western balsam poplar]
gb|AFW77280.1|  hypothetical protein ZEAMMB73_231111                    229   5e-70   
gb|EYU25627.1|  hypothetical protein MIMGU_mgv1a004356mg                238   5e-70   Erythranthe guttata [common monkey flower]
gb|AAB72116.2|  AtKAP alpha                                             238   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187328.1|  Importin subunit alpha-1                              238   6e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546338.1|  PREDICTED: importin subunit alpha-1-like iso...    238   6e-70   Glycine max [soybeans]
ref|XP_002882488.1|  AT-IMP                                             238   6e-70   
ref|XP_011013186.1|  PREDICTED: importin subunit alpha-1-like           238   6e-70   Populus euphratica
emb|CAA75513.1|  Importin alpha-like protein                            238   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06825.1|  AT3g06720/F3E22_14                                      238   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KHN14650.1|  Importin subunit alpha-1                                238   6e-70   Glycine soja [wild soybean]
ref|XP_003533220.1|  PREDICTED: importin subunit alpha-1-like iso...    238   7e-70   
gb|KHN12909.1|  Importin subunit alpha-1                                238   7e-70   Glycine soja [wild soybean]
ref|XP_009781699.1|  PREDICTED: importin subunit alpha-1-like iso...    238   8e-70   Nicotiana sylvestris
ref|XP_010486198.1|  PREDICTED: importin subunit alpha-1 isoform X1     238   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010094009.1|  Importin subunit alpha-1                           238   1e-69   Morus notabilis
ref|XP_009621534.1|  PREDICTED: importin subunit alpha-1-like           237   1e-69   Nicotiana tomentosiformis
ref|XP_004495675.1|  PREDICTED: importin subunit alpha-1b-like is...    235   1e-69   
gb|EEC78554.1|  hypothetical protein OsI_18524                          236   1e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_011036930.1|  PREDICTED: importin subunit alpha-1 isoform X1     237   2e-69   Populus euphratica
ref|XP_011036931.1|  PREDICTED: importin subunit alpha-1 isoform X2     237   2e-69   Populus euphratica
ref|NP_001054692.1|  Os05g0155500                                       237   2e-69   
gb|KJB82641.1|  hypothetical protein B456_013G206500                    236   3e-69   Gossypium raimondii
ref|XP_004495674.1|  PREDICTED: importin subunit alpha-1b-like is...    236   3e-69   Cicer arietinum [garbanzo]
ref|XP_004487798.1|  PREDICTED: importin subunit alpha-1-like           236   3e-69   Cicer arietinum [garbanzo]
ref|XP_007051048.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 1         236   3e-69   
ref|XP_010444089.1|  PREDICTED: importin subunit alpha-1-like           236   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002512485.1|  importin alpha, putative                           236   4e-69   Ricinus communis
ref|XP_010931697.1|  PREDICTED: importin subunit alpha-1b               236   4e-69   Elaeis guineensis
ref|XP_008797160.1|  PREDICTED: importin subunit alpha-1b-like          236   4e-69   Phoenix dactylifera
ref|XP_004244944.1|  PREDICTED: importin subunit alpha-1                236   5e-69   Solanum lycopersicum
gb|ABM05487.1|  Impa1                                                   236   6e-69   Nicotiana benthamiana
ref|XP_008245768.1|  PREDICTED: importin subunit alpha-1                235   6e-69   Prunus mume [ume]
ref|XP_008810191.1|  PREDICTED: importin subunit alpha-1b-like          235   7e-69   Phoenix dactylifera
gb|KHG29743.1|  Importin subunit alpha-1 -like protein                  236   7e-69   Gossypium arboreum [tree cotton]
ref|XP_007138966.1|  hypothetical protein PHAVU_009G253500g             235   7e-69   Phaseolus vulgaris [French bean]
gb|KJB41861.1|  hypothetical protein B456_007G124900                    233   7e-69   Gossypium raimondii
ref|XP_010464259.1|  PREDICTED: importin subunit alpha-1-like           235   7e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009606138.1|  PREDICTED: importin subunit alpha                  235   8e-69   Nicotiana tomentosiformis
ref|XP_006297392.1|  hypothetical protein CARUB_v10013416mg             235   8e-69   Capsella rubella
ref|XP_008350735.1|  PREDICTED: importin subunit alpha-1b-like          226   8e-69   
ref|XP_002275593.1|  PREDICTED: importin subunit alpha-1 isoform X1     235   8e-69   
ref|XP_010914512.1|  PREDICTED: importin subunit alpha-1b-like          235   9e-69   Elaeis guineensis
gb|KHN03320.1|  Importin subunit alpha-1                                234   1e-68   Glycine soja [wild soybean]
ref|XP_007031099.1|  Importin alpha, ALPHA,AIMP ALPHA isoform 2         235   1e-68   
ref|XP_007205032.1|  hypothetical protein PRUPE_ppa004091mg             235   1e-68   Prunus persica
ref|XP_006345634.1|  PREDICTED: importin subunit alpha-1-like           234   1e-68   Solanum tuberosum [potatoes]
ref|XP_009789105.1|  PREDICTED: importin subunit alpha                  235   1e-68   Nicotiana sylvestris
gb|KJB41862.1|  hypothetical protein B456_007G124900                    235   1e-68   Gossypium raimondii
ref|XP_010093918.1|  Importin subunit alpha                             240   1e-68   
gb|KHG01621.1|  Importin subunit alpha-1 -like protein                  234   1e-68   Gossypium arboreum [tree cotton]
ref|XP_010649543.1|  PREDICTED: importin subunit alpha-1 isoform X2     234   2e-68   
ref|XP_004150082.1|  PREDICTED: importin subunit alpha-1                234   2e-68   Cucumis sativus [cucumbers]
dbj|BAA88950.1|  importin alpha 1b                                      234   2e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_012082851.1|  PREDICTED: importin subunit alpha-like             234   2e-68   Jatropha curcas
dbj|BAK07842.1|  predicted protein                                      227   2e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655009.1|  PREDICTED: importin subunit alpha-1b-like          234   3e-68   Oryza brachyantha
ref|XP_004144766.1|  PREDICTED: importin subunit alpha-2                234   3e-68   Cucumis sativus [cucumbers]
ref|XP_006378029.1|  hypothetical protein POPTR_0010s00370g             226   4e-68   
ref|XP_011046400.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    233   4e-68   Populus euphratica
gb|KHN02923.1|  Importin subunit alpha-1                                233   4e-68   Glycine soja [wild soybean]
ref|XP_003550530.1|  PREDICTED: importin subunit alpha-1-like           233   5e-68   Glycine max [soybeans]
ref|NP_001141568.1|  uncharacterized protein LOC100273684               233   6e-68   Zea mays [maize]
gb|AFW81447.1|  hypothetical protein ZEAMMB73_731576                    233   6e-68   
ref|XP_004977076.1|  PREDICTED: importin subunit alpha-1b-like is...    233   6e-68   Setaria italica
ref|XP_010259399.1|  PREDICTED: importin subunit alpha-1                233   6e-68   Nelumbo nucifera [Indian lotus]
gb|EPS72677.1|  impa2                                                   223   6e-68   Genlisea aurea
dbj|BAE71209.1|  putative importin alpha                                233   6e-68   Trifolium pratense [peavine clover]
gb|AES65063.2|  importin subunit alpha-1b                               233   6e-68   Medicago truncatula
ref|XP_008458386.1|  PREDICTED: importin subunit alpha-1-like           233   7e-68   Cucumis melo [Oriental melon]
ref|XP_010094336.1|  Importin subunit alpha-1                           233   7e-68   Morus notabilis
emb|CDP17235.1|  unnamed protein product                                232   1e-67   Coffea canephora [robusta coffee]
ref|XP_002440631.1|  hypothetical protein SORBIDRAFT_09g004320          232   1e-67   Sorghum bicolor [broomcorn]
ref|XP_003594812.1|  Importin subunit alpha-1                           233   1e-67   
gb|KHG15238.1|  Importin subunit alpha-1 -like protein                  232   1e-67   Gossypium arboreum [tree cotton]
ref|XP_010268071.1|  PREDICTED: importin subunit alpha-1-like           232   1e-67   Nelumbo nucifera [Indian lotus]
gb|KHG28859.1|  Importin subunit alpha-1                                231   2e-67   Gossypium arboreum [tree cotton]
gb|KJB24392.1|  hypothetical protein B456_004G143100                    231   2e-67   Gossypium raimondii
gb|KJB24393.1|  hypothetical protein B456_004G143100                    231   2e-67   Gossypium raimondii
ref|XP_010231685.1|  PREDICTED: importin subunit alpha-1b               231   2e-67   Brachypodium distachyon [annual false brome]
gb|KJB49857.1|  hypothetical protein B456_008G142000                    231   3e-67   Gossypium raimondii
ref|XP_007163337.1|  hypothetical protein PHAVU_001G226400g             231   3e-67   Phaseolus vulgaris [French bean]
ref|NP_001234006.1|  importin subunit alpha                             231   3e-67   Solanum lycopersicum
gb|KHG28860.1|  Importin subunit alpha-1                                231   4e-67   Gossypium arboreum [tree cotton]
ref|XP_008453860.1|  PREDICTED: importin subunit alpha-1                230   7e-67   Cucumis melo [Oriental melon]
ref|XP_009393195.1|  PREDICTED: importin subunit alpha-1b-like          230   7e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009369966.1|  PREDICTED: importin subunit alpha-1-like           230   7e-67   Pyrus x bretschneideri [bai li]
ref|XP_008345591.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    230   8e-67   
ref|XP_009373267.1|  PREDICTED: importin subunit alpha-1b               230   8e-67   Pyrus x bretschneideri [bai li]
ref|XP_010024115.1|  PREDICTED: importin subunit alpha-1a               230   8e-67   Eucalyptus grandis [rose gum]
ref|XP_004295110.1|  PREDICTED: importin subunit alpha-1-like           229   1e-66   Fragaria vesca subsp. vesca
ref|XP_008360253.1|  PREDICTED: importin subunit alpha-1-like iso...    228   1e-66   
ref|XP_006407910.1|  hypothetical protein EUTSA_v10020480mg             229   2e-66   Eutrema salsugineum [saltwater cress]
ref|XP_009412111.1|  PREDICTED: importin subunit alpha-1b-like          229   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001760522.1|  predicted protein                                  229   2e-66   
gb|AII99829.1|  importin alpha                                          229   2e-66   Nicotiana tabacum [American tobacco]
ref|XP_009631847.1|  PREDICTED: importin subunit alpha-1a-like          228   3e-66   Nicotiana tomentosiformis
ref|XP_009338212.1|  PREDICTED: importin subunit alpha-1-like           228   3e-66   Pyrus x bretschneideri [bai li]
gb|KDO87079.1|  hypothetical protein CISIN_1g009679mg                   226   3e-66   Citrus sinensis [apfelsine]
ref|XP_009796163.1|  PREDICTED: importin subunit alpha-1a-like          228   3e-66   Nicotiana sylvestris
gb|EYU46779.1|  hypothetical protein MIMGU_mgv1a0058492mg               224   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_011092122.1|  PREDICTED: importin subunit alpha-1                228   3e-66   Sesamum indicum [beniseed]
ref|XP_008388495.1|  PREDICTED: importin subunit alpha-1b-like          228   3e-66   Malus domestica [apple tree]
ref|XP_008781168.1|  PREDICTED: importin subunit alpha-like isofo...    228   4e-66   Phoenix dactylifera
gb|EMT29219.1|  Importin subunit alpha-1b                               228   4e-66   
gb|ABM05488.1|  Impa2                                                   228   4e-66   Nicotiana benthamiana
ref|XP_007031098.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    229   4e-66   
emb|CDO98799.1|  unnamed protein product                                228   4e-66   Coffea canephora [robusta coffee]
ref|XP_002282816.1|  PREDICTED: importin subunit alpha-1                228   5e-66   Vitis vinifera
ref|XP_002274422.1|  PREDICTED: importin subunit alpha                  228   5e-66   Vitis vinifera
ref|XP_006480039.1|  PREDICTED: importin subunit alpha-like             228   5e-66   Citrus sinensis [apfelsine]
ref|XP_010548966.1|  PREDICTED: importin subunit alpha-1-like           227   6e-66   Tarenaya hassleriana [spider flower]
ref|XP_007154341.1|  hypothetical protein PHAVU_003G110500g             228   7e-66   Phaseolus vulgaris [French bean]
ref|XP_002515324.1|  importin alpha, putative                           226   7e-66   
ref|XP_008360251.1|  PREDICTED: importin subunit alpha-1-like iso...    227   7e-66   
emb|CDO98800.1|  unnamed protein product                                227   9e-66   Coffea canephora [robusta coffee]
ref|XP_009414157.1|  PREDICTED: importin subunit alpha-1a-like          227   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781167.1|  PREDICTED: importin subunit alpha-like isofo...    228   1e-65   Phoenix dactylifera
gb|KDO87077.1|  hypothetical protein CISIN_1g009679mg                   226   1e-65   Citrus sinensis [apfelsine]
ref|XP_001773629.1|  predicted protein                                  227   1e-65   
ref|XP_009347771.1|  PREDICTED: importin subunit alpha-1-like           226   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_001763761.1|  predicted protein                                  226   2e-65   
ref|XP_007222489.1|  hypothetical protein PRUPE_ppa004118mg             226   3e-65   Prunus persica
ref|XP_009612538.1|  PREDICTED: importin subunit alpha-1a-like          226   3e-65   Nicotiana tomentosiformis
ref|XP_001778004.1|  predicted protein                                  226   3e-65   
gb|KHG14170.1|  Importin subunit alpha-1 -like protein                  221   4e-65   Gossypium arboreum [tree cotton]
ref|XP_011079596.1|  PREDICTED: importin subunit alpha-like             225   7e-65   Sesamum indicum [beniseed]
ref|XP_008223291.1|  PREDICTED: importin subunit alpha-1-like           224   7e-65   Prunus mume [ume]
ref|XP_010043209.1|  PREDICTED: importin subunit alpha-1a-like          224   1e-64   Eucalyptus grandis [rose gum]
ref|XP_011082432.1|  PREDICTED: importin subunit alpha-like             224   1e-64   Sesamum indicum [beniseed]
ref|XP_010546997.1|  PREDICTED: importin subunit alpha-1                224   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_009402512.1|  PREDICTED: importin subunit alpha-1b-like          224   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008340751.1|  PREDICTED: importin subunit alpha-1                224   2e-64   
ref|XP_006355841.1|  PREDICTED: importin subunit alpha-like             223   2e-64   Solanum tuberosum [potatoes]
ref|XP_004302255.1|  PREDICTED: importin subunit alpha-1                224   2e-64   Fragaria vesca subsp. vesca
ref|XP_009401503.1|  PREDICTED: importin subunit alpha-1b-like          223   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002519264.1|  importin alpha, putative                           221   2e-64   Ricinus communis
gb|EPS62504.1|  hypothetical protein M569_12283                         223   2e-64   Genlisea aurea
gb|AIU34461.1|  putative importin subunit alpha-2                       223   3e-64   Taraxacum brevicorniculatum
ref|XP_011041680.1|  PREDICTED: importin subunit alpha-like             223   5e-64   Populus euphratica
gb|AGZ15387.1|  importin alpha                                          222   6e-64   Phaseolus vulgaris [French bean]
ref|XP_009763482.1|  PREDICTED: importin subunit alpha-1a-like          222   8e-64   Nicotiana sylvestris
gb|AHJ25927.1|  importin subunit alpha-1                                221   1e-63   Senecio scandens
ref|XP_004228994.1|  PREDICTED: importin subunit alpha-1a               221   1e-63   Solanum lycopersicum
ref|XP_010558435.1|  PREDICTED: importin subunit alpha-1-like           221   2e-63   Tarenaya hassleriana [spider flower]
emb|CDY34430.1|  BnaC01g22030D                                          221   2e-63   Brassica napus [oilseed rape]
ref|XP_002320318.1|  hypothetical protein POPTR_0014s11920g             221   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_006355403.1|  PREDICTED: importin subunit alpha-1-like iso...    221   2e-63   Solanum tuberosum [potatoes]
gb|AAM96997.1|  unknown protein                                         214   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031101.1|  Importin alpha, alpha,aimp alpha,impa-1,impa...    220   4e-63   
ref|XP_012084120.1|  PREDICTED: importin subunit alpha-4-like           219   6e-63   Jatropha curcas
gb|KJB09437.1|  hypothetical protein B456_001G142300                    219   6e-63   Gossypium raimondii
gb|KJB28705.1|  hypothetical protein B456_005G065400                    219   6e-63   Gossypium raimondii
ref|XP_009146474.1|  PREDICTED: importin subunit alpha-1-like           219   7e-63   Brassica rapa
emb|CDY52043.1|  BnaC08g48070D                                          219   8e-63   Brassica napus [oilseed rape]
emb|CDY22779.1|  BnaA08g06090D                                          219   8e-63   Brassica napus [oilseed rape]
ref|XP_009107883.1|  PREDICTED: importin subunit alpha-1-like           219   9e-63   Brassica rapa
ref|XP_010024770.1|  PREDICTED: importin subunit alpha-1                219   1e-62   Eucalyptus grandis [rose gum]
ref|XP_010434881.1|  PREDICTED: importin subunit alpha-1-like           219   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_001773628.1|  predicted protein                                  218   2e-62   
emb|CDY09716.1|  BnaC07g33450D                                          218   2e-62   Brassica napus [oilseed rape]
gb|KFK42624.1|  hypothetical protein AALP_AA1G019500                    218   2e-62   Arabis alpina [alpine rockcress]
gb|AAK38727.1|AF369707_1  importin alpha 2                              218   2e-62   Capsicum annuum
gb|AFW79686.1|  importin alpha-1b subunit, mRNA                         213   2e-62   
ref|XP_009136744.1|  PREDICTED: importin subunit alpha-1                218   2e-62   Brassica rapa
ref|XP_006414387.1|  hypothetical protein EUTSA_v10024884mg             218   3e-62   Eutrema salsugineum [saltwater cress]
gb|EMS47918.1|  Importin subunit alpha-1a                               218   3e-62   Triticum urartu
ref|NP_171769.1|  importin alpha isoform 6                              218   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302745.2|  hypothetical protein POPTR_0002s20060g             218   3e-62   Populus trichocarpa [western balsam poplar]
ref|NP_973743.1|  importin alpha isoform 6                              218   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011042196.1|  PREDICTED: importin subunit alpha-like             218   5e-62   Populus euphratica
gb|AAK32824.1|AF361811_1  AT3g06720/F3E22_14                            217   6e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CAA74965.1|  Importin alpha-like protein                            217   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285325.1|  hypothetical protein CARUB_v10006712mg             217   7e-62   Capsella rubella
ref|NP_001154239.1|  importin alpha isoform 2                           217   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003566399.1|  PREDICTED: importin subunit alpha-1a               216   9e-62   Brachypodium distachyon [annual false brome]
ref|XP_010556709.1|  PREDICTED: importin subunit alpha-2-like           216   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_004967840.1|  PREDICTED: importin subunit alpha-1a-like          216   1e-61   Setaria italica
ref|XP_010551087.1|  PREDICTED: importin subunit alpha-1-like           216   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_002868159.1|  AT3g06720/F3E22_14                                 217   2e-61   
ref|XP_010670910.1|  PREDICTED: importin subunit alpha-1                216   2e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004977075.1|  PREDICTED: importin subunit alpha-1b-like is...    216   3e-61   
ref|XP_008673870.1|  PREDICTED: importin subunit alpha-1a               214   4e-61   Zea mays [maize]
gb|KDO71825.1|  hypothetical protein CISIN_1g009544mg                   213   5e-61   Citrus sinensis [apfelsine]
ref|XP_011100802.1|  PREDICTED: importin subunit alpha-1a-like          214   5e-61   Sesamum indicum [beniseed]
pdb|4BPL|A  Chain A, Rice Importin_alpha In Complex With Nucleopl...    213   5e-61   Xenopus
pdb|4BQK|A  Chain A, Rice Importin_alpha : Vird2nls Complex             213   6e-61   Agrobacterium tumefaciens
pdb|4BQK|B  Chain B, Rice Importin_alpha : Vird2nls Complex             213   6e-61   Agrobacterium tumefaciens
ref|XP_007035863.1|  Importin alpha, putative                           216   7e-61   
pdb|2YNS|A  Chain A, Rimp_alpha_b54nls                                  213   8e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006488879.1|  PREDICTED: importin subunit alpha-1-like           214   9e-61   Citrus sinensis [apfelsine]
gb|KDO71823.1|  hypothetical protein CISIN_1g009544mg                   214   9e-61   Citrus sinensis [apfelsine]
dbj|BAJ34004.1|  unnamed protein product                                208   1e-60   Eutrema halophilum
gb|KDO81726.1|  hypothetical protein CISIN_1g009184mg                   214   1e-60   Citrus sinensis [apfelsine]
ref|NP_001042611.1|  Os01g0253300                                       213   1e-60   
pdb|4B8J|A  Chain A, Rimp_alpha1a                                       214   1e-60   
ref|XP_006472169.1|  PREDICTED: importin subunit alpha-1b-like          214   1e-60   
gb|EAY73331.1|  hypothetical protein OsI_01208                          213   1e-60   
ref|XP_006644004.1|  PREDICTED: importin subunit alpha-1a-like          213   1e-60   
ref|XP_010489893.1|  PREDICTED: importin subunit alpha-1-like           214   2e-60   
gb|EYU44000.1|  hypothetical protein MIMGU_mgv1a004419mg                213   2e-60   
ref|XP_004508265.1|  PREDICTED: importin subunit alpha-1-like           213   3e-60   
ref|NP_001148537.1|  LOC100282153                                       212   4e-60   
ref|XP_006307204.1|  hypothetical protein CARUB_v10008795mg             212   6e-60   
gb|AAQ13406.1|AF005265_1  importin                                      211   1e-59   
ref|XP_003610377.1|  Importin alpha-1b subunit                          208   2e-59   
gb|KJB12655.1|  hypothetical protein B456_002G029800                    210   2e-59   
ref|XP_006396421.1|  hypothetical protein EUTSA_v10028572mg             210   2e-59   
gb|KJB12653.1|  hypothetical protein B456_002G029800                    210   2e-59   
ref|XP_002961054.1|  hypothetical protein SELMODRAFT_266556             210   3e-59   
ref|XP_002966958.1|  hypothetical protein SELMODRAFT_439828             210   3e-59   
gb|KHG26190.1|  Importin subunit alpha-1 -like protein                  210   3e-59   
gb|EMS45808.1|  Importin subunit alpha-1b                               212   3e-59   
ref|XP_007035721.1|  Importin alpha isoform 1                           208   2e-58   
ref|XP_007035722.1|  Importin alpha isoform 2                           208   2e-58   
emb|CDY01921.1|  BnaC02g28060D                                          206   5e-58   
emb|CDX97257.1|  BnaA02g20480D                                          206   7e-58   
ref|XP_009128526.1|  PREDICTED: importin subunit alpha-2-like           206   8e-58   
emb|CDY15260.1|  BnaC05g01390D                                          207   4e-57   
ref|XP_010474848.1|  PREDICTED: importin subunit alpha-2                203   1e-56   
ref|XP_002508520.1|  predicted protein                                  202   2e-56   
ref|XP_004306871.1|  PREDICTED: importin subunit alpha-1-like           202   2e-56   
gb|KEH32336.1|  importin subunit alpha                                  201   4e-56   
ref|XP_009119620.1|  PREDICTED: importin subunit alpha-1                200   1e-55   
emb|CDX89948.1|  BnaA10g01340D                                          200   1e-55   
ref|XP_010424664.1|  PREDICTED: importin subunit alpha-2-like           198   5e-55   
ref|XP_010456072.1|  PREDICTED: importin subunit alpha-2                197   7e-55   
ref|XP_010522815.1|  PREDICTED: importin subunit alpha isoform X1       197   8e-55   
gb|AES92265.2|  importin subunit alpha                                  195   1e-54   
ref|XP_007510824.1|  predicted protein                                  195   2e-54   
emb|CAA70703.1|  Kap alpha protein                                      197   2e-54   
ref|XP_003638654.1|  Importin subunit alpha                             195   2e-54   
ref|XP_003610068.1|  Importin alpha-1b subunit                          196   2e-54   
gb|KEH18646.1|  importin subunit alpha-like protein                     195   2e-54   
gb|AES92711.2|  importin subunit alpha-like protein                     196   2e-54   
ref|NP_192124.1|  Importin alpha 3                                      197   3e-54   
emb|CAA75514.1|  Importin alpha-like protein                            197   3e-54   
ref|XP_003610514.1|  Importin alpha-1b subunit                          196   3e-54   
ref|XP_006289883.1|  hypothetical protein CARUB_v10003501mg             196   5e-54   
ref|XP_010501291.1|  PREDICTED: importin subunit alpha-2-like           199   7e-54   
ref|XP_010429262.1|  PREDICTED: importin subunit alpha-2                195   1e-53   
ref|XP_002872853.1|  ATIMPALPHA3/MOS6                                   194   2e-53   
gb|KEH32656.1|  importin subunit alpha                                  189   3e-53   
ref|XP_003057280.1|  predicted protein                                  192   8e-53   
gb|KJB34728.1|  hypothetical protein B456_006G080400                    192   9e-53   
gb|KEH28816.1|  importin subunit alpha                                  187   1e-52   
ref|XP_005646985.1|  importin alpha                                     192   2e-52   
gb|AES92706.2|  importin subunit alpha                                  190   2e-52   
ref|XP_005849695.1|  hypothetical protein CHLNCDRAFT_30497              191   5e-52   
ref|XP_003610509.1|  Importin alpha-1b subunit                          189   2e-51   
ref|XP_003520790.1|  PREDICTED: importin subunit alpha-like             189   2e-51   
gb|KHN03926.1|  Importin subunit alpha                                  189   2e-51   
ref|XP_001698656.1|  importin alpha                                     186   4e-51   
gb|KDO42368.1|  hypothetical protein CISIN_1g043676mg                   186   4e-51   
ref|XP_001419614.1|  predicted protein                                  184   6e-51   
gb|AES92712.2|  importin subunit alpha-like protein                     186   1e-50   
gb|KDD73677.1|  hypothetical protein H632_c1936p0                       187   1e-50   
emb|CEF99159.1|  Armadillo-type fold                                    182   4e-50   
ref|XP_003610515.1|  Importin alpha-1b subunit                          187   4e-50   
emb|CDY64806.1|  BnaCnng45030D                                          184   5e-50   
ref|XP_005758728.1|  hypothetical protein EMIHUDRAFT_460128             185   5e-50   
ref|XP_005778844.1|  hypothetical protein EMIHUDRAFT_421349             185   7e-50   
gb|KDO38014.1|  hypothetical protein CISIN_1g0355071mg                  184   2e-49   
ref|XP_006471707.1|  PREDICTED: importin subunit alpha-1a-like          184   2e-49   
ref|NP_001042958.1|  Os01g0343200                                       182   6e-49   
gb|EEE54508.1|  hypothetical protein OsJ_01650                          181   7e-49   
ref|XP_010495334.1|  PREDICTED: importin subunit alpha-1-like           181   7e-49   
gb|KFK30907.1|  hypothetical protein AALP_AA6G041500                    180   2e-48   
gb|KDO44063.1|  hypothetical protein CISIN_1g043116mg                   179   4e-48   
ref|XP_010513590.1|  PREDICTED: importin subunit alpha-1-like           178   4e-48   
gb|KFK30823.1|  hypothetical protein AALP_AA6G030600                    183   6e-48   
gb|KDO41451.1|  hypothetical protein CISIN_1g037142mg                   176   7e-48   
gb|KJB81070.1|  hypothetical protein B456_013G128000                    171   7e-48   
emb|CDX90948.1|  BnaA03g26280D                                          178   1e-47   
ref|XP_003609724.1|  Importin alpha-1b subunit                          177   1e-47   
ref|XP_009134443.1|  PREDICTED: importin subunit alpha-2-like           178   2e-47   
gb|KFK30899.1|  hypothetical protein AALP_AA6G040600                    177   3e-47   
ref|XP_002957574.1|  hypothetical protein VOLCADRAFT_84159              174   3e-47   
gb|AAG42106.2|  karyopherin alpha 6                                     168   4e-47   
ref|XP_006494504.1|  PREDICTED: uncharacterized protein LOC102608704    172   4e-47   
gb|KEH41662.1|  importin subunit alpha                                  172   6e-47   
ref|XP_006471848.1|  PREDICTED: importin subunit alpha-1a-like          173   6e-47   
gb|KEH41663.1|  importin subunit alpha                                  173   7e-47   
ref|XP_002590287.1|  hypothetical protein BRAFLDRAFT_279360             175   8e-47   
gb|KEH41661.1|  importin subunit alpha                                  171   1e-46   
ref|XP_011396312.1|  Importin subunit alpha-1                           173   1e-46   
gb|EPS69743.1|  hypothetical protein M569_05021                         171   2e-46   
ref|XP_006494501.1|  PREDICTED: disease resistance protein At4g27...    178   3e-46   
gb|KDO38489.1|  hypothetical protein CISIN_1g043950mg                   172   3e-46   
dbj|BAB24841.1|  unnamed protein product                                165   3e-46   
gb|KDO37705.1|  hypothetical protein CISIN_1g039940mg                   173   3e-46   
ref|XP_006494500.1|  PREDICTED: disease resistance protein At4g27...    178   3e-46   
gb|KDO52349.1|  hypothetical protein CISIN_1g042204mg                   174   5e-46   
ref|XP_006471714.1|  PREDICTED: importin subunit alpha-1-like iso...    172   5e-46   
gb|EDL80567.1|  karyopherin (importin) alpha 6                          167   6e-46   
gb|KDO38849.1|  hypothetical protein CISIN_1g037562mg                   175   6e-46   
ref|XP_006480868.1|  PREDICTED: uncharacterized protein LOC102608919    174   8e-46   
gb|EMP28421.1|  Importin subunit alpha-7                                172   1e-45   
ref|XP_005302236.1|  PREDICTED: importin subunit alpha-7                171   1e-45   
ref|XP_006471713.1|  PREDICTED: importin subunit alpha-1-like iso...    171   2e-45   
ref|XP_002182420.1|  predicted protein                                  169   2e-45   
ref|XP_006494499.1|  PREDICTED: importin subunit alpha-1a-like          172   2e-45   
ref|XP_009870457.1|  PREDICTED: importin subunit alpha-5-like           163   3e-45   
ref|NP_989192.1|  karyopherin alpha 1 (importin alpha 5)                171   3e-45   
ref|XP_009967872.1|  PREDICTED: importin subunit alpha-5-like           163   3e-45   
gb|KDO38957.1|  hypothetical protein CISIN_1g013228mg                   171   3e-45   
ref|XP_010144524.1|  PREDICTED: importin subunit alpha-5-like           165   4e-45   
ref|XP_006494505.1|  PREDICTED: importin subunit alpha-1a-like          173   4e-45   
ref|XP_006117607.1|  PREDICTED: importin subunit alpha-7                169   5e-45   
ref|XP_008246369.1|  PREDICTED: importin subunit alpha-like             168   5e-45   
ref|WP_028833024.1|  hypothetical protein                               170   6e-45   
emb|CDY05638.1|  BnaC02g38990D                                          171   6e-45   
ref|NP_032494.3|  importin subunit alpha-7                              168   7e-45   
ref|XP_006471709.1|  PREDICTED: importin subunit alpha-1a-like is...    172   7e-45   
ref|XP_008945481.1|  PREDICTED: importin subunit alpha-5-like           166   7e-45   
dbj|BAE32900.1|  unnamed protein product                                168   7e-45   
ref|XP_006502877.1|  PREDICTED: importin subunit alpha-7 isoform X1     168   7e-45   
ref|XP_006019402.1|  PREDICTED: importin subunit alpha-7                168   7e-45   
gb|AAC53373.1|  importin alpha S2                                       168   7e-45   
ref|XP_006274864.1|  PREDICTED: importin subunit alpha-7                168   8e-45   
ref|XP_011829425.1|  PREDICTED: importin subunit alpha-7 isoform X1     168   8e-45   
ref|XP_005079689.1|  PREDICTED: importin subunit alpha-7                168   8e-45   
ref|XP_003891548.1|  PREDICTED: importin subunit alpha-7 isoform X1     168   8e-45   
gb|ERE85411.1|  importin subunit alpha-7 isoform 1                      168   9e-45   
ref|XP_005270768.1|  PREDICTED: importin subunit alpha-7 isoform X1     168   9e-45   
ref|XP_003081334.1|  putative importin alpha 2 (ISS)                    164   9e-45   
ref|XP_007908530.1|  PREDICTED: importin subunit alpha-6                168   1e-44   
gb|EAX07569.1|  karyopherin alpha 6 (importin alpha 7), isoform C...    166   1e-44   
ref|XP_011810829.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
gb|ESA20675.1|  hypothetical protein GLOINDRAFT_343521                  171   1e-44   
ref|NP_001015029.2|  importin subunit alpha-7                           167   1e-44   
ref|XP_008271996.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_005705411.1|  importin alpha                                     168   1e-44   
ref|XP_011935805.1|  PREDICTED: importin subunit alpha-7                167   1e-44   
dbj|BAE01108.1|  unnamed protein product                                167   1e-44   
dbj|BAG63185.1|  unnamed protein product                                167   1e-44   
ref|XP_007170657.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
dbj|BAK62519.1|  importin alpha-7 subunit                               167   1e-44   
ref|XP_007468725.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_005004293.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_004471452.1|  PREDICTED: importin subunit alpha-7                167   1e-44   
ref|XP_006196983.1|  PREDICTED: importin subunit alpha-7 isoform X3     167   1e-44   
ref|XP_011762804.1|  PREDICTED: importin subunit alpha-7                171   1e-44   
ref|XP_004740986.1|  PREDICTED: importin subunit alpha-7                167   1e-44   
ref|XP_006176257.1|  PREDICTED: importin subunit alpha-7 isoform X3     167   1e-44   
ref|XP_004266579.1|  PREDICTED: importin subunit alpha-7 isoform 2      167   1e-44   
ref|XP_004603616.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_005665232.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|NP_036448.1|  importin subunit alpha-7                              167   1e-44   
ref|XP_003500689.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_005317796.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_007125169.1|  PREDICTED: importin subunit alpha-7                167   1e-44   
ref|XP_006994430.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_004266578.1|  PREDICTED: importin subunit alpha-7 isoform 1      167   1e-44   
ref|XP_004678795.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_008846295.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
dbj|BAG58497.1|  unnamed protein product                                167   1e-44   
ref|XP_004591683.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_003471249.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_004425942.1|  PREDICTED: importin subunit alpha-7 isoform 2      167   1e-44   
ref|XP_005317797.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_006158180.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_006734216.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_004266580.1|  PREDICTED: importin subunit alpha-7 isoform 3      167   1e-44   
ref|XP_005004294.1|  PREDICTED: importin subunit alpha-7 isoform X3     167   1e-44   
ref|XP_004603617.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_004642997.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_008846287.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_003228760.2|  PREDICTED: importin subunit alpha-7                168   1e-44   
gb|EFB27376.1|  hypothetical protein PANDA_010861                       167   1e-44   
ref|XP_011539462.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_010352204.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_003989858.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_004678794.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_002720679.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_006924365.1|  PREDICTED: importin subunit alpha-7                167   1e-44   
ref|NP_001069422.1|  importin subunit alpha-7                           167   1e-44   
ref|XP_008271998.1|  PREDICTED: importin subunit alpha-7 isoform X3     167   1e-44   
ref|XP_007170659.1|  PREDICTED: importin subunit alpha-7 isoform X3     167   1e-44   
ref|XP_003356325.2|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_003801323.1|  PREDICTED: importin subunit alpha-7                167   1e-44   
ref|XP_008271999.1|  PREDICTED: importin subunit alpha-7 isoform X4     167   1e-44   
ref|XP_008951744.1|  PREDICTED: importin subunit alpha-7 isoform X3     167   1e-44   
ref|XP_004425941.1|  PREDICTED: importin subunit alpha-7 isoform 1      167   1e-44   
ref|XP_007538559.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
tpg|DAA33092.1|  TPA: importin subunit alpha-7                          167   1e-44   
ref|XP_004591684.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_008692699.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
ref|XP_005906256.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
gb|ELW48631.1|  Importin subunit alpha-7                                167   1e-44   
ref|XP_004642996.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
gb|ELR48730.1|  Importin subunit alpha-7                                167   1e-44   
ref|XP_004005080.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   1e-44   
gb|ELK02023.1|  Importin subunit alpha-7                                167   1e-44   
pdb|4UAD|A  Chain A, Importin Alpha 7 Delta Ibb In Complex With I...    167   1e-44   
ref|XP_008155237.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_007538558.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   1e-44   
ref|XP_012005168.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   2e-44   
ref|XP_010045353.1|  PREDICTED: importin subunit alpha-1b-like is...    170   2e-44   
ref|XP_008155238.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   2e-44   
ref|XP_005878401.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   2e-44   
ref|XP_004705073.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   2e-44   
ref|XP_008064949.1|  PREDICTED: importin subunit alpha-7                167   2e-44   
ref|XP_005878402.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   2e-44   
gb|KCW87525.1|  hypothetical protein EUGRSUZ_B03974                     170   2e-44   
ref|XP_004705074.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   2e-44   
ref|XP_005906257.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   2e-44   
ref|XP_005395099.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   2e-44   
ref|XP_004406508.1|  PREDICTED: importin subunit alpha-7                167   2e-44   
ref|XP_010619871.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   2e-44   
ref|XP_010619873.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   2e-44   
ref|XP_005395098.1|  PREDICTED: importin subunit alpha-7 isoform X1     167   2e-44   
ref|XP_005395100.1|  PREDICTED: importin subunit alpha-7 isoform X3     167   2e-44   
ref|XP_006089255.1|  PREDICTED: importin subunit alpha-6 isoform X1     169   2e-44   
ref|XP_009034847.1|  hypothetical protein AURANDRAFT_69702              164   2e-44   
ref|XP_004900260.1|  PREDICTED: importin subunit alpha-7 isoform X2     167   2e-44   



>gb|AAK38726.1|AF369706_1 importin alpha 1 [Capsicum annuum]
Length=535

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQ+AEFDIKKEAAWAISNATSGGSNEQIRFLASQGC+KPLCDLLICP
Sbjct  369  VIEANIILPLVHLLQNAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCIKPLCDLLICP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE DK+ G N GIN+YAQMIDECEGLDK+ENLQTHDNNEIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEMDKETGANGGINLYAQMIDECEGLDKIENLQTHDNNEIYE  488

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K VKILEKYW +EDEE NLPDGVD NQQGF FGN+QPNVP
Sbjct  489  KTVKILEKYWAEEDEEQNLPDGVDGNQQGFQFGNNQPNVP  528



>ref|XP_009796205.1| PREDICTED: importin subunit alpha-1 [Nicotiana sylvestris]
Length=531

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ AEFDIKKEAAWAISNATSGGS +QIRFLASQGC+KPLCDLLICP
Sbjct  365  VIEANIIPPLVHLLQSAEFDIKKEAAWAISNATSGGSYDQIRFLASQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE DK+ GMN GIN+YAQMIDEC+GLDK+ENLQTHDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEMDKEAGMNGGINLYAQMIDECDGLDKIENLQTHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILEKYW +EDEE  LPDG+D NQQGF FGNSQPNVP
Sbjct  485  KAVKILEKYWAEEDEEQILPDGIDGNQQGFQFGNSQPNVP  524



>ref|XP_009592620.1| PREDICTED: importin subunit alpha-1 [Nicotiana tomentosiformis]
Length=531

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ AEFDIKKEAAWAISNATSGGS +QIRFLASQGC+KPLCDLLICP
Sbjct  365  VIEANIIPPLVHLLQSAEFDIKKEAAWAISNATSGGSYDQIRFLASQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE DK+ GMN GIN+YAQM+DEC+GLDK+ENLQTHDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEVDKEAGMNGGINLYAQMMDECDGLDKIENLQTHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILEKYW +EDEE   PDGVD NQQGF FGNSQPNVP
Sbjct  485  KAVKILEKYWAEEDEEQIFPDGVDGNQQGFQFGNSQPNVP  524



>ref|XP_006344784.1| PREDICTED: importin subunit alpha-1 [Solanum tuberosum]
Length=534

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILP+V LLQ+AEFDIKKEAAWAISNATSGGSN+QIRFLASQGC+KPLCDLLICP
Sbjct  368  VIEANIILPMVHLLQNAEFDIKKEAAWAISNATSGGSNDQIRFLASQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE DK+ G N GIN+YAQ IDEC+GLDK+ENLQTHDNNE+YE
Sbjct  428  DPRIVTVCLEGLENILKVGEVDKEAGANGGINLYAQTIDECDGLDKIENLQTHDNNELYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILEKYW +EDEE NLPDG D NQQGF FGN+QPNVP
Sbjct  488  KAVKILEKYWAEEDEEQNLPDGADGNQQGFQFGNNQPNVP  527



>ref|XP_004230322.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=534

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQ+AEFDIKKEAAWAISNATSGGSN+QIRFL SQGC+KPLCDLLICP
Sbjct  368  VIEANIILPLVHLLQNAEFDIKKEAAWAISNATSGGSNDQIRFLTSQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE DK+ G N GIN+Y  MIDEC+GLDK+ENLQTHDNNEIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEVDKEAGTNGGINMYTHMIDECDGLDKIENLQTHDNNEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILEKYW +EDEE NLPDG D N QGF FGN+QPNVP
Sbjct  488  KAVKILEKYWAEEDEEQNLPDGADGNPQGFQFGNNQPNVP  527



>ref|XP_007031183.1| Importin alpha isoform 1 [Theobroma cacao]
 gb|EOY11685.1| Importin alpha isoform 1 [Theobroma cacao]
Length=536

 Score =   280 bits (716),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLLICP
Sbjct  369  VIEANIILPLVHLLQHAEFDIKKEAAWAISNATSGGAHEQIQFLVSQGCIKPLCDLLICP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++GMN GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEADKEMGMNGGINLYAQMIDECDGLDKIENLQTHDNHEIYE  488

Query  537  KAVKILEKYWG-DEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE+YW  +ED+E NL DG +ENQQGF FG +QPNVP
Sbjct  489  KAVKILERYWAEEEDDEQNLQDGGNENQQGFNFGANQPNVP  529



>ref|XP_007031184.1| Importin alpha isoform 2 [Theobroma cacao]
 gb|EOY11686.1| Importin alpha isoform 2 [Theobroma cacao]
Length=540

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLLICP
Sbjct  373  VIEANIILPLVHLLQHAEFDIKKEAAWAISNATSGGAHEQIQFLVSQGCIKPLCDLLICP  432

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++GMN GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYE
Sbjct  433  DPRIVTVCLEGLENILKVGEADKEMGMNGGINLYAQMIDECDGLDKIENLQTHDNHEIYE  492

Query  537  KAVKILEKYWG-DEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE+YW  +ED+E NL DG +ENQQGF FG +QPNVP
Sbjct  493  KAVKILERYWAEEEDDEQNLQDGGNENQQGFNFGANQPNVP  533



>gb|ABB55384.1| importin alpha 1-like [Solanum tuberosum]
Length=445

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VIE+ IILP+V LLQ+AEFDIKKEAAWAISNATSGGSN+QIRFLASQGC+KPLCDLLI
Sbjct  287  QAVIEANIILPMVHLLQNAEFDIKKEAAWAISNATSGGSNDQIRFLASQGCIKPLCDLLI  346

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGE DK+ G N GIN+YAQ IDEC+GLDK+ENLQTHDNNE+
Sbjct  347  CPDPRIVTVCLEGLENILKVGEVDKEAGANGGINLYAQTIDECDGLDKIENLQTHDNNEL  406

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ  430
            YEKAVKILEKYW +EDEE NLPDG D NQ GF FGN+Q
Sbjct  407  YEKAVKILEKYWAEEDEEQNLPDGADGNQLGFQFGNNQ  444



>ref|XP_007205030.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
 gb|EMJ06229.1| hypothetical protein PRUPE_ppa004046mg [Prunus persica]
Length=533

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            KI+ + VIE+ IILPLV +LQHAEFDIKKEAAWAISNATSGGS+EQI+ LAS+GC+KPLC
Sbjct  362  KIQIQAVIEADIILPLVQVLQHAEFDIKKEAAWAISNATSGGSHEQIQHLASRGCIKPLC  421

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRI+TVCLEGLENILKVGEADK++GMNDGIN+YAQ++DECEGLDK+ENLQTHD
Sbjct  422  DLLICPDPRIITVCLEGLENILKVGEADKEMGMNDGINLYAQLVDECEGLDKIENLQTHD  481

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+E  N+ +  D NQ  FTFG +QPN P
Sbjct  482  NNEIYEKAVKILERYWAEEEEGQNIQENGDGNQHDFTFGANQPNPP  527



>ref|XP_002319478.1| importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE95401.1| importin alpha-1 subunit family protein [Populus trichocarpa]
Length=537

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEAAWAISNATS GS+EQI+FL SQGC+KPLCDLLICP
Sbjct  370  VIEANIILPLVNLLQHAEFDIKKEAAWAISNATSAGSHEQIQFLVSQGCIKPLCDLLICP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++G+N G+N+YAQM+DEC+GLDK+ENLQTHDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGEADKEMGLNGGVNLYAQMVDECDGLDKIENLQTHDNNEIYE  489

Query  537  KAVKILEKYWG-DEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            KAVKILE+YW  +ED EP + DG D NQQGF FG +QP+VP+
Sbjct  490  KAVKILERYWAEEEDGEPIVQDGGDGNQQGFAFGTNQPSVPQ  531



>ref|XP_008246117.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=533

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            KI+ + VIE+ IILPLV LLQHAEFDIKKEAAWAISNATSGGS++QI+ LAS+GC+KPLC
Sbjct  362  KIQIQAVIEADIILPLVQLLQHAEFDIKKEAAWAISNATSGGSHDQIQHLASRGCIKPLC  421

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRI+TVCLEGLENILKVGEADK++GMNDGIN+YAQ++DECEGLDK+ENLQTHD
Sbjct  422  DLLICPDPRIITVCLEGLENILKVGEADKEMGMNDGINLYAQLVDECEGLDKIENLQTHD  481

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +EDE  N+    D NQ  FTFG +QPN P
Sbjct  482  NNEIYEKAVKILERYWAEEDEGQNIQVNGDGNQHDFTFGANQPNPP  527



>gb|KJB26294.1| hypothetical protein B456_004G235800 [Gossypium raimondii]
Length=537

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 148/162 (91%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQ AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  369  VIEANIILPLVHLLQLAEFDIKKEAAWAISNATSGGSHEQIQFLVSQGCIKPLCDLLICP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++GMN GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEADKEMGMNGGINLYAQMIDECDGLDKIENLQTHDNHEIYE  488

Query  537  KAVKILEKYWGDEDE-EPNLPDGVDENQQGFTFG-NSQPNVP  418
            KAVKILE+YW +E+E E N+ DG +ENQQGF FG N QP+ P
Sbjct  489  KAVKILERYWAEEEEDEQNIQDGGNENQQGFNFGVNQQPSAP  530



>ref|XP_011023801.1| PREDICTED: importin subunit alpha [Populus euphratica]
Length=537

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEF+IKKEAAWAISNATS GS+EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VIEANIILPLVNLLQHAEFEIKKEAAWAISNATSAGSHEQIQFLVSQGCIKPLCDLLTCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++G+N G+N+YAQM+DEC+GLDK+ENLQTHDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGEADKEMGLNGGVNLYAQMVDECDGLDKIENLQTHDNNEIYE  489

Query  537  KAVKILEKYWG-DEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            KAVKILE+YW  +ED EP + DG D NQQGF FG +QP+VP+
Sbjct  490  KAVKILERYWAEEEDGEPIVQDGGDGNQQGFAFGTNQPSVPQ  531



>ref|XP_010549392.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=537

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 152/167 (91%), Gaps = 1/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            +++ + V+++ I+LPLV LLQHAEFDIKKEAAWAISNATSGG+++QI+FL +QGC+KPLC
Sbjct  364  RVQIQAVVDAGIVLPLVHLLQHAEFDIKKEAAWAISNATSGGTHDQIKFLVTQGCIKPLC  423

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKV EADK++G+N G+N+YAQM++E +GLDK+ENLQTHD
Sbjct  424  DLLICPDPRIVTVCLEGLENILKVSEADKEMGLNGGVNLYAQMVEESDGLDKIENLQTHD  483

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+E+ N  D ++EN QQGF FGNSQP+VP
Sbjct  484  NNEIYEKAVKILERYWAEEEEDQNHQDAMNENAQQGFNFGNSQPSVP  530



>emb|CAN64716.1| hypothetical protein VITISV_026717 [Vitis vinifera]
Length=523

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEAAW ISNATSGGS+EQI+FL SQGC+KPLCDLL+CP
Sbjct  357  VIEANIILPLVNLLQHAEFDIKKEAAWGISNATSGGSHEQIQFLVSQGCIKPLCDLLMCP  416

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK+ G N GIN+YAQMIDEC+GLDK+E LQTHDNNEIYE
Sbjct  417  DPRIVTVCLEGLENILKVGEADKESGKNGGINLYAQMIDECDGLDKIELLQTHDNNEIYE  476

Query  537  KAVKILEKYWGDEDEE-PNLPDGVDENQQGFTFGNSQPNVP  418
            K+VK+LE+YW +EDEE  N+ DG D NQQGF FG+SQPN+P
Sbjct  477  KSVKLLERYWAEEDEEVQNVQDG-DGNQQGFGFGSSQPNLP  516



>ref|XP_002281670.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CBI39614.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEAAW ISNATSGGS+EQI+FL SQGC+KPLCDLL+CP
Sbjct  369  VIEANIILPLVNLLQHAEFDIKKEAAWGISNATSGGSHEQIQFLVSQGCIKPLCDLLMCP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK+ G N GIN+YAQMIDEC+GLDK+E LQTHDNNEIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEADKESGKNGGINLYAQMIDECDGLDKIELLQTHDNNEIYE  488

Query  537  KAVKILEKYWGDEDEE-PNLPDGVDENQQGFTFGNSQPNVP  418
            K+VK+LE+YW +EDEE  N+ DG D NQQGF FG+SQPN+P
Sbjct  489  KSVKLLERYWAEEDEEVQNVQDG-DGNQQGFGFGSSQPNLP  528



>ref|XP_010674568.1| PREDICTED: importin subunit alpha-1a [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ ++ PLV LLQ+AEFDIKKEAAWAISNATSGG+ EQIRFL SQGC+KPLCDLLICP
Sbjct  368  VVEAGLVQPLVQLLQNAEFDIKKEAAWAISNATSGGAPEQIRFLVSQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLEN+LKVGE DK++GMN G+NIYAQMIDECEGLDK+ENLQTHDNN+IYE
Sbjct  428  DPRIVTVCLEGLENLLKVGETDKEMGMNGGVNIYAQMIDECEGLDKIENLQTHDNNDIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LEKYW +E+EE N  DG   NQQGF FG +QPN+P
Sbjct  488  KAVKVLEKYWAEEEEEQNAQDGAAMNQQGFNFGATQPNIP  527



>ref|XP_012088868.1| PREDICTED: importin subunit alpha-4 isoform X1 [Jatropha curcas]
 gb|KDP23371.1| hypothetical protein JCGZ_23204 [Jatropha curcas]
Length=535

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IIL LV LLQHAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  369  VIEANIILSLVHLLQHAEFDIKKEAAWAISNATSGGSHEQIQFLVNQGCIKPLCDLLICP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++G+N GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEADKEMGLNGGINLYAQMIDECDGLDKIENLQTHDNHEIYE  488

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE+YW +E+EE  + DG D NQQGF FG++QPN P
Sbjct  489  KAVKILERYWAEEEEEQTVQDGGDGNQQGFPFGSNQPNAP  528



>ref|XP_012088870.1| PREDICTED: importin subunit alpha-4 isoform X2 [Jatropha curcas]
Length=534

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IIL LV LLQHAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  368  VIEANIILSLVHLLQHAEFDIKKEAAWAISNATSGGSHEQIQFLVNQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++G+N GIN+YAQMIDEC+GLDK+ENLQTHDN+EIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEADKEMGLNGGINLYAQMIDECDGLDKIENLQTHDNHEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE+YW +E+EE  + DG D NQQGF FG++QPN P
Sbjct  488  KAVKILERYWAEEEEEQTVQDGGDGNQQGFPFGSNQPNAP  527



>ref|XP_011092170.1| PREDICTED: importin subunit alpha [Sesamum indicum]
Length=540

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LL+HAEF+IKKEAAWAI NATSGGS  QIR LAS GC+KPLCDLLICP
Sbjct  374  VIQADIIPPLVQLLEHAEFEIKKEAAWAIFNATSGGSPAQIRLLASHGCIKPLCDLLICP  433

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE DK+ GMN GINIYAQMID CEGLDKLENLQ+HDNNEIY+
Sbjct  434  DPRIVTVCLEGLENILKVGEIDKENGMNGGINIYAQMIDYCEGLDKLENLQSHDNNEIYD  493

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILEKYW +EDE+ NL DGVD N QGF+FGN++ NVP
Sbjct  494  KAVKILEKYWVEEDEDQNLADGVDGNHQGFSFGNNKANVP  533



>ref|XP_008453295.1| PREDICTED: importin subunit alpha [Cucumis melo]
Length=536

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEA WAISNATSGGS++QI+FL +QGC+KPLCDLL CP
Sbjct  368  VIEANIILPLVHLLQHAEFDIKKEAGWAISNATSGGSHQQIQFLVTQGCIKPLCDLLTCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGL+NILKVGEADK +GMN GINIYAQ IDECEGLDK+ENLQ+HDNNEIYE
Sbjct  428  DPRIVTVCLEGLDNILKVGEADKDMGMNGGINIYAQAIDECEGLDKIENLQSHDNNEIYE  487

Query  537  KAVKILEKYWGDEDE--EPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW +EDE  E N     D NQ GF FG +QPNVP
Sbjct  488  KAVKMLERYWAEEDEEQEQNPQQNGDANQHGFAFGANQPNVP  529



>ref|XP_010270837.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   264 bits (674),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 2/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEF+IKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  367  VIDANIIFPLVQLLQHAEFEIKKEAAWAISNATSGGTHEQIQYLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK+LG   G+N+YAQMIDECEGLDK+ENLQ HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKELGKTGGVNMYAQMIDECEGLDKIENLQNHDNNEIYE  486

Query  537  KAVKILEKYWGD-EDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KA+KILE+YW D E+EE NL DG +  QQGF FGNSQPNVP
Sbjct  487  KAMKILERYWVDEEEEEQNLQDG-EITQQGFEFGNSQPNVP  526



>ref|XP_002512528.1| importin alpha, putative [Ricinus communis]
 gb|EEF49980.1| importin alpha, putative [Ricinus communis]
Length=450

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  287  VIEANIILPLVHLLQHAEFDIKKEAAWAISNATSGGSHEQIQFLVNQGCIKPLCDLLICP  346

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA K++GMN G+N+YAQMIDEC+GLDK+ENLQTHDNNEIYE
Sbjct  347  DPRIVTVCLEGLENILKVGEAKKEMGMNGGVNLYAQMIDECDGLDKIENLQTHDNNEIYE  406

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQP  427
            KAVKILE+YW +E+EE N+ +  D NQQ F FG +QP
Sbjct  407  KAVKILERYWAEEEEEQNVQESGDGNQQSFAFGTNQP  443



>emb|CDX94988.1| BnaC05g06830D [Brassica napus]
Length=540

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + I+LPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  367  KVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLC  426

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILK+GEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HD
Sbjct  427  DLLICPDPRIVTVCLEGLENILKIGEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHD  486

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E++E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  487  NNEIYEKAVKILERYWAEEEDEQILPDGVNENPQQGFSFGNNQTAAP  533



>gb|KFK43224.1| hypothetical protein AALP_AA1G096500 [Arabis alpina]
Length=539

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + IILPLV LLQ AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  366  KVQIEAVVGAGIILPLVHLLQTAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLC  425

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLL+CPDPRIVTVCLEGLENILKVGEADK++G+NDG+N+YAQ+I+E +GLDK+ENLQ+HD
Sbjct  426  DLLVCPDPRIVTVCLEGLENILKVGEADKEMGLNDGVNLYAQLIEESDGLDKVENLQSHD  485

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +EDEE  L DG +EN QQ F FGN+QP  P
Sbjct  486  NNEIYEKAVKILERYWAEEDEEQILQDGGNENPQQAFNFGNNQPAAP  532



>ref|NP_001275782.1| importin alpha [Citrus sinensis]
 gb|ACU56981.1| importin alpha [Citrus sinensis]
Length=535

 Score =   262 bits (669),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEF+IKKEAAWAISNATSGGS++QI+FL SQGC+KPLCDLL+CP
Sbjct  367  VIEANIILPLVHLLQHAEFEIKKEAAWAISNATSGGSHQQIQFLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++GMN+GIN+YAQMIDEC+GLDK+ENLQTHDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKEMGMNNGINVYAQMIDECDGLDKIENLQTHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNL--PDGVDENQQGFTFGNSQPNVP  418
            KAVKILE+YW +E+EE  L    G+   QQGF F  +QPN+P
Sbjct  487  KAVKILERYWAEEEEEEQLIQEGGIGNQQQGFGFATNQPNIP  528



>ref|XP_010024140.1| PREDICTED: importin subunit alpha [Eucalyptus grandis]
 gb|KCW60572.1| hypothetical protein EUGRSUZ_H03303 [Eucalyptus grandis]
Length=542

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ II PLV LLQHAEF+IKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  374  VVEANIIHPLVHLLQHAEFEIKKEAAWAISNATSGGSHEQIQFLVSQGCIKPLCDLLICP  433

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLEN+LK+GEADK++G+N G+N+Y QMIDECEGLDK+E+LQTHDNNEIYE
Sbjct  434  DPRIVTVCLEGLENVLKIGEADKEMGLNGGVNLYGQMIDECEGLDKIESLQTHDNNEIYE  493

Query  537  KAVKILEKYWGDEDE--EPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE+YW +E++  E +  D V+ + QGFTFG + PN+P
Sbjct  494  KAVKILERYWAEEEDGVEDDTQDAVNGDAQGFTFGANAPNLP  535



>ref|XP_008370371.1| PREDICTED: importin subunit alpha-like [Malus domestica]
Length=532

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 145/160 (91%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II+PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  368  VIDAGIIIPLVQLLQNAEFDIKKEAAWAISNATSGGSHEQIQFLVAQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEADKEMGMNGGINLYAQLIDECEGSDKIENLQTHDNHEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW +EDEE  + +  +  QQGFTFG +QPN P
Sbjct  488  KAVKLLERYWTEEDEE--VQENGNGTQQGFTFGTNQPNPP  525



>ref|XP_009337642.1| PREDICTED: importin subunit alpha-like isoform X2 [Pyrus x bretschneideri]
Length=532

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 145/160 (91%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II+PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  368  VIDAGIIIPLVQLLQNAEFDIKKEAAWAISNATSGGSHEQIQFLVAQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEADKEMGMNGGINLYAQLIDECEGSDKIENLQTHDNHEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW +EDEE  + +  +  QQGFTFG +QPN P
Sbjct  488  KAVKLLERYWTEEDEE--VQENGNGTQQGFTFGTNQPNPP  525



>ref|XP_009337641.1| PREDICTED: importin subunit alpha-like isoform X1 [Pyrus x bretschneideri]
Length=533

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 145/160 (91%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II+PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  369  VIDAGIIIPLVQLLQNAEFDIKKEAAWAISNATSGGSHEQIQFLVAQGCIKPLCDLLICP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEADKEMGMNGGINLYAQLIDECEGSDKIENLQTHDNHEIYE  488

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW +EDEE  + +  +  QQGFTFG +QPN P
Sbjct  489  KAVKLLERYWTEEDEE--VQENGNGTQQGFTFGTNQPNPP  526



>ref|XP_010267916.1| PREDICTED: importin subunit alpha-like [Nelumbo nucifera]
Length=533

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 144/161 (89%), Gaps = 2/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEF+IKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLL+CP
Sbjct  367  VIDANIIFPLVQLLQHAEFEIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK+LG   G+NIYAQMIDECEGLDK+ENLQ HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKELGKTGGVNIYAQMIDECEGLDKIENLQNHDNNEIYE  486

Query  537  KAVKILEKYWGD-EDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K++KILE+YW D E+EE N+ DG +  QQGF FG +QPNVP
Sbjct  487  KSMKILERYWVDEEEEEQNIQDG-EIAQQGFEFGTNQPNVP  526



>gb|ABO21639.1| importin alpha-like protein [Brassica napus]
 gb|ABO21640.1| importin alpha-like protein [Brassica napus]
Length=542

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + I+LPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  368  KVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLC  427

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILK+GEADK++G+N G+N+YAQ+++E +GLDK+ENLQ+HD
Sbjct  428  DLLICPDPRIVTVCLEGLENILKIGEADKEMGLNGGVNLYAQIVEESDGLDKIENLQSHD  487

Query  555  NNEIYEKAVKILEKYWGDEDE-EPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+E E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  488  NNEIYEKAVKILERYWAEEEEDEQILPDGVNENPQQGFSFGNNQTAAP  535



>ref|XP_009148181.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
Length=542

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + I+LPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  368  KVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLC  427

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILK+GEADK++G+N G+N+YAQ+++E +GLDK+ENLQ+HD
Sbjct  428  DLLICPDPRIVTVCLEGLENILKIGEADKEMGLNGGVNLYAQIVEESDGLDKIENLQSHD  487

Query  555  NNEIYEKAVKILEKYWGDEDE-EPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+E E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  488  NNEIYEKAVKILERYWAEEEEDEQILPDGVNENPQQGFSFGNNQTAAP  535



>emb|CDX93514.1| BnaA06g05340D [Brassica napus]
Length=542

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + I+LPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  368  KVQIEAVVGAGIVLPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVAQGCIKPLC  427

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILK+GEADK++G+N G+N+YAQ+++E +GLDK+ENLQ+HD
Sbjct  428  DLLICPDPRIVTVCLEGLENILKIGEADKEMGLNGGVNLYAQIVEESDGLDKIENLQSHD  487

Query  555  NNEIYEKAVKILEKYWGDEDE-EPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+E E  LPDGV+EN QQGF+FGN+Q   P
Sbjct  488  NNEIYEKAVKILERYWAEEEEDEQILPDGVNENPQQGFSFGNNQTAAP  535



>ref|XP_010475758.1| PREDICTED: importin subunit alpha-1a-like [Camelina sativa]
Length=540

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+ + IILPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICP
Sbjct  373  VVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICP  432

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKV EADK++G+NDG+N+YA +I+E +GLDK+ENLQ+HDNNEIYE
Sbjct  433  DPRIVTVCLEGLENILKVSEADKEMGLNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYE  492

Query  537  KAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            KAVKILE+YW +++EE +L DGV+EN QQ F FG +QP  P
Sbjct  493  KAVKILERYWNEDEEEQSLQDGVNENSQQTFNFGTNQPAAP  533



>ref|XP_010544159.1| PREDICTED: importin subunit alpha-1b-like [Tarenaya hassleriana]
Length=540

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ IILPLV LLQHAEFDIKKEAAWAISNATSGGS++QI+FL +Q C+KPLCDLLICP
Sbjct  373  VIDACIILPLVHLLQHAEFDIKKEAAWAISNATSGGSHDQIKFLVTQDCIKPLCDLLICP  432

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK++G+N G+N+YAQ+++E +GLDK+ENLQTHDNNEIYE
Sbjct  433  DPRIVTVCLEGLENILKVGEADKEMGLNGGVNLYAQVVEESDGLDKIENLQTHDNNEIYE  492

Query  537  KAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            KAVKILE+YW +E+EE NL DG+++N QQGF FG  QP  P
Sbjct  493  KAVKILERYWAEEEEEQNLQDGMNQNGQQGFNFGTDQPGAP  533



>ref|XP_004302281.1| PREDICTED: importin subunit alpha-4 [Fragaria vesca subsp. vesca]
Length=531

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K + + VI+++II PLV LLQHAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLC
Sbjct  360  KAQIQAVIDAQIINPLVQLLQHAEFDIKKEAAWAISNATSGGSHEQIQFLVTQGCIKPLC  419

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKVGEADK++G N+GIN++AQMIDE +GL+K+ENLQTHD
Sbjct  420  DLLICPDPRIVTVCLEGLENILKVGEADKEMGANNGINLFAQMIDEFDGLEKIENLQTHD  479

Query  555  NNEIYEKAVKILEKYWG-DEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW  +EDEE NL    D N   FTFG +QP  P
Sbjct  480  NNEIYEKAVKILERYWAEEEDEEQNLQQNGDGN--AFTFGGNQPAAP  524



>ref|XP_004144743.1| PREDICTED: importin subunit alpha-4 [Cucumis sativus]
 gb|KGN61011.1| hypothetical protein Csa_2G034640 [Cucumis sativus]
Length=537

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ IILPLV LLQHAEFDIKKEA WAISNATSGGS++QI+FL +QGC+KPLCDLL CP
Sbjct  368  VIEANIILPLVHLLQHAEFDIKKEAGWAISNATSGGSHQQIQFLVTQGCIKPLCDLLTCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGL+NILKVGEADK +GMN GINIYAQ IDECEGLDK+ENLQ+HDNNEIYE
Sbjct  428  DPRIVTVCLEGLDNILKVGEADKDMGMNGGINIYAQAIDECEGLDKIENLQSHDNNEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGV---DENQQGFTFGNSQPNVP  418
            KAVK+LE+YW +EDEE          D NQ GF FG +QPNVP
Sbjct  488  KAVKMLERYWAEEDEEQEQNPQQQNGDANQHGFAFGANQPNVP  530



>ref|XP_008388467.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=534

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  368  VIDAGIIFPLVQLLQHAEFDIKKEAAWAISNATSGGSHEQIQFLVTQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEADKNMGMNGGINLYAQIIDECEGSDKIENLQTHDNHEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW +EDEE       + NQQG+TFG +QPN P
Sbjct  488  KAVKLLERYWTEEDEEVQENGNGNGNQQGYTFGANQPNPP  527



>ref|XP_009373302.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009373303.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=534

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGS+EQI+FL +QGC+KPLCDLLICP
Sbjct  368  VIDAGIIFPLVQLLQHAEFDIKKEAAWAISNATSGGSHEQIQFLVTQGCIKPLCDLLICP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +GMN GIN+YAQ+IDECEG DK+ENLQTHDN+EIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEADKNMGMNGGINLYAQIIDECEGSDKIENLQTHDNHEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW +EDEE       + NQQGFTF  +QPN P
Sbjct  488  KAVKLLERYWTEEDEEVQENGNGNGNQQGFTFAANQPNPP  527



>ref|XP_006417589.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
 gb|ESQ35942.1| hypothetical protein EUTSA_v10007310mg [Eutrema salsugineum]
Length=539

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+ + IILPLV LLQ AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICP
Sbjct  372  VVGAGIILPLVHLLQTAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICP  431

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYE
Sbjct  432  DPRIVTVCLEGLENILKVGEADKDMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYE  491

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQ-GFTFGNSQPNVP  418
            KAVKILE+YW +E+EE N+PDG  EN Q GF FGN+QP  P
Sbjct  492  KAVKILERYWAEEEEEQNMPDGGSENPQLGFNFGNNQPAAP  532



>ref|XP_010458212.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Camelina 
sativa]
Length=540

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   ++ + IILPLV LLQ AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  367  KVQIEAMVGAGIILPLVHLLQTAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLC  426

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKV EADK++G+NDG+N+YA +I+E +GLDK+ENLQ+HD
Sbjct  427  DLLICPDPRIVTVCLEGLENILKVSEADKEMGLNDGVNLYAHIIEESDGLDKIENLQSHD  486

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +++EE  L DG +EN QQ F FG +QP  P
Sbjct  487  NNEIYEKAVKILERYWAEDEEEQILQDGGNENSQQTFNFGTNQPAAP  533



>emb|CDY31102.1| BnaA08g26520D [Brassica napus]
Length=542

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+ + ++LPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICP
Sbjct  374  VVGAGLVLPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPLCDLLICP  433

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+ EADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYE
Sbjct  434  DPRIVTVCLEGLENILKISEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYE  493

Query  537  KAVKILEKYWG-DEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            KAVKILEKYW  +EDEE  L DG +EN QQGF+FGN+QP  P
Sbjct  494  KAVKILEKYWAEEEDEEQILTDGGNENPQQGFSFGNNQPAAP  535



>ref|XP_006304709.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
 gb|EOA37607.1| hypothetical protein CARUB_v10011976mg [Capsella rubella]
Length=540

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 149/167 (89%), Gaps = 1/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + IILPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++LA+QGC+KPLC
Sbjct  367  KVQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLATQGCIKPLC  426

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLL+CPDPRIVTVCLEGLENILKVGE DK++G+NDG+N+Y Q+I+EC+GLDK+E+LQ+HD
Sbjct  427  DLLVCPDPRIVTVCLEGLENILKVGETDKEMGLNDGVNLYGQIIEECDGLDKVESLQSHD  486

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+EE  L DG +EN QQ F+FG +QP  P
Sbjct  487  NNEIYEKAVKILERYWAEEEEEQILQDGGNENSQQAFSFGTNQPAAP  533



>ref|XP_002889740.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65999.1| hypothetical protein ARALYDRAFT_888168 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 148/167 (89%), Gaps = 1/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + IILPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  365  KVQIEAVVAAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLC  424

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HD
Sbjct  425  DLLICPDPRIVTVCLEGLENILKVGEADKEMGLNGGVNLYAQIIEESDGLDKVENLQSHD  484

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+EE  L DG +EN QQ F FGN+QP  P
Sbjct  485  NNEIYEKAVKILERYWAEEEEEQILQDGGNENSQQAFNFGNNQPAAP  531



>emb|CDY32165.1| BnaCnng06740D [Brassica napus]
Length=542

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+ + ++LPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KP+CDLLICP
Sbjct  374  VVGAGLVLPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPICDLLICP  433

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+ EADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYE
Sbjct  434  DPRIVTVCLEGLENILKISEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYE  493

Query  537  KAVKILEKYWG-DEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            KAVKILE+YW  +EDEE  L DG +EN QQGF+FGN+QP  P
Sbjct  494  KAVKILERYWAEEEDEEQILTDGGNENPQQGFSFGNNQPAAP  535



>ref|XP_010458211.1| PREDICTED: importin subunit alpha-1b-like isoform X1 [Camelina 
sativa]
Length=540

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            ++ + IILPLV LLQ AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICP
Sbjct  373  MVGAGIILPLVHLLQTAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICP  432

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKV EADK++G+NDG+N+YA +I+E +GLDK+ENLQ+HDNNEIYE
Sbjct  433  DPRIVTVCLEGLENILKVSEADKEMGLNDGVNLYAHIIEESDGLDKIENLQSHDNNEIYE  492

Query  537  KAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            KAVKILE+YW +++EE  L DG +EN QQ F FG +QP  P
Sbjct  493  KAVKILERYWAEDEEEQILQDGGNENSQQTFNFGTNQPAAP  533



>ref|XP_008801729.1| PREDICTED: importin subunit alpha-1a isoform X2 [Phoenix dactylifera]
Length=533

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K + + VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGSNEQI FLASQGC+KPLC
Sbjct  362  KAQIQAVIDANIINPLVQLLQHAEFDIKKEAAWAISNATSGGSNEQIHFLASQGCIKPLC  421

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLL+CPDPRIVTVCLEGLENILKVGEA+K LG    IN YAQMIDECEGLDK+ENLQ HD
Sbjct  422  DLLVCPDPRIVTVCLEGLENILKVGEAEKDLGRTGDINPYAQMIDECEGLDKIENLQGHD  481

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            NNEIYEK +KILE+YW +ED+E  +  G  E    F FG +QP+ P
Sbjct  482  NNEIYEKTIKILERYWIEEDDEGQVVQGTGEGAT-FEFGANQPSAP  526



>ref|XP_010914627.1| PREDICTED: importin subunit alpha isoform X2 [Elaeis guineensis]
Length=533

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGSNEQI FL SQGC+KPLCDLL+CP
Sbjct  368  VIDANIINPLVQLLQHAEFDIKKEAAWAISNATSGGSNEQIHFLVSQGCIKPLCDLLVCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   GIN YAQMIDECEGLDK+ENLQ HDNNEIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEAEKDLGRTGGINPYAQMIDECEGLDKIENLQGHDNNEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K +KILE+YW +ED+E  +  G  E    F FG +QP+ P
Sbjct  488  KTIKILERYWVEEDDEGQVVQGTGEG-AAFEFGANQPSAP  526



>gb|EYU38410.1| hypothetical protein MIMGU_mgv1a004192mg [Erythranthe guttata]
Length=540

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 146/162 (90%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ I+LPLV LLQHAEFDIKKEAAWAISNATSGGS EQIRFL SQGC+KPLCDLLI P
Sbjct  372  VIQADILLPLVQLLQHAEFDIKKEAAWAISNATSGGSPEQIRFLVSQGCIKPLCDLLISP  431

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK+ G+N GINIYAQMID+CEGLDK+E LQ+HDNNEIYE
Sbjct  432  DPRIVTVCLEGLENILKVGEADKESGLNGGINIYAQMIDDCEGLDKIETLQSHDNNEIYE  491

Query  537  KAVKILEKYWGDEDEEPNLPD-GVD-ENQQGFTFGNSQPNVP  418
            KAVKILEKYW +EDE+ N+ D GVD  N QGF FGN+QPNVP
Sbjct  492  KAVKILEKYWAEEDEDQNIADAGVDGNNNQGFNFGNNQPNVP  533



>ref|XP_009110839.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Brassica 
rapa]
 ref|XP_009110840.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Brassica 
rapa]
Length=542

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 145/162 (90%), Gaps = 2/162 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+ + ++LPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLCDLLICP
Sbjct  374  VVGAGLVLPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVNQGCIKPLCDLLICP  433

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+ EADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HDNNEIYE
Sbjct  434  DPRIVTVCLEGLENILKISEADKEMGLNGGVNLYAQIIEESDGLDKIENLQSHDNNEIYE  493

Query  537  KAVKILEKYWG-DEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            KAVKILE+YW  +EDEE  L DG +EN QQGF+FGN+Q   P
Sbjct  494  KAVKILERYWAEEEDEEQILTDGGNENPQQGFSFGNNQAAAP  535



>ref|XP_010914626.1| PREDICTED: importin subunit alpha isoform X1 [Elaeis guineensis]
Length=557

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGSNEQI FL SQGC+KPLCDLL+CP
Sbjct  392  VIDANIINPLVQLLQHAEFDIKKEAAWAISNATSGGSNEQIHFLVSQGCIKPLCDLLVCP  451

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   GIN YAQMIDECEGLDK+ENLQ HDNNEIYE
Sbjct  452  DPRIVTVCLEGLENILKVGEAEKDLGRTGGINPYAQMIDECEGLDKIENLQGHDNNEIYE  511

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K +KILE+YW +ED+E  +  G  E    F FG +QP+ P
Sbjct  512  KTIKILERYWVEEDDEGQVVQGTGEG-AAFEFGANQPSAP  550



>ref|XP_003554623.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
 gb|KHN43332.1| Importin subunit alpha-1b [Glycine soja]
Length=532

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  367  VIEASIIAPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQP  427
            KAVKILE YW +ED+E  +P G D +Q GF FG +QP
Sbjct  487  KAVKILETYWMEEDDE-TMPPG-DASQSGFNFGGAQP  521



>ref|XP_003521670.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=532

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC++PLCDLLICP
Sbjct  367  VIEASIIAPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIRPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQP  427
            KAVKILE YW +ED+E  +P G D +Q GF FG +QP
Sbjct  487  KAVKILETYWMEEDDE-TMPPG-DASQSGFNFGGTQP  521



>gb|KHN03948.1| Importin subunit alpha [Glycine soja]
Length=532

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC++PLCDLLICP
Sbjct  367  VIEASIIAPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIRPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQP  427
            KAVKILE YW +ED+E  +P G D +Q GF FG +QP
Sbjct  487  KAVKILETYWMEEDDE-TMPPG-DASQSGFNFGGTQP  521



>ref|XP_006488809.1| PREDICTED: importin subunit alpha-1b-like [Citrus sinensis]
Length=528

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 140/161 (87%), Gaps = 5/161 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQHAEF++KKEA+WAISNATSGG+ EQI+FL SQGC+KPLCDLL+CP
Sbjct  365  VIEANIIAPLVYLLQHAEFEVKKEASWAISNATSGGTREQIQFLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEADK+ G +  +N+Y++MIDEC+GLDK+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKIGEADKEAG-STTVNVYSEMIDECDGLDKIENLQSHDNNEIYE  483

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW  +ED+E N+PDG   N   F FG  QPN+P
Sbjct  484  KAVKLLERYWVEEEDDEQNIPDG---NNPEFNFGTGQPNIP  521



>ref|XP_008806746.1| PREDICTED: importin subunit alpha-1-like, partial [Phoenix dactylifera]
Length=210

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI++ II PLV LLQHAEFDIKKEAAWAISN TSGGSNEQI FL SQGC+KPLCDLL+
Sbjct  43   QAVIDANIINPLVQLLQHAEFDIKKEAAWAISNTTSGGSNEQIHFLVSQGCIKPLCDLLV  102

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   GIN YAQMID CEGLDK+ENLQ HDNNEI
Sbjct  103  CPDPRIVTVCLEGLENILKVGEAEKDLGRTGGINPYAQMIDGCEGLDKIENLQGHDNNEI  162

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YE+ +KILE++W +ED+E  +  G  E    F F  +Q +VP
Sbjct  163  YERTIKILERFWVEEDDEGQVVQGSAEG-TAFEFRANQSSVP  203



>ref|XP_002519178.1| importin alpha, putative [Ricinus communis]
 gb|EEF43042.1| importin alpha, putative [Ricinus communis]
Length=488

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIES++I+PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI+++ SQGC+KPLCDLL+CP
Sbjct  324  VIESELIVPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYMVSQGCIKPLCDLLVCP  383

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  384  DPRIVTVCLEGLENILKVGEAEKNLGNSGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  443

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +ED+E  LP G D +QQGF FG + P+ P
Sbjct  444  KAVKVLETYWLEEDDE-TLPPG-DNSQQGFHFGGNDPSAP  481



>gb|KDO72000.1| hypothetical protein CISIN_1g009700mg [Citrus sinensis]
Length=528

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 5/161 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQHAEF++KKEA+WAISNATSGG+ EQI+FL SQGC+KPLCDLL+CP
Sbjct  365  VIEANIIAPLVYLLQHAEFEVKKEASWAISNATSGGTREQIQFLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEADK+ G     N+Y++MIDEC+GLDK+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKIGEADKEAGSTTA-NVYSEMIDECDGLDKIENLQSHDNNEIYE  483

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE+YW  +ED+E N+PDG   N   F FG  QPN+P
Sbjct  484  KAVKLLERYWVEEEDDEQNIPDG---NNPEFNFGTGQPNIP  521



>ref|XP_010931776.1| PREDICTED: importin subunit alpha-like [Elaeis guineensis]
Length=533

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PL  LLQHAEFDIKKEAAWA+SNATSGGSNEQI FL +QGC+KPLCDLL+CP
Sbjct  368  VIDANIINPLAQLLQHAEFDIKKEAAWAMSNATSGGSNEQIHFLVNQGCIKPLCDLLVCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   GIN YAQMIDECEGLDK+ENLQ HDNNEIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEAEKDLGRTGGINPYAQMIDECEGLDKIENLQGHDNNEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K +KILE+YW +ED+E  +  G  E    F FG +QP+VP
Sbjct  488  KTIKILERYWVEEDDEGQVVQGSAEG-VAFEFGANQPSVP  526



>emb|CAA74966.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=528

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 148/167 (89%), Gaps = 2/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + IILPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  356  KLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLC  415

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HD
Sbjct  416  DLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHD  475

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+EE  L DG ++N QQGF FGN+ P  P
Sbjct  476  NNEIYEKAVKILERYWAEEEEEQILQDGGNDNSQQGFNFGNN-PAAP  521



>ref|NP_001031011.1| importin alpha isoform 4 [Arabidopsis thaliana]
 gb|AEE28423.1| importin alpha isoform 4 [Arabidopsis thaliana]
Length=456

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + IILPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  284  KLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLC  343

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HD
Sbjct  344  DLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHD  403

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+EE  L DG ++N QQ F FGN+ P  P
Sbjct  404  NNEIYEKAVKILERYWAEEEEEQILQDGGNDNSQQAFNFGNN-PAAP  449



>ref|NP_172398.1| importin alpha isoform 4 [Arabidopsis thaliana]
 ref|NP_849623.1| importin alpha isoform 4 [Arabidopsis thaliana]
 sp|O80480.1|IMPA4_ARATH RecName: Full=Importin subunit alpha-4; Short=IMPa-4 [Arabidopsis 
thaliana]
 gb|AAC24079.1| Match to mRNA for importin alpha-like protein 4 (impa4) gb|Y14616 
from A. thaliana. ESTs gb|N96440, gb|N37503, gb|N37498 
and gb|T42198 come from this gene [Arabidopsis thaliana]
 gb|AAM13992.1| putative importin alpha protein [Arabidopsis thaliana]
 gb|AAM51388.1| putative importin alpha protein [Arabidopsis thaliana]
 dbj|BAH19416.1| AT1G09270 [Arabidopsis thaliana]
 gb|AEE28421.1| importin alpha isoform 4 [Arabidopsis thaliana]
 gb|AEE28422.1| importin alpha isoform 4 [Arabidopsis thaliana]
Length=538

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K++   V+ + IILPLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L +QGC+KPLC
Sbjct  366  KLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLC  425

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKVGEADK++G+N G+N+YAQ+I+E +GLDK+ENLQ+HD
Sbjct  426  DLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHD  485

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDEN-QQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +E+EE  L DG ++N QQ F FGN+ P  P
Sbjct  486  NNEIYEKAVKILERYWAEEEEEQILQDGGNDNSQQAFNFGNN-PAAP  531



>ref|XP_008801728.1| PREDICTED: importin subunit alpha-1a isoform X1 [Phoenix dactylifera]
Length=539

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 138/172 (80%), Gaps = 7/172 (4%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIR------FLASQG  754
            K + + VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGSNEQI+      FLASQG
Sbjct  362  KAQIQAVIDANIINPLVQLLQHAEFDIKKEAAWAISNATSGGSNEQIQYVLFFIFLASQG  421

Query  753  CVKPLCDLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLE  574
            C+KPLCDLL+CPDPRIVTVCLEGLENILKVGEA+K LG    IN YAQMIDECEGLDK+E
Sbjct  422  CIKPLCDLLVCPDPRIVTVCLEGLENILKVGEAEKDLGRTGDINPYAQMIDECEGLDKIE  481

Query  573  NLQTHDNNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            NLQ HDNNEIYEK +KILE+YW +ED+E  +  G  E    F FG +QP+ P
Sbjct  482  NLQGHDNNEIYEKTIKILERYWIEEDDEGQVVQGTGEGAT-FEFGANQPSAP  532



>ref|XP_006842676.1| PREDICTED: importin subunit alpha-1 [Amborella trichopoda]
 gb|ERN04351.1| hypothetical protein AMTR_s00147p00043750 [Amborella trichopoda]
Length=527

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQ AEFDIKKEAAWAISNATSGG++EQI++L +QGC++PLCDLL+CP
Sbjct  364  VIDANIIPPLVQLLQTAEFDIKKEAAWAISNATSGGTHEQIKYLVNQGCIRPLCDLLVCP  423

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  DG+N+YAQ+ID+ EGLDK+ENLQ+HDNNEIYE
Sbjct  424  DPRIVTVCLEGLENILKVGEAEKNLGNTDGVNLYAQLIDDAEGLDKIENLQSHDNNEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNV  421
            KAVKILE YW +EDE+  LP G +     FTFG++QP +
Sbjct  484  KAVKILETYWLEEDEDTLLPPG-ETAPAAFTFGSNQPPI  521



>ref|XP_012084020.1| PREDICTED: importin subunit alpha-2 isoform X2 [Jatropha curcas]
 gb|KDP27876.1| hypothetical protein JCGZ_18956 [Jatropha curcas]
Length=529

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG+NEQI++L SQGCVKPLCDLL+CP
Sbjct  365  VIEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTNEQIKYLVSQGCVKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGNSGDVNMYAQLIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +ED+E  LP G D  QQGF FG   P+VP
Sbjct  485  KAVKVLETYWLEEDDE-TLPTG-DGFQQGFHFGGKDPSVP  522



>ref|XP_012084019.1| PREDICTED: importin subunit alpha-2 isoform X1 [Jatropha curcas]
Length=531

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG+NEQI++L SQGCVKPLCDLL+CP
Sbjct  367  VIEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTNEQIKYLVSQGCVKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKNLGNSGDVNMYAQLIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +ED+E  LP G D  QQGF FG   P+VP
Sbjct  487  KAVKVLETYWLEEDDE-TLPTG-DGFQQGFHFGGKDPSVP  524



>ref|XP_003536050.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=532

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  367  VIEANLIAPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G    +N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNIGNTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E++E  +P G D +Q GF FG+S  P VP
Sbjct  487  KAVKILETYWLEEEDE-TMPPG-DASQSGFNFGSSDAPTVP  525



>gb|KHN16078.1| Importin subunit alpha-1 [Glycine soja]
Length=532

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  367  VIEANLIAPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G    +N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNIGNTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E++E  +P G D +Q GF FG+S  P VP
Sbjct  487  KAVKILETYWLEEEDE-TMPPG-DASQSGFNFGSSDAPTVP  525



>gb|AES82394.2| importin subunit alpha-1b [Medicago truncatula]
Length=532

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQ+++L SQGC+KPLCDLL CP
Sbjct  367  VIDANIIAPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQLKYLVSQGCIKPLCDLLTCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK  G+ DG+N YA++IDE EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNAGITDGVNRYAELIDEAEGLEKIENLQSHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +ED+E  +P G D +Q GF FG S+ P VP
Sbjct  487  KAVKILETYWLEEDDEA-MPPG-DASQSGFNFGGSEVPAVP  525



>ref|XP_003556535.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006606551.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
 gb|KHN20271.1| Importin subunit alpha-1 [Glycine soja]
Length=532

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  367  VIEANLIAPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G    +N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNIGNTGDVNLYAQMIDEAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E++E  +P G D +Q GF FG+S  P VP
Sbjct  487  KAVKILETYWLEEEDE-TMPPG-DASQSGFNFGSSDAPAVP  525



>ref|XP_003626176.1| Importin subunit alpha [Medicago truncatula]
Length=563

 Score =   241 bits (615),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQ+++L SQGC+KPLCDLL CP
Sbjct  367  VIDANIIAPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQLKYLVSQGCIKPLCDLLTCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK  G+ DG+N YA++IDE EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNAGITDGVNRYAELIDEAEGLEKIENLQSHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +ED+E  +P G D +Q GF FG S+ P VP
Sbjct  487  KAVKILETYWLEEDDEA-MPPG-DASQSGFNFGGSEVPAVP  525



>ref|XP_011023747.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Populus 
euphratica]
Length=529

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICP
Sbjct  366  VIEANIIGPLVNLLQSAEFDIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLICP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEADKNVSETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +EDE   +P G D +Q GF FG   P VP
Sbjct  486  KAVKILETYWLEEDE--TMPPG-DASQSGFQFGGEAPAVP  522



>ref|XP_010095558.1| Importin subunit alpha [Morus notabilis]
 gb|EXB60957.1| Importin subunit alpha [Morus notabilis]
Length=628

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 137/166 (83%), Gaps = 10/166 (6%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K + + VI++ II PLV LLQHAEF+IKKEAAWAISNATSGGS+EQI+FL +QGC+ PLC
Sbjct  362  KAQIQAVIDANIIQPLVHLLQHAEFEIKKEAAWAISNATSGGSHEQIQFLVTQGCIAPLC  421

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLL CPDPRI+TVCLEGLENILKVGEADK++G+N GIN+YAQ IDEC+GLDK+E+LQ HD
Sbjct  422  DLLACPDPRIITVCLEGLENILKVGEADKEMGLNGGINLYAQQIDECDGLDKIESLQNHD  481

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +ED++ NLP           F   QP +P
Sbjct  482  NNEIYEKAVKILERYWTEEDDDENLP----------VFAGGQPTLP  517



>ref|XP_011023748.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICP
Sbjct  365  VIEANIIGPLVNLLQSAEFDIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNVSETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +EDE   +P G D +Q GF FG   P VP
Sbjct  485  KAVKILETYWLEEDE--TMPPG-DASQSGFQFGGEAPAVP  521



>ref|XP_007144986.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris]
 gb|ESW16980.1| hypothetical protein PHAVU_007G199900g [Phaseolus vulgaris]
Length=532

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  367  VIEANLITPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKSIGNTGDVNLYAQIIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +ED+E  +P G D +Q GF FGN+  P VP
Sbjct  487  KAVKILETYWLEEDDE-TMPPG-DASQSGFNFGNNDAPAVP  525



>ref|XP_010684628.1| PREDICTED: importin subunit alpha [Beta vulgaris subsp. vulgaris]
Length=531

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS +QI+FL SQGC+KPLCDLL+CP
Sbjct  367  VIEAGIIAPLVHLLQNAEFDIKKEAAWAISNATSGGSPDQIKFLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEA+K LG + GIN+YAQM+++ EGLDK+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKIGEAEKNLGTSGGINVYAQMVEDAEGLDKIENLQSHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            KAVKILE YW D DE+  LP   +  Q GF FG ++ NVP+
Sbjct  487  KAVKILETYWVD-DEDEALPSA-EGAQNGFEFGGNELNVPQ  525



>ref|XP_004494548.1| PREDICTED: importin subunit alpha-like [Cicer arietinum]
Length=531

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ I  PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQ+++L SQGC+KPLCDLLICP
Sbjct  366  VIDANIFGPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQLKYLVSQGCIKPLCDLLICP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +   DG+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEADKNVSNTDGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW  EDE+  +P G D +Q GF FG S+ P+VP
Sbjct  486  KAVKILETYWL-EDEDETMPPG-DASQSGFNFGGSEVPSVP  524



>gb|ACF86631.1| unknown [Zea mays]
Length=234

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 138/163 (85%), Gaps = 4/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+
Sbjct  70   QAVINANIIAPLVQLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLV  129

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EI
Sbjct  130  CPDPRIVTVCLEGLENILKVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEI  188

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            YEKAVK+LE YW +E+++  +P G D  Q GF FGN QP+VP 
Sbjct  189  YEKAVKMLESYWLEEEDDA-MPSG-DNPQNGFNFGN-QPSVPS  228



>ref|XP_003591197.1| Importin subunit alpha-1 [Medicago truncatula]
 gb|AES61448.1| importin subunit alpha-1b [Medicago truncatula]
Length=533

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 140/161 (87%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ I  PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICP
Sbjct  367  VIEANIFGPLVSLLQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G N  +N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNIGNNGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +E++E  +P G D +Q GF FG+++ P+VP
Sbjct  487  KAVKILETYWLEEEDE-TMPPG-DASQSGFNFGSAEVPSVP  525



>ref|XP_002318966.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|EEE94889.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICP
Sbjct  365  VIEANIIGPLVNLLQNAEFDIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNVSETGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  +P G D +Q GF FG   P VP
Sbjct  485  KAVKILETYWLEEEDE-TMPPG-DASQSGFQFGGEAPAVP  522



>ref|XP_012088940.1| PREDICTED: importin subunit alpha-2 [Jatropha curcas]
 gb|KDP23418.1| hypothetical protein JCGZ_23251 [Jatropha curcas]
Length=528

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 140/161 (87%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLICP
Sbjct  363  VIEAGIIGPLVHLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLICP  422

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK LG + G+N+YAQMID+ +GL+K+ENLQ+HDN EIYE
Sbjct  423  DPRIVTVCLEGLENILKVGEADKNLGNSGGVNLYAQMIDDSDGLEKIENLQSHDNTEIYE  482

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +E++E  +P G D +Q GF FG S+ P VP
Sbjct  483  KAVKILETYWLEEEDE-TMPPG-DASQSGFQFGGSEMPAVP  521



>ref|XP_009781700.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Nicotiana 
sylvestris]
Length=453

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICP
Sbjct  289  VIEAGIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICP  348

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  349  DPRIVTVCLEGLENILKVGEAEKNLGRTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYE  408

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D  QQGF FG+ + +VP
Sbjct  409  KAVKILETYWLEEDDE-TMPPG-DAPQQGFQFGDGEVSVP  446



>ref|XP_006380207.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
 gb|ERP58004.1| hypothetical protein POPTR_0008s22930g [Populus trichocarpa]
Length=529

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIEAGLIGPLVNLLQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGNSGDVNFYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP G D  QQGF FG +   VP
Sbjct  486  KAVKILETYWLEEDDEA-LPSG-DGAQQGFHFGENNVQVP  523



>ref|XP_006382424.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
 gb|ERP60221.1| Importin alpha-1 subunit family protein [Populus trichocarpa]
Length=529

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKE+AWAISNATSGG++EQI++L SQGC+KPLCDLLICP
Sbjct  365  VIEANLIGPLVHLLQNAEFDIKKESAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNVSDTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D +Q GF FG   P VP
Sbjct  485  KAVKILETYWLEEDDE-TMPPG-DASQSGFQFGGDAPAVP  522



>gb|AFW77280.1| hypothetical protein ZEAMMB73_231111, partial [Zea mays]
Length=227

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 4/162 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+
Sbjct  63   QAVINANIIAPLVQLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLV  122

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EI
Sbjct  123  CPDPRIVTVCLEGLENILKVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEI  181

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YEKAVK+LE YW +E+++  +P G D  Q GF FGN QP+VP
Sbjct  182  YEKAVKMLESYWLEEEDDA-MPSG-DNPQNGFNFGN-QPSVP  220



>gb|EYU25627.1| hypothetical protein MIMGU_mgv1a004356mg [Erythranthe guttata]
 gb|EYU42202.1| hypothetical protein MIMGU_mgv1a004354mg [Erythranthe guttata]
Length=531

 Score =   238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PL+ LLQ+AEFD+KKEAAWAISNATSGG++EQI++L SQ C+KPLCDLL+CP
Sbjct  366  VIEANIIGPLIQLLQNAEFDVKKEAAWAISNATSGGTHEQIKYLVSQQCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGKTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+EP  P G    QQGF FG S  ++P
Sbjct  486  KAVKILETYWLEEDDEP-APPGDAAAQQGFQFGGSDVSLP  524



>gb|AAB72116.2| AtKAP alpha [Arabidopsis thaliana]
Length=532

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  365  VVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  +ED+E   P GVD +Q GF FG +Q  VP
Sbjct  485  KAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>ref|NP_187328.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 ref|NP_850524.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 sp|Q96321.2|IMPA1_ARATH RecName: Full=Importin subunit alpha-1; Short=IMPa-1; AltName: 
Full=Karyopherin subunit alpha-1; Short=KAP-alpha-1 [Arabidopsis 
thaliana]
 gb|AAC27644.1| importin alpha [Arabidopsis thaliana]
 gb|AAF63826.1| importin alpha [Arabidopsis thaliana]
 gb|AAM19769.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AAM67050.1| importin alpha [Arabidopsis thaliana]
 gb|AAM78039.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
 gb|AEE74447.1| Importin subunit alpha-1 [Arabidopsis thaliana]
 gb|AEE74448.1| Importin subunit alpha-1 [Arabidopsis thaliana]
Length=532

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  365  VVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  +ED+E   P GVD +Q GF FG +Q  VP
Sbjct  485  KAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>ref|XP_003546338.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006597715.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
Length=531

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  367  VIEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKSLGNTGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW ++D+E  LP G D  Q GF FGN+   VP
Sbjct  487  KAVKILETYWLEDDDE-TLPAG-DGAQPGFNFGNNDLPVP  524



>ref|XP_002882488.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58747.1| AT-IMP [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  365  VVEANLIAPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIITVCLEGLENILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  +ED+E   P GVD +Q GF FG +Q  VP
Sbjct  485  KAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>ref|XP_011013186.1| PREDICTED: importin subunit alpha-1-like [Populus euphratica]
Length=529

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIEAGLIGPLVNLLQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGNSGDVNFYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP G D  QQGF FG +   VP
Sbjct  486  KAVKILETYWLEEDDEA-LPSG-DGAQQGFHFGENNVQVP  523



>emb|CAA75513.1| Importin alpha-like protein [Arabidopsis thaliana]
Length=532

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  365  VVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  +ED+E   P GVD +Q GF FG +Q  VP
Sbjct  485  KAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>gb|AAL06825.1| AT3g06720/F3E22_14 [Arabidopsis thaliana]
Length=532

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  365  VVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  +ED+E   P GVD +Q GF FG +Q  VP
Sbjct  485  KAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVP  525



>gb|KHN14650.1| Importin subunit alpha-1 [Glycine soja]
Length=533

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  369  VIEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEAEKSLGNTGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYE  488

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW ++D+E  LP G D  Q GF FGN+   VP
Sbjct  489  KAVKILETYWLEDDDE-TLPAG-DGAQPGFNFGNNDLPVP  526



>ref|XP_003533220.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006586905.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Glycine 
max]
 ref|XP_006586906.1| PREDICTED: importin subunit alpha-1-like isoform X3 [Glycine 
max]
Length=531

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  367  VVEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K +G +  +N+YAQMIDE EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKSMGNSGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW ++D+E  LP G D  Q GF FGN+   VP
Sbjct  487  KAVKILETYWLEDDDE-TLPTG-DGAQPGFNFGNNDVPVP  524



>gb|KHN12909.1| Importin subunit alpha-1 [Glycine soja]
Length=526

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  362  VVEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  421

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K +G +  +N+YAQMIDE EGL+K+ENLQ+HDNNEIYE
Sbjct  422  DPRIVTVCLEGLENILKVGEAEKSMGNSGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYE  481

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW ++D+E  LP G D  Q GF FGN+   VP
Sbjct  482  KAVKILETYWLEDDDE-TLPTG-DGAQPGFNFGNNDVPVP  519



>ref|XP_009781699.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Nicotiana 
sylvestris]
Length=529

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICP
Sbjct  365  VIEAGIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGRTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D  QQGF FG+ + +VP
Sbjct  485  KAVKILETYWLEEDDE-TMPPG-DAPQQGFQFGDGEVSVP  522



>ref|XP_010486198.1| PREDICTED: importin subunit alpha-1 isoform X1 [Camelina sativa]
 ref|XP_010486199.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486200.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
 ref|XP_010486201.1| PREDICTED: importin subunit alpha-1 isoform X2 [Camelina sativa]
Length=534

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  367  VVEANLITPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIITVCLEGLENILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYE  486

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  DEDEE   P GVD +Q GF FG +Q  VP
Sbjct  487  KAVKILEAYWLEDEDEETPQPPGVDGSQAGFQFGGNQAPVP  527



>ref|XP_010094009.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55043.1| Importin subunit alpha-1 [Morus notabilis]
Length=530

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  365  VIEANIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   G+N YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGNTGGVNQYAQLIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +E+++  +P G D +Q GF FG  Q P+VP
Sbjct  485  KAVKILETYWLEEEDD-TMPPG-DASQSGFNFGGDQVPSVP  523



>ref|XP_009621534.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
 ref|XP_009621540.1| PREDICTED: importin subunit alpha-1-like [Nicotiana tomentosiformis]
Length=529

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICP
Sbjct  365  VIETGIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGRTADVNLYAQLIDDAEGLEKIENLQSHDNQEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D  QQGF FG+ + +VP
Sbjct  485  KAVKILETYWLEEDDE-TMPPG-DAPQQGFQFGDGEVSVP  522



>ref|XP_004495675.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Cicer arietinum]
Length=455

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VIE+ I  PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L SQGC+KPLCDLLI
Sbjct  287  QAVIEANIFGPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVSQGCIKPLCDLLI  346

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEADK +G    +N+YAQMID+ EGL+K+ENLQ+HDN EI
Sbjct  347  CPDPRIVTVCLEGLENILKVGEADKNIGNTGDVNLYAQMIDDAEGLEKIENLQSHDNTEI  406

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVPE  415
            YEKAVKILE YW +ED+E  +P G D  Q GF FG+++ P+VP 
Sbjct  407  YEKAVKILETYWLEEDDE-TMPPG-DAAQSGFNFGSAEVPSVPS  448



>gb|EEC78554.1| hypothetical protein OsI_18524 [Oryza sativa Indica Group]
Length=502

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 3/162 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+
Sbjct  337  QAVINANIIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLV  396

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EI
Sbjct  397  CPDPRIVTVCLEGLENILKVGEAEKNLGAGD-VNAYAQMIDDAEGLEKIENLQSHDNTEI  455

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YEKAVK+LE YW +E+++  +P G D  Q GF FGN QPNVP
Sbjct  456  YEKAVKMLESYWLEEEDDA-MPSG-DNAQNGFNFGNQQPNVP  495



>ref|XP_011036930.1| PREDICTED: importin subunit alpha-1 isoform X1 [Populus euphratica]
Length=530

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKE+AWAISNATSGG++EQI++L  QGC+KPLCDLLICP
Sbjct  366  VIEANLIGPLVHLLQNAEFDIKKESAWAISNATSGGTHEQIKYLVGQGCIKPLCDLLICP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEADKNVSNTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D +Q GF FG   P VP
Sbjct  486  KAVKILETYWLEEDDE-TMPPG-DASQSGFQFGGDAPAVP  523



>ref|XP_011036931.1| PREDICTED: importin subunit alpha-1 isoform X2 [Populus euphratica]
Length=529

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKE+AWAISNATSGG++EQI++L  QGC+KPLCDLLICP
Sbjct  365  VIEANLIGPLVHLLQNAEFDIKKESAWAISNATSGGTHEQIKYLVGQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +    G+N+YAQMID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNVSNTGGVNLYAQMIDDAEGLEKIENLQSHDNSEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D +Q GF FG   P VP
Sbjct  485  KAVKILETYWLEEDDE-TMPPG-DASQSGFQFGGDAPAVP  522



>ref|NP_001054692.1| Os05g0155500 [Oryza sativa Japonica Group]
 sp|Q9SLX0.2|IMA1B_ORYSJ RecName: Full=Importin subunit alpha-1b [Oryza sativa Japonica 
Group]
 dbj|BAF16606.1| Os05g0155500 [Oryza sativa Japonica Group]
 gb|EEE62387.1| hypothetical protein OsJ_17176 [Oryza sativa Japonica Group]
 gb|AGW80665.1| hypothetical protein [Oryza sativa Japonica Group]
Length=534

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CP
Sbjct  371  VINANIIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCP  430

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  431  DPRIVTVCLEGLENILKVGEAEKNLGAGD-VNSYAQMIDDAEGLEKIENLQSHDNTEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E+++  +P G D  Q GF FGN QPNVP
Sbjct  490  KAVKMLESYWLEEEDDA-MPSG-DNAQNGFNFGNQQPNVP  527



>gb|KJB82641.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
 gb|KJB82642.1| hypothetical protein B456_013G206500 [Gossypium raimondii]
Length=529

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL CP
Sbjct  365  VIEANIISPLVHLLQNAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK LG   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNLGTTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E++E  +P G D +Q GF FG  +  VP
Sbjct  485  KAVKVLETYWLEEEDE-TMPPG-DASQTGFHFGGGELPVP  522



>ref|XP_004495674.1| PREDICTED: importin subunit alpha-1b-like isoform X1 [Cicer arietinum]
Length=533

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ I  PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L SQGC+KPLCDLLICP
Sbjct  367  VIEANIFGPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G    +N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNIGNTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +ED+E  +P G D  Q GF FG+++ P+VP
Sbjct  487  KAVKILETYWLEEDDE-TMPPG-DAAQSGFNFGSAEVPSVP  525



>ref|XP_004487798.1| PREDICTED: importin subunit alpha-1-like [Cicer arietinum]
Length=531

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  367  VIEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K  G    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKSFGNTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  EDE+  LP G D +Q GF FG+S   VP
Sbjct  487  KAVKILETYWL-EDEDETLPAG-DGSQPGFNFGSSDLPVP  524



>ref|XP_007051048.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 ref|XP_007051049.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95205.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
 gb|EOX95206.1| Importin alpha, ALPHA,AIMP ALPHA isoform 1 [Theobroma cacao]
Length=534

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 138/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGEAEKNLGHTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW ++++EP LP G D +Q GF FG +Q  VP
Sbjct  490  KAVKILETYWVEDEDEP-LPPG-DASQSGFQFGANQHPVP  527



>ref|XP_010444089.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+++ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  367  VVDANLITPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVQQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIITVCLEGLENILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYE  486

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  DEDEE   P GVD +Q GF FG +Q  VP
Sbjct  487  KAVKILEAYWLEDEDEETPQPPGVDGSQAGFQFGGNQAPVP  527



>ref|XP_002512485.1| importin alpha, putative [Ricinus communis]
 gb|EEF49937.1| importin alpha, putative [Ricinus communis]
Length=531

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 140/162 (86%), Gaps = 4/162 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LL++AEFDIKKEAAWAISNATSGG+++QI++L SQGC+KPLCDLLICP
Sbjct  365  VIEANIIGPLVHLLENAEFDIKKEAAWAISNATSGGTHDQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMND-GINIYAQMIDECEGLDKLENLQTHDNNEIY  541
            DPRIVTVCLEGLENILKVGEADK LG ND G+N+YAQMID+ EGL+K+ENLQ+HDN EIY
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNLGNNDGGVNLYAQMIDDAEGLEKIENLQSHDNIEIY  484

Query  540  EKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            EKAVKILE YW +E++E  +P G D +Q GF FG S  P +P
Sbjct  485  EKAVKILETYWLEEEDE-TMPPG-DASQSGFQFGGSDMPTIP  524



>ref|XP_010931697.1| PREDICTED: importin subunit alpha-1b [Elaeis guineensis]
Length=531

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLLICP
Sbjct  366  VIAAGIIGPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLICP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGATGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E+++  +P G D  Q GF FGN+ Q  VP
Sbjct  486  KAVKILETYWLEEEDDA-MPTG-DAAQSGFHFGNNEQVQVP  524



>ref|XP_008797160.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIAAGIIGPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E+++  +P G D  Q GF FGN+ Q  VP
Sbjct  486  KAVKILETYWLEEEDDA-MPTG-DAAQTGFNFGNNEQVQVP  524



>ref|XP_004244944.1| PREDICTED: importin subunit alpha-1 [Solanum lycopersicum]
Length=529

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+++ II PLV LLQ+AEF+IKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICP
Sbjct  365  VVDAGIIGPLVNLLQNAEFEIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    IN+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKSLGRTSDINLYAQLIDDAEGLEKIENLQSHDNQEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D  QQGF FG  + +VP
Sbjct  485  KAVKILETYWLEEDDE-TMPPG-DAAQQGFQFGGGEVSVP  522



>gb|ABM05487.1| Impa1 [Nicotiana benthamiana]
Length=532

 Score =   236 bits (601),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CP
Sbjct  367  VIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP   D    GF FG  +  +P
Sbjct  487  KAVKILETYWLEEDDE-QLPSA-DAQHSGFNFGGGELPLP  524



>ref|XP_008245768.1| PREDICTED: importin subunit alpha-1 [Prunus mume]
Length=530

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI++ II PLV LLQ AEFDIKKEAAWAISNATSGGS+EQI+ L  QGC+KPLCDLLI
Sbjct  363  KAVIDAGIIAPLVSLLQGAEFDIKKEAAWAISNATSGGSHEQIKILVDQGCIKPLCDLLI  422

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ ID+ EGL+K+ENLQ+HDN EI
Sbjct  423  CPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIDDAEGLEKIENLQSHDNTEI  482

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            YEKAVKILE YW  EDE+  +P G D +Q GF FG S  P VP
Sbjct  483  YEKAVKILETYW-VEDEDETMPPG-DASQTGFNFGGSGMPTVP  523



>ref|XP_008810191.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810193.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
 ref|XP_008810194.1| PREDICTED: importin subunit alpha-1b-like [Phoenix dactylifera]
Length=531

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIAAGIIGPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGATAGVNLYAQMIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E+++  +P G D  Q GF FGN+ Q  VP
Sbjct  486  KAVKILETYWLEEEDDA-MPTG-DAAQSGFQFGNNEQVQVP  524



>gb|KHG29743.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=556

 Score =   236 bits (602),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGG+++Q++FL SQGC+KPLCDLL CP
Sbjct  365  VIEANIISPLVHLLQNAEFDIKKEAAWAISNATSGGTHDQMKFLVSQGCIKPLCDLLNCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK LG   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNLGTTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E++E  +P G D +Q GF FG  +  VP
Sbjct  485  KAVKVLETYWLEEEDE-TMPPG-DASQTGFHFGGGELPVP  522



>ref|XP_007138966.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
 gb|ESW10960.1| hypothetical protein PHAVU_009G253500g [Phaseolus vulgaris]
Length=529

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  366  VIEAGLIAPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKSLGNTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQP  427
            KAVKILE YW ++D++  LP G D  Q GF FGN  P
Sbjct  486  KAVKILETYWLEDDDD-TLPTG-DGAQPGFNFGNELP  520



>gb|KJB41861.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=453

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL 
Sbjct  287  QAVIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLN  346

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEI
Sbjct  347  CPDPRIVTVCLEGLENILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEI  406

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            YEKAVKILE YW  EDE+  LP G D +Q GF FG +Q  VP 
Sbjct  407  YEKAVKILETYW-VEDEDEALPTG-DASQPGFQFGGNQLPVPS  447



>ref|XP_010464259.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+ + +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  367  VVAANLITPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIITVCLEGLENILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNQEIYE  486

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  DEDEE   P GVD +Q GF FG +Q  VP
Sbjct  487  KAVKILEAYWLEDEDEETPQPPGVDGSQAGFQFGGNQAPVP  527



>ref|XP_009606138.1| PREDICTED: importin subunit alpha [Nicotiana tomentosiformis]
Length=530

 Score =   235 bits (600),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG+ +QI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGNQDQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP   D    GF FG  +  +P
Sbjct  486  KAVKILETYWLEEDDE-QLPSA-DAQHSGFNFGGGELPLP  523



>ref|XP_006297392.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 ref|XP_006297393.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 gb|EOA30290.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
 gb|EOA30291.1| hypothetical protein CARUB_v10013416mg [Capsella rubella]
Length=536

 Score =   235 bits (600),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+++ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  369  VVDANLIAPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  429  DPRIITVCLEGLENILKVGEAEKNLGNTGDMNYYAQLIDDAEGLEKIENLQSHDNHEIYE  488

Query  537  KAVKILEKYWGDE-DEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E DEE     GVD +Q GF FG +Q +VP
Sbjct  489  KAVKILEAYWLEEGDEETQQAPGVDSSQAGFQFGGNQASVP  529



>ref|XP_008350735.1| PREDICTED: importin subunit alpha-1b-like, partial [Malus domestica]
Length=239

 Score =   226 bits (577),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 3/164 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            R V+E+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+
Sbjct  72   RAVVEANIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLV  131

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EI
Sbjct  132  CPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEI  191

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVPE  415
            YEKAVK+LE YW ++D+E  +P G D     F F GN  P VP 
Sbjct  192  YEKAVKMLETYWLEDDDE-TMPPG-DAAPTTFNFGGNDVPTVPS  233



>ref|XP_002275593.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 ref|XP_010649542.1| PREDICTED: importin subunit alpha-1 isoform X1 [Vitis vinifera]
 emb|CBI22923.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  365  VIEAGVIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKTLGNSGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D +Q GF FG +  +VP
Sbjct  485  KAVKILETYWLEEEDE-TLPSG-DGSQPGFQFGGNDVSVP  522



>ref|XP_010914512.1| PREDICTED: importin subunit alpha-1b-like [Elaeis guineensis]
Length=531

 Score =   235 bits (599),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIAAGIIGPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQMIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E+++  +P G D  Q GF FGN+ Q  VP
Sbjct  486  KAVKILETYWLEEEDDA-MPAG-DAAQTGFHFGNNEQLQVP  524



>gb|KHN03320.1| Importin subunit alpha-1 [Glycine soja]
Length=487

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ ++ PLV LLQ+AEFDIKKEAAWAISNATSGG +EQI++L SQGC+KPLCDLL+CP
Sbjct  323  VIEAGLVAPLVNLLQNAEFDIKKEAAWAISNATSGGIHEQIKYLVSQGCIKPLCDLLVCP  382

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  383  DPRIVTVCLEGLENILKVGEAEKSLGNTGDVNEYAQMIDDAEGLEKIENLQSHDNNEIYE  442

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D  Q GF FGN++  VP
Sbjct  443  KAVKILETYWLEEEDE-TLPSG-DGAQPGFNFGNNELPVP  480



>ref|XP_007031099.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 ref|XP_007031100.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11601.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
 gb|EOY11602.1| Importin alpha, ALPHA,AIMP ALPHA isoform 2 [Theobroma cacao]
Length=529

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL CP
Sbjct  365  VIEANIIAPLVHLLQNAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK  G   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNQGNTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E++E  +P G D +Q GF FG  + +VP
Sbjct  485  KAVKVLETYWLEEEDE-TMPPG-DASQTGFQFGPGEVHVP  522



>ref|XP_007205032.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
 gb|EMJ06231.1| hypothetical protein PRUPE_ppa004091mg [Prunus persica]
Length=530

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI++ II PLV LLQ AEFDIKKEAAWAISNATSGGS+EQI+ L  QGC+KPLCDLLI
Sbjct  363  KAVIDAGIIGPLVSLLQGAEFDIKKEAAWAISNATSGGSHEQIKILVDQGCIKPLCDLLI  422

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ ID+ EGL+K+ENLQ+HDN EI
Sbjct  423  CPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIDDAEGLEKIENLQSHDNTEI  482

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            YEKAVKILE YW  EDE+  +P G D +Q GF F GN  P VP
Sbjct  483  YEKAVKILETYW-VEDEDETMPPG-DASQTGFNFGGNGMPTVP  523



>ref|XP_006345634.1| PREDICTED: importin subunit alpha-1-like [Solanum tuberosum]
Length=529

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+++ II PLV LLQ+AEF+IKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICP
Sbjct  365  VVDAGIIGPLVNLLQNAEFEIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    IN+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGRTSDINLYAQLIDDAEGLEKIENLQSHDNQEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D  QQGF FG  + +VP
Sbjct  485  KAVKILETYWLEEDDE-TMPPG-DAPQQGFQFGGGEVSVP  522



>ref|XP_009789105.1| PREDICTED: importin subunit alpha [Nicotiana sylvestris]
Length=532

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CP
Sbjct  367  VIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP   D    GF FG     +P
Sbjct  487  KAVKILETYWLEEDDE-QLPSA-DAQHSGFNFGGGDLPLP  524



>gb|KJB41862.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=535

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  371  VIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  430

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  431  DPRIVTVCLEGLENILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  490

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  EDE+  LP G D +Q GF FG +Q  VP
Sbjct  491  KAVKILETYWV-EDEDEALPTG-DASQPGFQFGGNQLPVP  528



>ref|XP_010093918.1| Importin subunit alpha [Morus notabilis]
 gb|EXB54870.1| Importin subunit alpha [Morus notabilis]
Length=840

 Score =   240 bits (613),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 137/166 (83%), Gaps = 10/166 (6%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K + + VI++ II PLV LLQHAEF+IKKEAAWAISNATSGGS+EQI+FL +QGC+ PLC
Sbjct  362  KAQIQAVIDANIIQPLVHLLQHAEFEIKKEAAWAISNATSGGSHEQIQFLVTQGCIAPLC  421

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLL CPDPRI+TVCLEGLENILKVGEADK++G+N GIN+YAQ IDEC+GLDK+E+LQ HD
Sbjct  422  DLLACPDPRIITVCLEGLENILKVGEADKEMGLNGGINLYAQQIDECDGLDKIESLQNHD  481

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            NNEIYEKAVKILE+YW +ED++ NLP           F   QP +P
Sbjct  482  NNEIYEKAVKILERYWTEEDDDENLP----------VFAGGQPTLP  517


 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 10/118 (8%)
 Frame = -1

Query  771  FLASQGCVKPLCDLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECE  592
            FL +QGC+ PLCDLL CPDPRI+TVCLEGLENILKVGEADK++G+N GIN+YAQ IDEC+
Sbjct  525  FLVTQGCIAPLCDLLACPDPRIITVCLEGLENILKVGEADKEMGLNGGINLYAQQIDECD  584

Query  591  GLDKLENLQTHDNNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            GLDK+E+LQ HDNNEIYEKAVKILE+YW +ED++ NLP           F   QP +P
Sbjct  585  GLDKIESLQNHDNNEIYEKAVKILERYWTEEDDDENLP----------VFAGGQPTLP  632



>gb|KHG01621.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
 gb|KJB41859.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41860.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41864.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
 gb|KJB41865.1| hypothetical protein B456_007G124900 [Gossypium raimondii]
Length=534

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  EDE+  LP G D +Q GF FG +Q  VP
Sbjct  490  KAVKILETYWV-EDEDEALPTG-DASQPGFQFGGNQLPVP  527



>ref|XP_010649543.1| PREDICTED: importin subunit alpha-1 isoform X2 [Vitis vinifera]
Length=509

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  345  VIEAGVIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  404

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  405  DPRIVTVCLEGLENILKVGEAEKTLGNSGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYE  464

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D +Q GF FG +  +VP
Sbjct  465  KAVKILETYWLEEEDE-TLPSG-DGSQPGFQFGGNDVSVP  502



>ref|XP_004150082.1| PREDICTED: importin subunit alpha-1 [Cucumis sativus]
 gb|KGN47403.1| hypothetical protein Csa_6G312550 [Cucumis sativus]
Length=530

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+++I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  365  VIEARLIPPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG N  +N+YAQMID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGTNGDVNLYAQMIDDAEGLEKIENLQSHDNHEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP      Q GF FG ++  VP
Sbjct  485  KAVKILETYWLEEEDEA-LPATDGGAQPGFRFGGNELPVP  523



>dbj|BAA88950.1| importin alpha 1b [Oryza sativa Japonica Group]
Length=534

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CP
Sbjct  371  VINANIIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCP  430

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  431  DPRIVTVCLEGLENILKVGEAEKNLGAGD-VNSYAQMIDDAEGLEKIENLQSHDNTEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E+++  +P G D  Q GF  GN QPNVP
Sbjct  490  KAVKMLESYWLEEEDDA-MPSG-DNAQNGFNLGNQQPNVP  527



>ref|XP_012082851.1| PREDICTED: importin subunit alpha-like [Jatropha curcas]
 gb|KDP28222.1| hypothetical protein JCGZ_13993 [Jatropha curcas]
Length=535

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            +I++ II PLV LLQ AEF+IKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLLICP
Sbjct  370  IIDAGIIGPLVQLLQIAEFEIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLICP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +   N+YAQ+ID+ EGL+K+ENLQ+HDN++IYE
Sbjct  430  DPRIVTVCLEGLENILKVGEAEKNLGNSGETNLYAQLIDDAEGLEKIENLQSHDNHDIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +EDE+  LP G D +Q GF FG ++  VP
Sbjct  490  KAVKILETYWLEEDEDETLPSG-DASQSGFHFGGNEVPVP  528



>dbj|BAK07842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI++ II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L  QGC+KPLCDLLI
Sbjct  125  QAVIQANIIGPLVHLLQGAEFDIKKEAAWAISNATSGGTHDQIKYLVGQGCIKPLCDLLI  184

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EI
Sbjct  185  CPDPRIVTVCLEGLENILKVGEAEKNLGAGD-VNNYAQMIDDAEGLEKIENLQSHDNTEI  243

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YEKAVK+LE YW +E++E  +P G D  Q GF FG+ Q +VP
Sbjct  244  YEKAVKMLESYWLEEEDEV-MPSG-DNAQNGFNFGSQQNSVP  283



>ref|XP_006655009.1| PREDICTED: importin subunit alpha-1b-like [Oryza brachyantha]
Length=529

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+
Sbjct  364  QAVINANIIGPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLV  423

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K L   D +N YAQMID+ EGL+K+ENLQ+HDN EI
Sbjct  424  CPDPRIVTVCLEGLENILKVGEAEKNLAAGD-VNAYAQMIDDAEGLEKIENLQSHDNTEI  482

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YEKAVK+LE YW +E+++  +P G D  Q GF FGN QPNVP
Sbjct  483  YEKAVKMLESYWLEEEDDA-MPSG-DNAQNGFNFGNQQPNVP  522



>ref|XP_004144766.1| PREDICTED: importin subunit alpha-2 [Cucumis sativus]
 gb|KGN60977.1| hypothetical protein Csa_2G033320 [Cucumis sativus]
Length=529

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K + + VI++ I+ PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLC
Sbjct  359  KAQIQAVIDANIVAPLVHLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVNQGCIKPLC  418

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKVGEA+K      G+N+YAQ+ID+ EGL+K+ENLQ+HD
Sbjct  419  DLLICPDPRIVTVCLEGLENILKVGEAEKNTTNTGGVNLYAQLIDDAEGLEKIENLQSHD  478

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            N EIYEKAVKILE YW +E++E  +P G D  Q GF FG  +P VP
Sbjct  479  NTEIYEKAVKILETYWLEEEDE-TMPPGTDP-QAGFNFGGDRPVVP  522



>ref|XP_006378029.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa]
 gb|ERP55826.1| hypothetical protein POPTR_0010s00370g, partial [Populus trichocarpa]
Length=285

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VIE+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+
Sbjct  67   QAVIENGLIGPLVNLLQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLV  126

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
             PDPRIVTV LEGLENILKVGEA+K LG +   N YAQMID+ EGL+K+ENLQ+HDNNEI
Sbjct  127  SPDPRIVTVSLEGLENILKVGEAEKNLGNSGDANFYAQMIDDAEGLEKIENLQSHDNNEI  186

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFG  439
            YEKAVKILE YW +ED+E  LP G D  QQGF FG
Sbjct  187  YEKAVKILETYWLEEDDE-TLPSG-DGAQQGFQFG  219



>ref|XP_011046400.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1-like 
[Populus euphratica]
Length=529

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGG++EQI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIENGLIGPLVNLLQNAEFDIKKEAAWAVSNATSGGTHEQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTV LEGLENILKVGEA+K LG +   N YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVSLEGLENILKVGEAEKNLGNSGDANFYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP G D  QQGF FG +   VP
Sbjct  486  KAVKILETYWLEEDDE-TLPSG-DGAQQGFQFGGNDVQVP  523



>gb|KHN02923.1| Importin subunit alpha-1 [Glycine soja]
Length=530

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ ++ PLV LLQ AEFDIKKEA+WAISNATSGG+++QI++L SQGCVKPLCDLL+CP
Sbjct  366  VIEAGLVAPLVNLLQSAEFDIKKEASWAISNATSGGTHDQIKYLVSQGCVKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKSLGNTGDVNVYAQMIDEAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K VKILE YW +E++E  LP G +  Q GF FGN++  VP
Sbjct  486  KVVKILETYWLEEEDE-TLPSG-NGAQPGFNFGNNELPVP  523



>ref|XP_003550530.1| PREDICTED: importin subunit alpha-1-like [Glycine max]
Length=530

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ ++ PLV LLQ+AEFDIKKEAAWAISNATSGG +EQI++L SQGC+KPLCDLL+CP
Sbjct  366  VIEAGLVAPLVNLLQNAEFDIKKEAAWAISNATSGGIHEQIKYLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKSLGNTGDVNEYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D  Q GF FGN++  VP
Sbjct  486  KAVKILETYWLEEEDE-TLPSG-DGAQPGFNFGNNELPVP  523



>ref|NP_001141568.1| uncharacterized protein LOC100273684 [Zea mays]
 gb|ACN28186.1| unknown [Zea mays]
 gb|ACN28383.1| unknown [Zea mays]
 gb|AFW77281.1| hypothetical protein ZEAMMB73_231111 [Zea mays]
 gb|AFW77282.1| hypothetical protein ZEAMMB73_231111 [Zea mays]
Length=528

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CP
Sbjct  366  VINANIIAPLVQLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E+++  +P G D  Q GF FGN QP+VP
Sbjct  485  KAVKMLESYWLEEEDDA-MPSG-DNPQNGFNFGN-QPSVP  521



>gb|AFW81447.1| hypothetical protein ZEAMMB73_731576 [Zea mays]
 gb|AFW81448.1| hypothetical protein ZEAMMB73_731576 [Zea mays]
Length=529

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CP
Sbjct  367  VINANIIAPLVQLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEKNLGAGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E+++  +P G D  Q GF FGN QP+VP
Sbjct  486  KAVKMLESYWLEEEDDA-MPSG-DNPQNGFNFGN-QPSVP  522



>ref|XP_004977076.1| PREDICTED: importin subunit alpha-1b-like isoform X2 [Setaria 
italica]
Length=530

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+N+QI++L  QGC+KPLCDLL+CP
Sbjct  368  VINANIIAPLVHLLQTAEFDIKKEAAWAISNATSGGTNDQIKYLVGQGCIKPLCDLLVCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  D +N+YAQ+ID+ EGLDK+ENLQ+HDN EIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEAEKNLGAGD-VNVYAQLIDDAEGLDKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E+++  +P G D  Q GF FGN QP+VP
Sbjct  487  KAVKMLESYWLEEEDDA-MPSG-DNPQNGFNFGN-QPSVP  523



>ref|XP_010259399.1| PREDICTED: importin subunit alpha-1 [Nelumbo nucifera]
Length=529

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L SQGC+KPLCDLL+CP
Sbjct  365  VIEANIIGPLVQLLQTAEFDIKKEAAWAISNATSGGNHDQIKYLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ+ID+ EGL+K+ENLQ HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGNTGGVNLYAQLIDDAEGLEKIENLQNHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D +Q GF FG ++  VP
Sbjct  485  KAVKILETYWMEEEDE-TLPPG-DASQPGFRFGGNELPVP  522



>gb|EPS72677.1| impa2, partial [Genlisea aurea]
Length=211

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 4/165 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI+S II PLV LLQ AEF+IKKEAAWAISNATSGGS EQI+FL  QGC+KPLCDLL+
Sbjct  42   QAVIDSGIISPLVSLLQTAEFEIKKEAAWAISNATSGGSQEQIKFLVEQGCIKPLCDLLV  101

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGE++K  G +  +N++AQ++DE EGLDK+E LQ+HDNNEI
Sbjct  102  CPDPRIVTVCLEGLENILKVGESEKNQGNSGNVNVFAQLVDEAEGLDKIETLQSHDNNEI  161

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQ--GFTFGNSQPN-VP  418
            YEKAVKILE YW ++D+E  L  G D  QQ  GF FG    N VP
Sbjct  162  YEKAVKILEAYWLEDDDE-QLAAGDDNVQQQSGFNFGGGDDNGVP  205



>dbj|BAE71209.1| putative importin alpha [Trifolium pratense]
Length=533

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE  I  PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L SQGC+KPLCDLLICP
Sbjct  367  VIEGNIFGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK +G    +N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEADKNIGNTGDVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +E++E  +P G +  Q GF FG ++ P+VP
Sbjct  487  KAVKILETYWLEEEDE-TMPPG-EAAQSGFNFGGAEVPSVP  525



>gb|AES65063.2| importin subunit alpha-1b [Medicago truncatula]
Length=530

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  366  VIEAGLIAPLVNLLQNAEFDIKKEAAWALSNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEA+K  G    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKIGEAEKSFGNAGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  EDE+  LP G D +Q GF FG +   VP
Sbjct  486  KAVKILETYWL-EDEDETLPPG-DGSQPGFNFGGNDLPVP  523



>ref|XP_008458386.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
 ref|XP_008458387.1| PREDICTED: importin subunit alpha-1-like [Cucumis melo]
Length=530

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  365  VIEAGLIPPLVNLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG N  +N+YAQMID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGTNGDVNLYAQMIDDAEGLEKIENLQSHDNHEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP      Q GF FG ++  VP
Sbjct  485  KAVKILETYWLEEEDEA-LPTTDGGAQPGFRFGGNELPVP  523



>ref|XP_010094336.1| Importin subunit alpha-1 [Morus notabilis]
 gb|EXB55756.1| Importin subunit alpha-1 [Morus notabilis]
Length=529

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWAISNATSGG+NEQI++L SQ C+KPLCDLL+CP
Sbjct  365  VIEAGLIGPLVNLLQNAEFDIKKEAAWAISNATSGGTNEQIKYLVSQQCIKPLCDLLLCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N+YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGNSGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K VKILE YW +ED+E  LP G D +Q GF FG +   VP
Sbjct  485  KTVKILETYWLEEDDE-TLPPG-DGSQSGFRFGGNDLPVP  522



>emb|CDP17235.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIES I+ PL+ LLQ+ EF+IKKEAAWAISNATSGGS+EQI++L SQ C+KPLCDLL+CP
Sbjct  364  VIESGIMSPLIDLLQNGEFEIKKEAAWAISNATSGGSHEQIKYLVSQACIKPLCDLLVCP  423

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIV+VCLEGLENILKVGEA+K LG+   +N+YAQMID+ EGL+K+ENLQ+HDNN+IYE
Sbjct  424  DPRIVSVCLEGLENILKVGEAEKNLGITGDVNLYAQMIDDAEGLEKIENLQSHDNNDIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED++  +P G D +QQ F  G SQ +VP
Sbjct  484  KAVKILETYWLEEDDD-TMPPG-DASQQSFQLGGSQISVP  521



>ref|XP_002440631.1| hypothetical protein SORBIDRAFT_09g004320 [Sorghum bicolor]
 gb|EES19061.1| hypothetical protein SORBIDRAFT_09g004320 [Sorghum bicolor]
Length=530

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL+CP
Sbjct  368  VINANIIAPLVQLLQTAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLVCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  D +N+YAQMID+ EGLDK+ENLQ+HDN EIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEAEKNLGGGD-VNVYAQMIDDAEGLDKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +E+++  +P G D  Q GF FGN QP+VP
Sbjct  487  KAVKMLESYWLEEEDDA-MPSG-DNPQNGFNFGN-QPSVP  523



>ref|XP_003594812.1| Importin subunit alpha-1 [Medicago truncatula]
Length=561

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  397  VIEAGLIAPLVNLLQNAEFDIKKEAAWALSNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  456

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEA+K  G    +N+YAQMIDE EGL+K+ENLQ+HDNNEIYE
Sbjct  457  DPRIVTVCLEGLENILKIGEAEKSFGNAGDVNLYAQMIDEAEGLEKIENLQSHDNNEIYE  516

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  EDE+  LP G D +Q GF FG +   VP
Sbjct  517  KAVKILETYW-LEDEDETLPPG-DGSQPGFNFGGNDLPVP  554



>gb|KHG15238.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=534

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VIEAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW ++++EP LP G D  Q G  FG +Q  VP
Sbjct  490  KAVKILETYWVEDEDEP-LPLG-DAAQSGLQFGGNQLPVP  527



>ref|XP_010268071.1| PREDICTED: importin subunit alpha-1-like [Nelumbo nucifera]
Length=529

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI+++II PLV LL  AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLCDLL+CP
Sbjct  365  VIDAQIIGPLVQLLHTAEFDIKKEAAWAISNATSGGSHDQIKYLVNQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE++K LG   G+N+YAQ+IDE EGLDK+ENLQ HDN+EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGESEKNLGNTGGVNVYAQLIDEAEGLDKIENLQIHDNSEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E +E   P   D +Q GF FG S+  VP
Sbjct  485  KAVKILETYWLEEQDEILAP--ADASQPGFQFGGSELQVP  522



>gb|KHG28859.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=534

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + I  PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VISAGIFAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGVAEKNLGHTREVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++EP LP G D +Q GF FG +Q  VP
Sbjct  490  KAVKILETYWVEEEDEP-LPPG-DASQSGFQFGGNQLPVP  527



>gb|KJB24392.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=534

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + I  PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VISAGIFAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGVAEKNLGHTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++EP LP G D +Q GF FG +Q  VP
Sbjct  490  KAVKILETYWVEEEDEP-LPPG-DASQSGFQFGGNQLPVP  527



>gb|KJB24393.1| hypothetical protein B456_004G143100 [Gossypium raimondii]
Length=535

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + I  PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  371  VISAGIFAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  430

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  431  DPRIVTVCLEGLENILKVGVAEKNLGHTGEVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  490

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++EP LP G D +Q GF FG +Q  VP
Sbjct  491  KAVKILETYWVEEEDEP-LPPG-DASQSGFQFGGNQLPVP  528



>ref|XP_010231685.1| PREDICTED: importin subunit alpha-1b [Brachypodium distachyon]
Length=532

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLLICP
Sbjct  369  VINANIIGPLVHLLQGAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLICP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  429  DPRIVTVCLEGLENILKVGEAEKNLGAGD-VNTYAQMIDDAEGLEKIENLQSHDNTEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +ED+E  +P G +  Q GF FGN Q +VP
Sbjct  488  KAVKMLESYWLEEDDEA-MPTG-ENPQNGFNFGNQQNSVP  525



>gb|KJB49857.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
 gb|KJB49858.1| hypothetical protein B456_008G142000 [Gossypium raimondii]
Length=534

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VIKAGIIAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGEAEKNLGHTGDVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW ++++EP LP G D  Q G  FG +Q  VP
Sbjct  490  KAVKILETYWVEDEDEP-LPPG-DAAQSGLQFGGNQLPVP  527



>ref|XP_007163337.1| hypothetical protein PHAVU_001G226400g [Phaseolus vulgaris]
 gb|ESW35331.1| hypothetical protein PHAVU_001G226400g [Phaseolus vulgaris]
Length=531

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 136/161 (84%), Gaps = 4/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQ++FL SQGC+KPLCDLLICP
Sbjct  367  VIDAGLIAPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQVKFLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE++K +   DG+N+Y  MID+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGESEKNVSNADGVNLYGAMIDDVEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +ED+E  +P G  +  QGF FG  + P+VP
Sbjct  487  KAVKILETYWMEEDDE-TVPPG--DASQGFNFGGHKFPSVP  524



>ref|NP_001234006.1| importin subunit alpha [Solanum lycopersicum]
 sp|O22478.2|IMA_SOLLC RecName: Full=Importin subunit alpha; AltName: Full=Karyopherin 
subunit alpha; Short=KAP alpha [Solanum lycopersicum]
 gb|AAC23722.1| importin alpha [Solanum lycopersicum]
Length=527

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 135/160 (84%), Gaps = 5/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIEAGIIAPLVYLLQNAEFEIKKEAAWAISNATSGGNHDQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++ P     V  N+  F FG +  ++P
Sbjct  486  KAVKILETYWLEEEDVP-----VSLNEDQFEFGGADISLP  520



>gb|KHG28860.1| Importin subunit alpha-1 [Gossypium arboreum]
Length=557

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + I  PLV LLQ+AEF+IKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL CP
Sbjct  370  VISAGIFAPLVHLLQNAEFEIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLNCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVG A+K LG    +N+YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGVAEKNLGHTREVNLYAQLIDDAEGLEKIENLQSHDNNEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++EP LP G D +Q GF FG +Q  VP
Sbjct  490  KAVKILETYWVEEEDEP-LPPG-DASQSGFQFGGNQLPVP  527



>ref|XP_008453860.1| PREDICTED: importin subunit alpha-1 [Cucumis melo]
Length=529

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = -1

Query  915  KIK*RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLC  736
            K + + VI++ I+ PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLC
Sbjct  359  KAQIQAVIDANIVAPLVHLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVNQGCIKPLC  418

Query  735  DLLICPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHD  556
            DLLICPDPRIVTVCLEGLENILKVGEA+K      G+N+YAQ+ID+ EGL+K+ENLQ+HD
Sbjct  419  DLLICPDPRIVTVCLEGLENILKVGEAEKNTTDTGGVNLYAQLIDDAEGLEKIENLQSHD  478

Query  555  NNEIYEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            N EIYEKAVKILE YW +E++E  +P G    Q GF FG  +P VP
Sbjct  479  NTEIYEKAVKILETYWLEEEDE-TMPPGTAP-QGGFNFGGDRPVVP  522



>ref|XP_009393195.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=530

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L SQGCVKPLCDLL+CP
Sbjct  366  VIAAGIIGPLVHLLQTAEFDIKKEAAWAISNATSGGNHDQIKYLVSQGCVKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG +  +N+YAQMI+E EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGASGDVNLYAQMIEEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNV  421
            KAVKILE YW +ED+   +P G D  Q GF FGN+  N 
Sbjct  486  KAVKILETYWLEEDDA--MPTG-DAAQTGFHFGNNGQNT  521



>ref|XP_009369966.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 135/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQHAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CP
Sbjct  365  VIEAGLIGPLVNLLQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K +G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKAVG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K+VKILE YW +EDEE  LP G D  Q GF FG S+  VP
Sbjct  484  KSVKILETYWLEEDEE-TLPAG-DGTQPGFRFGGSEVQVP  521



>ref|XP_008345591.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-1-like 
[Malus domestica]
Length=524

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            R V+E+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+
Sbjct  357  RAVVEANIISPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLV  416

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EI
Sbjct  417  CPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEI  476

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            YEKAVK+LE YW ++D+E  +P G D     F F GN  P VP
Sbjct  477  YEKAVKMLETYWLEDDDE-TMPPG-DAAPAAFNFGGNDVPTVP  517



>ref|XP_009373267.1| PREDICTED: importin subunit alpha-1b [Pyrus x bretschneideri]
Length=530

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            R V+E+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+
Sbjct  363  RAVVEANIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLV  422

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EI
Sbjct  423  CPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEI  482

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            YEKAVK+LE YW ++D+E  +P G D     F F GN  P+VP
Sbjct  483  YEKAVKMLETYWLEDDDE-TMPPG-DAASTAFNFGGNDVPSVP  523



>ref|XP_010024115.1| PREDICTED: importin subunit alpha-1a [Eucalyptus grandis]
 gb|KCW60545.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
 gb|KCW60546.1| hypothetical protein EUGRSUZ_H03281 [Eucalyptus grandis]
Length=531

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL  QGC+KPLCDLLICP
Sbjct  366  VIEANIIAPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVCQGCIKPLCDLLICP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGGTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            KAVK+LE YW +E++E   P+  D    G  F GN  P VP
Sbjct  486  KAVKLLETYWLEEEDEAMPPE--DSAHPGVPFGGNELPPVP  524



>ref|XP_004295110.1| PREDICTED: importin subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEF+IKKEAAWAISNATSGG++EQI+ L ++GC+KPL DLL+CP
Sbjct  365  VIEAGLIGPLVNLLQTAEFEIKKEAAWAISNATSGGTHEQIKVLVTEGCIKPLSDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG N G N+YAQ+IDE +GL+K+ENLQTHDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLG-NSGTNLYAQLIDEADGLEKIENLQTHDNNEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  EDE+  LP G D  Q GF FG + P VP
Sbjct  484  KAVKILETYW-LEDEDETLPAG-DAAQPGFNFGGNGPQVP  521



>ref|XP_008360253.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Malus domestica]
Length=485

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  894  IESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPD  715
            IE+ +I PLV LLQHAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CPD
Sbjct  323  IEAGLIGPLVNLLQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPD  382

Query  714  PRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEK  535
            PRIVTVCLEGLENILKVGEA+K  G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYEK
Sbjct  383  PRIVTVCLEGLENILKVGEAEKAAG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEK  441

Query  534  AVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            +VKILE YW +EDEE  LP G D +Q GF FG S+  VP
Sbjct  442  SVKILETYWLEEDEE-TLPAG-DGSQPGFRFGGSEVQVP  478



>ref|XP_006407910.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
 gb|ESQ49363.1| hypothetical protein EUTSA_v10020480mg [Eutrema salsugineum]
Length=536

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI +L  QGC+KPLCDLLICP
Sbjct  369  VVEANLIPPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIIYLVEQGCIKPLCDLLICP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGE++K LG     N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  429  DPRIITVCLEGLENILKVGESEKTLGNTGETNYYAQLIDDAEGLEKIENLQSHDNNEIYE  488

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  +EDEE     G D +Q GF FG +Q +VP
Sbjct  489  KAVKILETYWLEEEDEETQQAPGGDGSQAGFQFGGNQASVP  529



>ref|XP_009412111.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412112.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412113.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI+++  QGC+KPLCDLL+CP
Sbjct  366  VIAAGIIAPLVHLLQTAEFDIKKEAAWAISNATSGGTHDQIKYIVGQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEA+K LG    +N YAQ+IDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKIGEAEKNLGATGAVNSYAQLIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS-QPNVP  418
            KAVKILE YW +E+++  +P G D  Q GF FGNS Q  VP
Sbjct  486  KAVKILETYWMEEEDDA-MPTG-DAAQTGFQFGNSGQNTVP  524



>ref|XP_001760522.1| predicted protein [Physcomitrella patens]
 gb|EDQ74597.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 128/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LL  AEFDIKKEAAWAISNATSGGS EQI++L +QGC+KPLCDLL CP
Sbjct  367  VIDANIIPPLVSLLATAEFDIKKEAAWAISNATSGGSPEQIKYLVTQGCIKPLCDLLTCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTV LEGLENILKVGE +K LG + GIN+YA+ IDE EGL+K+ENLQTHDNNEIYE
Sbjct  427  DPRIVTVSLEGLENILKVGEQEKDLGNSGGINLYARYIDEAEGLEKIENLQTHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS  433
            KAVKILE YW +EDE+ N   G +   QGF FG S
Sbjct  487  KAVKILETYWLEEDEDQNFAPGTE--GQGFAFGTS  519



>gb|AII99829.1| importin alpha [Nicotiana tabacum]
Length=528

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIEAGLIAPLVNLLQTAEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEK--ANTGGINFYAQLTDDAEGLEKIENLQSHDNNEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G DE Q GF FG +   +P
Sbjct  484  KAVKILETYWLEEEDE-TLPAG-DETQAGFNFGGNDIQLP  521



>ref|XP_009631847.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana tomentosiformis]
Length=529

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CP
Sbjct  367  VIEAGLIAPLVNLLQTAEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G DE Q GF FG +   +P
Sbjct  485  KAVKILETYWLEEEDE-TLPAG-DETQAGFNFGGNDIQLP  522



>ref|XP_009338212.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=530

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            R V+E+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+
Sbjct  363  RAVVEANIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLV  422

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EI
Sbjct  423  CPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEI  482

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            YEKAVK+LE YW ++D+E  +P G D     F F GN  P VP
Sbjct  483  YEKAVKMLETYWLEDDDE-TMPPG-DAAPAAFNFVGNDVPTVP  523



>gb|KDO87079.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=431

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + +IE+ II PLV LL +AEF+IKKEAAWAISNATSGGSNEQI+FL SQGC+KPLCDLL 
Sbjct  264  QAIIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGSNEQIKFLVSQGCIKPLCDLLN  323

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILK GEA+K +G   G+N++AQ ID+ EGL+K+ENLQ+HDN EI
Sbjct  324  CPDPRIVTVCLEGLENILKAGEAEKNMGNTGGVNLFAQAIDDAEGLEKIENLQSHDNTEI  383

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            YEKAVKILE YW +EDE+  LP G D  Q GF F  +   VP 
Sbjct  384  YEKAVKILETYWVEEDEDEPLPPG-DATQAGFGFAGNGLPVPS  425



>ref|XP_009796163.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana sylvestris]
Length=528

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIEAGLIAPLVNLLQTAEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G DE Q GF FG +   +P
Sbjct  484  KAVKILETYWLEEEDE-TLPAG-DETQAGFNFGGNDIQLP  521



>gb|EYU46779.1| hypothetical protein MIMGU_mgv1a0058492mg, partial [Erythranthe 
guttata]
Length=364

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VIE+ II PLV LLQ AEF+IKKEAAWA+SNATSGG+N+QI+FL  +GC+KPLCDLL+
Sbjct  198  QAVIEAGIIAPLVALLQTAEFEIKKEAAWALSNATSGGTNDQIKFLVREGCIKPLCDLLV  257

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTV LEGLENILKVGEADK  G    +N++AQMID+ EGL+K+ENLQ+HDNNEI
Sbjct  258  CPDPRIVTVSLEGLENILKVGEADKSQGNTGDVNVFAQMIDDAEGLEKIENLQSHDNNEI  317

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YEKAVKILE YW +ED+   L  G D +Q GF FG S   VP
Sbjct  318  YEKAVKILETYWLEEDDG-ELASG-DASQSGFNFGGSDLPVP  357



>ref|XP_011092122.1| PREDICTED: importin subunit alpha-1 [Sesamum indicum]
Length=530

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFD+KKEAAWAISNATSGG++EQI++L SQ C+KPLCDLL+CP
Sbjct  366  VIEANIIGPLVQLLQNAEFDVKKEAAWAISNATSGGTHEQIKYLVSQQCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+Y QMI++ EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNLGRTGDVNLYGQMIEDAEGLEKIENLQSHDNIEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFG  439
            KAVKILE YW +ED+EP  P G    QQGF FG
Sbjct  486  KAVKILETYWLEEDDEPA-PPGDASQQQGFQFG  517



>ref|XP_008388495.1| PREDICTED: importin subunit alpha-1b-like [Malus domestica]
Length=530

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            R V+E+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL SQGC+KPLCDLL+
Sbjct  363  RAVVEANIIGPLVNLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVSQGCIKPLCDLLV  422

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG   G+N+YAQ I++ +GL+K+E+LQ+HDN EI
Sbjct  423  CPDPRIVTVCLEGLENILKVGEAEKNLGTTGGVNLYAQAIEDADGLEKIESLQSHDNTEI  482

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            YEKAVK+LE YW ++D+E  +P G D     F F GN  P VP
Sbjct  483  YEKAVKMLETYWLEDDDE-TMPPG-DAAPTTFNFGGNDVPTVP  523



>ref|XP_008781168.1| PREDICTED: importin subunit alpha-like isoform X2 [Phoenix dactylifera]
Length=536

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGS+EQI +L SQGC+KPLCDLL+ P
Sbjct  369  VIDANIIGPLVQLLQHAEFDIKKEAAWAISNATSGGSDEQIHYLVSQGCIKPLCDLLVSP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIV VCLEGLENILKVGE +K+LG  DGIN+YAQ+I +CEGLDK+ENLQ H NNEIYE
Sbjct  429  DPRIVIVCLEGLENILKVGETEKELGKTDGINLYAQLIYDCEGLDKIENLQGHGNNEIYE  488

Query  537  KAVKILEKYWGDEDEEPNLPDG-VDENQQGFTFGNSQPNVP  418
            K +K+LE+YW +E++E     G ++  +  F FG S+ ++P
Sbjct  489  KTIKMLERYWLEEEDEAQSARGSLEGTEHAFEFGVSKSSLP  529



>gb|EMT29219.1| Importin subunit alpha-1b [Aegilops tauschii]
Length=537

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI++ II PLV LLQ AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLLI
Sbjct  227  QAVIQANIIGPLVHLLQGAEFDIKKEAAWAISNATSGGTHDQIKYLVAQGCIKPLCDLLI  286

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG  D +N YAQMID+ EGL+K+ENLQ+HDN EI
Sbjct  287  CPDPRIVTVCLEGLENILKVGEAEKNLGAGD-VNNYAQMIDDAEGLEKIENLQSHDNTEI  345

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            YEKAVK+LE YW +E++E  +P G D  Q GF FG+ Q +VP 
Sbjct  346  YEKAVKMLESYWLEEEDEV-MPSG-DNAQNGFNFGSQQNSVPS  386



>gb|ABM05488.1| Impa2 [Nicotiana benthamiana]
Length=529

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI+FL SQGC+KPLCDLL+CP
Sbjct  367  VIEAGLIAPLVNLLQTAEFDIKKEAAWAISNATSGGTHEQIKFLVSQGCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G DE Q GF FG +   +P
Sbjct  485  KAVKILETYWLEEEDE-TLPAG-DEAQAGFNFGGNDIQLP  522



>ref|XP_007031098.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
 gb|EOY11600.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 1 [Theobroma 
cacao]
Length=599

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL CP
Sbjct  365  VIEANIIAPLVHLLQNAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK  G   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNQGNTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFG  439
            KAVK+LE YW +E++E  +P G D +Q GF FG
Sbjct  485  KAVKVLETYWLEEEDE-TMPPG-DASQTGFQFG  515



>emb|CDO98799.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+++I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  364  VIEAQLIGPLVNLLQTAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  423

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+ VCLEGLENILKVGE +K LG +  +N YAQ++DE EGL+K+ENLQ+HDNNEIYE
Sbjct  424  DPRIIAVCLEGLENILKVGEVEKSLGNSGDVNFYAQLVDEAEGLEKIENLQSHDNNEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D  Q GF FG +   +P
Sbjct  484  KAVKILETYWLEEEDE-TLPAG-DGGQPGFNFGGNDMQLP  521



>ref|XP_002282816.1| PREDICTED: importin subunit alpha-1 [Vitis vinifera]
 emb|CBI39567.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 2/153 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGGS+EQI++L SQ  +KPLCDLL+CP
Sbjct  365  VIEANIIGPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIKYLVSQASIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGSTREVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFG  439
            KAVKILE YW +E++E  +P G D +Q GF FG
Sbjct  485  KAVKILETYWLEEEDE-TMPPG-DSSQPGFRFG  515



>ref|XP_002274422.1| PREDICTED: importin subunit alpha [Vitis vinifera]
 emb|CAN75951.1| hypothetical protein VITISV_028605 [Vitis vinifera]
 emb|CBI36918.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 4/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PL+ LLQ+AEF+IKKEAAWAISNATSGG+++QI+ L SQGC+KPLCDLLICP
Sbjct  365  VIEAGIIPPLIYLLQNAEFEIKKEAAWAISNATSGGTHDQIKLLVSQGCIKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK LG  D +N +AQ ID+ +GL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKSLGHTD-VNQFAQAIDDADGLEKIENLQSHDNTEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            KAVKILE YW +EDEEP LP G D +Q  F F GN  P VP
Sbjct  484  KAVKILETYWLEEDEEP-LPPG-DASQSEFHFGGNDHPPVP  522



>ref|XP_006480039.1| PREDICTED: importin subunit alpha-like [Citrus sinensis]
 gb|KDO87073.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
 gb|KDO87074.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=529

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            +IE+ II PLV LL +AEF+IKKEAAWAISNATSGGSNEQI+FL SQGC+KPLCDLL CP
Sbjct  364  IIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCP  423

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK GEA+K +G   G+N++AQ ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  424  DPRIVTVCLEGLENILKAGEAEKNMGNTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQP  427
            KAVKILE YW +EDE+  LP G D  Q GF F GN  P
Sbjct  484  KAVKILETYWVEEDEDEPLPPG-DATQAGFGFAGNGLP  520



>ref|XP_010548966.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=524

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ++EFDIKKEAAWAISNATSGGS+EQI++L  QGC+KPLCDLL+CP
Sbjct  360  VIEAGLIGPLVNLLQNSEFDIKKEAAWAISNATSGGSHEQIKYLVEQGCIKPLCDLLVCP  419

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K +G    +N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  420  DPRIITVCLEGLENILKVGEAEKTMGNTGDVNYYAQLIDDAEGLEKIENLQSHDNNEIYE  479

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E + P   D + QGF FG ++  +P
Sbjct  480  KAVKILETYWLEEEDEASPPG--DGSAQGFQFGGNEAPLP  517



>ref|XP_007154341.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
 gb|ESW26335.1| hypothetical protein PHAVU_003G110500g [Phaseolus vulgaris]
Length=529

 Score =   228 bits (580),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ ++ PLV LLQ+AEFDIKKEAAWA+SNATSGG+++QI++L +QGC+KPLCDLL+CP
Sbjct  366  VIEAGLVAPLVNLLQNAEFDIKKEAAWAVSNATSGGTHDQIKYLVAQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKSLGNTGDVNLYAQMIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQP  427
            KAVKILE YW  EDE+  LP G +  Q  F FG+  P
Sbjct  486  KAVKILETYWL-EDEDETLPSG-EGAQPDFAFGSELP  520



>ref|XP_002515324.1| importin alpha, putative [Ricinus communis]
 gb|EEF47308.1| importin alpha, putative [Ricinus communis]
Length=454

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + +I++ +I PL+ LLQ AEF+IKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLLI
Sbjct  287  QAIIDADLIGPLIQLLQIAEFEIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLI  346

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVGEA+K LG     N+YAQMIDE EGL+K+ENLQ+HDNN+I
Sbjct  347  CPDPRIVTVCLEGLENILKVGEAEKNLGNTGDANLYAQMIDEAEGLEKIENLQSHDNNDI  406

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YEKAVKILE YW +EDE+  L    D +Q GF FG ++   P
Sbjct  407  YEKAVKILETYWLEEDEDEALAPA-DASQSGFHFGGNEVPAP  447



>ref|XP_008360251.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Malus domestica]
Length=528

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  894  IESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICPD  715
            IE+ +I PLV LLQHAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CPD
Sbjct  366  IEAGLIGPLVNLLQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCPD  425

Query  714  PRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYEK  535
            PRIVTVCLEGLENILKVGEA+K  G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYEK
Sbjct  426  PRIVTVCLEGLENILKVGEAEKAAG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYEK  484

Query  534  AVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            +VKILE YW +EDEE  LP G D +Q GF FG S+  VP
Sbjct  485  SVKILETYWLEEDEE-TLPAG-DGSQPGFRFGGSEVQVP  521



>emb|CDO98800.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   227 bits (579),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+++I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  366  VIEAQLIGPLVNLLQTAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+ VCLEGLENILKVGE +K LG +  +N YAQ+IDE EGL+K+E+LQ+HDNNEIYE
Sbjct  426  DPRIIAVCLEGLENILKVGEVEKSLGHSGDVNFYAQLIDEAEGLEKIEHLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D  Q GF FG +   +P
Sbjct  486  KAVKILETYWLEEEDE-TLPAG-DGGQPGFNFGGNDMQLP  523



>ref|XP_009414157.1| PREDICTED: importin subunit alpha-1a-like [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQHAEFDIKKEAAWAISNATSG SNEQI +LASQGC+KPLCDLL+CP
Sbjct  370  VIDANIISPLVHLLQHAEFDIKKEAAWAISNATSGSSNEQIHYLASQGCIKPLCDLLVCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE +K LG   G+N YAQ+IDECEGLDK+ENLQ HDNNEIYE
Sbjct  430  DPRIVTVCLEGLENILKVGEIEKDLG-KCGVNPYAQLIDECEGLDKIENLQGHDNNEIYE  488

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFT-FGNSQPNVP  418
            K +K+LE+YW +E++E     G  E  +  +    SQP+VP
Sbjct  489  KTIKLLERYWVEEEDEAQDALGSTEGAEHSSEVAISQPSVP  529



>ref|XP_008781167.1| PREDICTED: importin subunit alpha-like isoform X1 [Phoenix dactylifera]
Length=567

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI++ II PLV LLQHAEFDIKKEAAWAISNATSGGS+EQI +L SQGC+KPLCDLL+
Sbjct  398  QAVIDANIIGPLVQLLQHAEFDIKKEAAWAISNATSGGSDEQIHYLVSQGCIKPLCDLLV  457

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
             PDPRIV VCLEGLENILKVGE +K+LG  DGIN+YAQ+I +CEGLDK+ENLQ H NNEI
Sbjct  458  SPDPRIVIVCLEGLENILKVGETEKELGKTDGINLYAQLIYDCEGLDKIENLQGHGNNEI  517

Query  543  YEKAVKILEKYWGDEDEEPNLPDG-VDENQQGFTFGNSQPNVP  418
            YEK +K+LE+YW +E++E     G ++  +  F FG S+ ++P
Sbjct  518  YEKTIKMLERYWLEEEDEAQSARGSLEGTEHAFEFGVSKSSLP  560



>gb|KDO87077.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
 gb|KDO87078.1| hypothetical protein CISIN_1g009679mg [Citrus sinensis]
Length=488

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            +IE+ II PLV LL +AEF+IKKEAAWAISNATSGGSNEQI+FL SQGC+KPLCDLL CP
Sbjct  323  IIEAGIIGPLVNLLLNAEFEIKKEAAWAISNATSGGSNEQIKFLVSQGCIKPLCDLLNCP  382

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK GEA+K +G   G+N++AQ ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  383  DPRIVTVCLEGLENILKAGEAEKNMGNTGGVNLFAQAIDDAEGLEKIENLQSHDNTEIYE  442

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVPE  415
            KAVKILE YW +EDE+  LP G D  Q GF F  +   VP 
Sbjct  443  KAVKILETYWVEEDEDEPLPPG-DATQAGFGFAGNGLPVPS  482



>ref|XP_001773629.1| predicted protein [Physcomitrella patens]
 gb|EDQ61517.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LL  AEFDIKKEAAWAISNATSGGS++QI++L +QGC+KPLCDLL CP
Sbjct  367  VIDANIIPPLVSLLATAEFDIKKEAAWAISNATSGGSHDQIKYLVTQGCIKPLCDLLTCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTV LEGLENILKVGE +K LG + GIN+YA+ IDE EGL+K+ENLQTHDNNEIYE
Sbjct  427  DPRIVTVSLEGLENILKVGEQEKDLGQSGGINLYARYIDEAEGLEKIENLQTHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS  433
            KAVKILE YW +EDE+ N   G +   Q F FG+S
Sbjct  487  KAVKILETYWLEEDEDSNAAPGTE--GQTFAFGSS  519



>ref|XP_009347771.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009347772.1| PREDICTED: importin subunit alpha-1-like [Pyrus x bretschneideri]
Length=528

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQHAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CP
Sbjct  365  VIEAGLIGPLVNLLQHAEFDIKKEAAWAISNATSGGTPDQIKYLVGEGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K  G N  +N+YAQ++D+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKAAG-NSEVNLYAQLVDDAEGLEKIENLQSHDNTEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K+VKILE YW +EDEE  LP G D  Q G  FG S+  VP
Sbjct  484  KSVKILETYWLEEDEE-TLPAG-DGTQPGLRFGGSEVQVP  521



>ref|XP_001763761.1| predicted protein [Physcomitrella patens]
 gb|EDQ71403.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LL  AEFDIKKEAAWA+SNATSGG++EQI+ L +QGC+KPLCDLL CP
Sbjct  366  VIDANIIPPLVSLLASAEFDIKKEAAWAVSNATSGGTSEQIKHLVNQGCIKPLCDLLTCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTV LEGLENILKVGE DK  G N+G+NIYA+ IDE EGL+K+ENLQTHDNNEIYE
Sbjct  426  DPRIVTVSLEGLENILKVGEQDKDSGNNNGVNIYARYIDEAEGLEKIENLQTHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS  433
            KAVKILE YW +EDE+ N+  G +   Q F FG+S
Sbjct  486  KAVKILETYWLEEDEDQNVAPGTE--GQNFAFGSS  518



>ref|XP_007222489.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
 gb|EMJ23688.1| hypothetical protein PRUPE_ppa004118mg [Prunus persica]
Length=529

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ +I PLV LLQ+AEFDIKKEAAWAISNATSGG+ EQI++L  +GC+KPLCDLL+CP
Sbjct  365  VIDASLIGPLVNLLQNAEFDIKKEAAWAISNATSGGTPEQIKYLVGEGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K  G    +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNAGNTGEVNLYAQLIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP G D +Q GF FG ++  VP
Sbjct  485  KAVKILETYWVEEDDE-TLPSG-DGSQPGFHFGGNELQVP  522



>ref|XP_009612538.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana tomentosiformis]
Length=528

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +  PLV LLQ+AEFDIKKEAAWAISNATSGG+NEQI++L SQGC+KPLCDLL+CP
Sbjct  365  VIEAGVFGPLVNLLQNAEFDIKKEAAWAISNATSGGTNEQIKYLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVG+ +  LG    IN+YAQMID+ EG++K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGDVE-NLGEAGNINVYAQMIDDAEGIEKIENLQSHDNQEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D  QQGF FG    +VP
Sbjct  484  KAVKILETYWLEEDDE-TMPPG-DAPQQGFQFGGGNVSVP  521



>ref|XP_001778004.1| predicted protein [Physcomitrella patens]
 gb|EDQ57217.1| predicted protein [Physcomitrella patens]
Length=534

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LL  AEFDIKKEAAWAISNATSGG+++QI++L +QGC+KPLCDLL CP
Sbjct  369  VIDANIIPPLVSLLATAEFDIKKEAAWAISNATSGGTHDQIKYLVNQGCIKPLCDLLTCP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTV LEGLENILKVGE +K LG   GIN YA+ IDE EGL+K+ENLQTHDNNEIYE
Sbjct  429  DPRIVTVSLEGLENILKVGEQEKDLGKTGGINEYARYIDEAEGLEKIENLQTHDNNEIYE  488

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNS  433
            KAVKILE YW +EDEE N   G D   Q F FG+S
Sbjct  489  KAVKILETYWLEEDEEQNTAPGTD--GQSFAFGSS  521



>gb|KHG14170.1| Importin subunit alpha-1 -like protein [Gossypium arboreum]
Length=385

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL CP
Sbjct  211  VINAGIIGPLVSLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSQGCIKPLCDLLACP  270

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K +G  +  N  AQ+I++ EGL+K+ENLQ+HDNNEIYE
Sbjct  271  DPRIITVCLEGLENILKVGEAEKAVGAGE-FNYCAQLIEDAEGLEKIENLQSHDNNEIYE  329

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +EDEE  LP G D  QQ F FG +   VP
Sbjct  330  KAVKILETYWLEEDEE-TLPPG-DGTQQSFYFGGNDVKVP  367



>ref|XP_011079596.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG+++QI+FL  +GC+KPLCDLL+CP
Sbjct  365  VIEAGIISPLVVLLQNAEFEIKKEAAWAISNATSGGTSDQIKFLVREGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K  G    +N+YAQMID  EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNQGNTGDVNVYAQMIDSAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  L  G D  Q GF FG     VP
Sbjct  485  KAVKILETYWLEEEDE-QLVSG-DAPQSGFNFGGGDLPVP  522



>ref|XP_008223291.1| PREDICTED: importin subunit alpha-1-like [Prunus mume]
Length=529

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ +I PLV LLQ+AEFDIKKEAAWAISNATSGG+ EQI++L  +GC+KPLCDLL+CP
Sbjct  365  VIDASLIGPLVNLLQNAEFDIKKEAAWAISNATSGGTPEQIKYLVGEGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K  G    +N++AQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNAGNTGEVNLFAQLIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  LP G D +Q GF FG ++  VP
Sbjct  485  KAVKILETYWVEEDDE-TLPSG-DGSQPGFHFGGNELQVP  522



>ref|XP_010043209.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 ref|XP_010043210.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 ref|XP_010043211.1| PREDICTED: importin subunit alpha-1a-like [Eucalyptus grandis]
 gb|KCW85236.1| hypothetical protein EUGRSUZ_B02080 [Eucalyptus grandis]
 gb|KCW85237.1| hypothetical protein EUGRSUZ_B02080 [Eucalyptus grandis]
Length=530

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 136/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ II P+V LLQ+AEFDIKKEAAWAISNATSGGS+EQI+FL +QGCVKPLCDLLICP
Sbjct  365  VVEADIIGPMVQLLQNAEFDIKKEAAWAISNATSGGSHEQIKFLVNQGCVKPLCDLLICP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N+YAQM+++ EGL+K+E+LQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGNTGDVNVYAQMVEDVEGLEKIESLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTF-GNSQPNVP  418
            KAVKILE YW +ED++  +P G D  Q    F GN+ P +P
Sbjct  485  KAVKILEAYWLEEDDDA-MPPG-DAPQPDMQFGGNNLPPMP  523



>ref|XP_011082432.1| PREDICTED: importin subunit alpha-like [Sesamum indicum]
Length=529

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAWAISNATSGG+N+QI+ L  +GC+KPLCDLL+CP
Sbjct  365  VIEAGIISPLVVLLQNAEFEIKKEAAWAISNATSGGTNDQIKLLVREGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K  G    +N++AQMID+ +GL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNQGNTGDVNVFAQMIDDAQGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +ED+E  L  G D  Q GF FG     VP
Sbjct  485  KAVKVLETYWLEEDDE-QLVSG-DTQQSGFNFGGGDLPVP  522



>ref|XP_010546997.1| PREDICTED: importin subunit alpha-1 [Tarenaya hassleriana]
Length=535

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ ++ PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI+++  QGCVKPLCDLL+CP
Sbjct  369  VIEAGLVAPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYMVEQGCVKPLCDLLVCP  428

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG +   N YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  429  DPRIITVCLEGLENILKVGEAEKNLGHSGDTNYYAQLIDDAEGLEKIENLQSHDNNEIYE  488

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW  +++E+  LP G D +Q GF FG +Q  VP
Sbjct  489  KAVKILETYWLEEDEEDETLPPG-DGSQPGFQFGGNQVPVP  528



>ref|XP_009402512.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=531

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 2/159 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEFDIKKEAAWAISNATSGGS++QI+FL  QGC+KPLCDLL+CP
Sbjct  366  VIAAGIIGPLVHLLQSAEFDIKKEAAWAISNATSGGSHDQIKFLVDQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K      G+N+YAQMIDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKVGEAEKNQVTTGGVNVYAQMIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNV  421
            KAVKILE +W +E+++  +P G D    GF FGN+  N 
Sbjct  486  KAVKILETFWLEEEDDA-MPTG-DAAPTGFHFGNNGQNT  522



>ref|XP_008340751.1| PREDICTED: importin subunit alpha-1 [Malus domestica]
Length=529

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQHAEFDIKKEAAWAISNATSGG+ +QI++L  +GC+KPLCDLL+CP
Sbjct  365  VIEAGLIGPLVNLLQHAEFDIKKEAAWAISNATSGGTADQIKYLVGEGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEG ENILKVGEA+K  G +  +N+YAQ+ID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGXENILKVGEAEKAAGNSGEVNLYAQLIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K+VKILE YW +EDEE  LP G D  QQG  F  ++  VP
Sbjct  485  KSVKILETYWLEEDEE-TLPAG-DGTQQGIRFEGNEVQVP  522



>ref|XP_006355841.1| PREDICTED: importin subunit alpha-like [Solanum tuberosum]
Length=527

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 5/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEF+IKKEAAW ISNATSGG+++QI+FL SQGC+KPLCDLL+CP
Sbjct  366  VIEAGIIAPLVYLLQNAEFEIKKEAAWGISNATSGGNHDQIKFLVSQGCIKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILK+GEADK LG  +G+N+YAQ+IDE EGL+K+ENLQ+HDN EIYE
Sbjct  426  DPRIVTVCLEGLENILKIGEADKDLGNTEGVNVYAQLIDEAEGLEKIENLQSHDNTEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW    EE ++   + E+Q  F FG +  ++P
Sbjct  486  KAVKILETYWL---EEEDVQVSLIEDQ--FEFGGADISLP  520



>ref|XP_004302255.1| PREDICTED: importin subunit alpha-1 [Fragaria vesca subsp. vesca]
Length=532

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+++ +I PLV LL  AEFDIKKEAAWA+SNATSGGS++QI+ L + GC+KPLCDLLICP
Sbjct  363  VVDANLIGPLVQLLSSAEFDIKKEAAWAVSNATSGGSHDQIKILVNHGCIKPLCDLLICP  422

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LGM  G+N++AQ IDE EGL+K+ENLQTHDN EIYE
Sbjct  423  DPRIVTVCLEGLENILKVGEAEKNLGMTGGVNLFAQAIDEAEGLEKIENLQTHDNAEIYE  482

Query  537  KAVKILEKYW-GDEDEEPNLP--DGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW  D+D +  +P  D       GF FG + P VP
Sbjct  483  KAVKLLETYWLEDDDGDETMPPGDAATVPTGGFNFGGNAPTVP  525



>ref|XP_009401503.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. 
malaccensis]
Length=528

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ AEF+IKKEAAWAISNATSGG++EQI++L SQGC+KPLCDLL+CP
Sbjct  365  VIAAGIIGPLVHLLQTAEFEIKKEAAWAISNATSGGAHEQIKYLVSQGCIKPLCDLLLCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K LG+  G N YAQ+I++ EGLDK+EN Q+HDN EIYE
Sbjct  425  DPRIITVCLEGLENILKVGEAEKNLGVPGGTNPYAQLIEDAEGLDKIENFQSHDNTEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K+VKILE YW +E+++  +P   D  Q GF FGN+  +VP
Sbjct  485  KSVKILETYWLEEEDDA-MPG--DTTQTGFDFGNNDQSVP  521



>ref|XP_002519264.1| importin alpha, putative [Ricinus communis]
 gb|EEF43128.1| importin alpha, putative [Ricinus communis]
Length=453

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 140/163 (86%), Gaps = 5/163 (3%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VIE+ II PLV LLQ+AEF++KKEAAWAISNATSGGS EQI++L SQGC+KPLCDLL+
Sbjct  287  QAVIEANIISPLVHLLQNAEFEVKKEAAWAISNATSGGSREQIQYLVSQGCIKPLCDLLV  346

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILK+GE +K+ G N  +N+YAQ+ID+C+GLDK+ENLQ+HDN+EI
Sbjct  347  CPDPRIVTVCLEGLENILKIGETEKESG-NTTVNMYAQLIDDCDGLDKIENLQSHDNHEI  405

Query  543  YEKAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            YEKAVKILEKYW  +E+E+ N+   +D +    +FG +QP++P
Sbjct  406  YEKAVKILEKYWIEEEEEDQNI---IDASNGDLSFGTNQPSIP  445



>gb|EPS62504.1| hypothetical protein M569_12283, partial [Genlisea aurea]
Length=535

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIES II PLV LLQ+AEF+IKKEAAWAISNATSGG+ +QI+FL  +GC+KPLCDLL+CP
Sbjct  371  VIESGIISPLVSLLQNAEFEIKKEAAWAISNATSGGTPDQIKFLVGEGCIKPLCDLLVCP  430

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE++K  G    +N++AQMIDE EGL+K+E+LQ HDNNEIYE
Sbjct  431  DPRIVTVCLEGLENILKVGESEKNQGNTGDVNVFAQMIDEAEGLEKIESLQNHDNNEIYE  490

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K VKILE YW +ED+E  L  G D  Q GF FG     VP
Sbjct  491  KVVKILETYWLEEDDE-QLASG-DAQQSGFNFGGGDNAVP  528



>gb|AIU34461.1| putative importin subunit alpha-2, partial [Taraxacum brevicorniculatum]
Length=531

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + +I PLV LLQ AEFDIKKEAAWAISNATSGG+NEQI++L +QGC+KPLCDLL CP
Sbjct  367  VIIAGLISPLVNLLQTAEFDIKKEAAWAISNATSGGNNEQIKYLVAQGCIKPLCDLLACP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE +K  G +  +N YAQ+IDE EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEIEKNSGQSGDVNFYAQLIDEAEGLEKIENLQSHDNNEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  + D   + Q GF FG +   +P
Sbjct  487  KAVKILETYWLEEEDEA-VGDAAGQGQPGFNFGGNNVQLP  525



>ref|XP_011041680.1| PREDICTED: importin subunit alpha-like [Populus euphratica]
Length=538

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ II PLV LLQ+AEF+IKKEAAWAISNATSGGS+EQI+FL  QGC+KPLCDLLICP
Sbjct  372  VLEAGIIGPLVQLLQNAEFEIKKEAAWAISNATSGGSHEQIKFLVDQGCIKPLCDLLICP  431

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA K LG     N+Y QMI++ EGL+K+ENLQ+HDNNEIYE
Sbjct  432  DPRIVTVCLEGLENILKVGEAKKNLGNTGNANLYTQMIEDVEGLEKIENLQSHDNNEIYE  491

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQ  430
            KAVKILE YW  D D+    P G D +Q GF FG ++
Sbjct  492  KAVKILETYWVEDGDDFEAFPPG-DASQSGFQFGGTE  527



>gb|AGZ15387.1| importin alpha [Phaseolus vulgaris]
Length=532

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 3/161 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ +I PLV LL  AE DIKKEAAWAISNAT GGS+EQ++FL SQGC+KPLCDLLICP
Sbjct  367  VIDAGLIAPLVPLLPKAEVDIKKEAAWAISNATPGGSHEQVKFLVSQGCIKPLCDLLICP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE++K +   DG+N+Y  M D+ EGL+K+ENLQ+HDN EIYE
Sbjct  427  DPRIVTVCLEGLENILKVGESEKNVSNADGVNLYGAMFDDVEGLEKIENLQSHDNTEIYE  486

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQ-PNVP  418
            KAVKILE YW +ED+E  +P G D  Q GF FG  + P+VP
Sbjct  487  KAVKILETYWMEEDDE-TVPPG-DAFQSGFDFGGHKFPSVP  525



>ref|XP_009763482.1| PREDICTED: importin subunit alpha-1a-like [Nicotiana sylvestris]
Length=528

 Score =   222 bits (565),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +  PLV LLQ+AEF+IKKEAAWAISNATSGG+NEQI++L SQGC+KPLCDLL+CP
Sbjct  365  VIEAGVFGPLVNLLQNAEFEIKKEAAWAISNATSGGTNEQIKYLVSQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVG+ +  LG    IN+YAQMID+ +G++K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGDVE-NLGEAGNINVYAQMIDDADGIEKIENLQSHDNQEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +ED+E  +P G D   QGF FG    +VP
Sbjct  484  KAVKILETYWLEEDDE-TMPPG-DATHQGFQFGGGNVSVP  521



>gb|AHJ25927.1| importin subunit alpha-1 [Senecio scandens]
Length=529

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 131/160 (82%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ I+ PLV LLQ AEF+IKKEAAWAISNATSGG+++QI+FL  +GC+KPLCDLL+ P
Sbjct  365  VVEAGIVSPLVALLQSAEFEIKKEAAWAISNATSGGTSDQIKFLVREGCIKPLCDLLVSP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K LG    +N++AQMID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEAEKNLGNTGDVNVFAQMIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  +    D  Q GF FG  +  VP
Sbjct  485  KAVKILETYWLEEEDEQLVSS--DGPQAGFNFGGGELPVP  522



>ref|XP_004228994.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318783.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318786.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
 ref|XP_010318791.1| PREDICTED: importin subunit alpha-1a [Solanum lycopersicum]
Length=530

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PLV LLQ AEFDIKKEAAWAISNATSGGS+EQI+FL SQ C+KPLCDLL+CP
Sbjct  368  VIEAGLISPLVNLLQTAEFDIKKEAAWAISNATSGGSHEQIKFLVSQNCIKPLCDLLVCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K     +GIN YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  428  DPRIVTVCLEGLENILKVGEAEK--ANTEGINYYAQLIDDAEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  +P G D  Q  F FG +   +P
Sbjct  486  KAVKILETYWLEEEDE-TVPAG-DGAQNEFNFGGNDIQLP  523



>ref|XP_010558435.1| PREDICTED: importin subunit alpha-1-like [Tarenaya hassleriana]
Length=526

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 134/160 (84%), Gaps = 5/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ ++ PLV LLQ+AEFDIKKEAAWAISNATSGGS++QI++L  QGC+KPLCDLL+CP
Sbjct  365  VIQAGLVAPLVNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGE +K  G    +N Y Q+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIVTVCLEGLENILKVGETEKNSGR---VNYYTQLIDDAEGLEKIENLQSHDNNEIYE  481

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E+E+  +P G D +Q GF FG +Q ++P
Sbjct  482  KAVKILETYWVEEEED-TVPPG-DGSQPGFEFGGNQVHIP  519



>emb|CDY34430.1| BnaC01g22030D [Brassica napus]
Length=530

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLL+CP
Sbjct  366  VCEAGLIAPLVNLLQNAEFDIKKEAAWAVSNATSGGSADQIKYMVDQGVVKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G     N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  426  DPRIITVCLEGLENILKVGEAEKVTGNTGDANYYAQLIDDAEGLEKIENLQSHDNSEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G DE+ QGF FG S    P
Sbjct  486  KAVKILETYWLEEEDE-TLPPG-DESAQGFQFGGSDAAAP  523



>ref|XP_002320318.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
 gb|EEE98633.1| hypothetical protein POPTR_0014s11920g [Populus trichocarpa]
Length=538

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ II PLV LLQ+AEF+IKKEAAWAISNATSGGS+EQI+FL  QGC+KPLCDLLICP
Sbjct  372  VLEAGIIGPLVQLLQNAEFEIKKEAAWAISNATSGGSHEQIKFLVDQGCIKPLCDLLICP  431

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA K LG     N+Y QMI++ EGL+K+ENLQ+HDNNEIYE
Sbjct  432  DPRIVTVCLEGLENILKVGEAKKNLGNTGNANLYTQMIEDVEGLEKIENLQSHDNNEIYE  491

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQ  430
            KAVKILE +W  D D+    P G D +Q GF FG ++
Sbjct  492  KAVKILETFWVEDGDDFEAFPPG-DASQSGFQFGGTE  527



>ref|XP_006355403.1| PREDICTED: importin subunit alpha-1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006355404.1| PREDICTED: importin subunit alpha-1-like isoform X2 [Solanum 
tuberosum]
Length=529

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V+E+ +I PLV LLQ AEFDIKKEAAWAISNATSGGS+EQI+FL SQ C+KPLCDLL+CP
Sbjct  367  VVEAGLISPLVNLLQTAEFDIKKEAAWAISNATSGGSHEQIKFLVSQNCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K     +GIN YAQ+ID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEK--ANTEGINYYAQLIDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  +P G D  Q  F FG +   +P
Sbjct  485  KAVKILETYWLEEEDE-TVPAG-DGAQNEFNFGGNDIQLP  522



>gb|AAM96997.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15476.1| unknown protein [Arabidopsis thaliana]
Length=314

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + V E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS +QI+++  QG VKPLCDLL+
Sbjct  147  QAVCEAGLICPLVNLLQNAEFDIKKEAAWAISNATSGGSPDQIKYMVEQGVVKPLCDLLV  206

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EI
Sbjct  207  CPDPRIITVCLEGLENILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEI  266

Query  543  YEKAVKILEKYWGDEDEEPNLPDGVDENQQGFTFG  439
            YEKAVKILE YW +E++E  LP G D + QGF FG
Sbjct  267  YEKAVKILETYWLEEEDE-TLPPG-DPSAQGFQFG  299



>ref|XP_007031101.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 4 [Theobroma 
cacao]
 gb|EOY11603.1| Importin alpha, alpha,aimp alpha,impa-1,impa1 isoform 4 [Theobroma 
cacao]
Length=530

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ II PLV LLQ+AEFDIKKEAAWAISNATSGG+++QI+FL SQGC+KPLCDLL CP
Sbjct  365  VIEANIIAPLVHLLQNAEFDIKKEAAWAISNATSGGTHDQIKFLVSQGCIKPLCDLLNCP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEADK  G   G+N+YAQMID+ EGL+K+ENLQ+HDN EIYE
Sbjct  425  DPRIVTVCLEGLENILKVGEADKNQGNTGGVNLYAQMIDDAEGLEKIENLQSHDNTEIYE  484

Query  537  KAVKILEKYWGDED  496
            KAVK+LE YW +ED
Sbjct  485  KAVKVLETYWLEED  498



>ref|XP_012084120.1| PREDICTED: importin subunit alpha-4-like [Jatropha curcas]
 gb|KDP27954.1| hypothetical protein JCGZ_19034 [Jatropha curcas]
Length=527

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 133/161 (83%), Gaps = 5/161 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            +I++ II PLV LLQHAEF++KKEAAWAISNATSGG+ EQI+ L S+GC+KPLCDLL CP
Sbjct  365  IIDANIIAPLVHLLQHAEFEVKKEAAWAISNATSGGTQEQIQHLVSRGCIKPLCDLLACP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILK+GE DK+ G N  +N+Y  MI++C+GLDK+ENLQ HDN EIYE
Sbjct  425  DPRIITVCLEGLENILKIGETDKESG-NTQVNVYRHMIEDCDGLDKIENLQNHDNQEIYE  483

Query  537  KAVKILEKYW-GDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            K VKILE+YW  +ED + ++ DG+D +    +FG +QP++P
Sbjct  484  KVVKILERYWIEEEDPDQDIADGIDGS---LSFGTNQPSLP  521



>gb|KJB09437.1| hypothetical protein B456_001G142300 [Gossypium raimondii]
Length=532

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II PLV LLQH+EF+IKKEAAWAISNATSGGS++QI+FL S+GC+  LCDLL CP
Sbjct  369  VIDAGIIAPLVHLLQHSEFEIKKEAAWAISNATSGGSHKQIKFLVSEGCIT-LCDLLTCP  427

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA KKLG     N+YA ++++  GL+K+ENLQ+HDNNEIYE
Sbjct  428  DPRIITVCLEGLENILKVGEAQKKLGHTGEFNVYADLLNDAGGLEKIENLQSHDNNEIYE  487

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YWG++++EP LP G D +Q  F FG +Q  VP
Sbjct  488  KAVKILETYWGEDEDEP-LPPG-DASQSDFHFGGNQLPVP  525



>gb|KJB28705.1| hypothetical protein B456_005G065400 [Gossypium raimondii]
Length=528

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 131/160 (82%), Gaps = 3/160 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + II PLV LLQ+AEFDIKKEAAWAISNATSGG++EQI++L S+GC+KPLCDLL CP
Sbjct  365  VINAGIIGPLVSLLQNAEFDIKKEAAWAISNATSGGTHEQIKYLVSEGCIKPLCDLLACP  424

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G  +  N  AQ+I++ EGL+K+ENLQ+HDNNEIYE
Sbjct  425  DPRIITVCLEGLENILKVGEAEKAAGAGE-FNYCAQLIEDAEGLEKIENLQSHDNNEIYE  483

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +EDEE  LP G D  QQ F FG +   VP
Sbjct  484  KAVKILETYWLEEDEE-TLPPG-DGTQQNFHFGGNDVKVP  521



>ref|XP_009146474.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
 emb|CDY32215.1| BnaA01g17690D [Brassica napus]
Length=530

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PL+ LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLL+CP
Sbjct  366  VCEAGLIGPLINLLQNAEFDIKKEAAWAVSNATSGGSADQIKYMVDQGVVKPLCDLLVCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G     N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  426  DPRIITVCLEGLENILKVGEAEKVTGNTGDANYYAQLIDDAEGLEKIENLQSHDNSEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G DE+ QGF FG S    P
Sbjct  486  KAVKILETYWLEEEDE-TLPPG-DESAQGFQFGGSDAAAP  523



>emb|CDY52043.1| BnaC08g48070D [Brassica napus]
Length=534

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICP
Sbjct  370  VCEAGLIFPLVNLLQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVDQGVVKPLCDLLICP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  430  DPRIITVCLEGLENILKVGEAEKLTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D + QGF FG +    P
Sbjct  490  KAVKILETYWLEEEDE-TLPPG-DVSAQGFQFGGNDAAAP  527



>emb|CDY22779.1| BnaA08g06090D [Brassica napus]
Length=534

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICP
Sbjct  370  VCEAGLIFPLVNLLQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVDQGVVKPLCDLLICP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  430  DPRIITVCLEGLENILKVGEAEKLTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D + QGF FG +    P
Sbjct  490  KAVKILETYWLEEEDE-TLPPG-DVSAQGFQFGGNDAAAP  527



>ref|XP_009107883.1| PREDICTED: importin subunit alpha-1-like [Brassica rapa]
Length=534

 Score =   219 bits (558),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICP
Sbjct  370  VCEAGLIFPLVNLLQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVDQGVVKPLCDLLICP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  430  DPRIITVCLEGLENILKVGEAEKLTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D + QGF FG +    P
Sbjct  490  KAVKILETYWLEEEDE-TLPPG-DVSAQGFQFGGNDAAAP  527



>ref|XP_010024770.1| PREDICTED: importin subunit alpha-1 [Eucalyptus grandis]
 gb|KCW61262.1| hypothetical protein EUGRSUZ_H04025 [Eucalyptus grandis]
Length=523

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 133/153 (87%), Gaps = 3/153 (2%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VIE+ +I PL+ LLQ+AEFDIKKEAAWAISNATSGGS++QI+++ SQGC+KPLCDLL+CP
Sbjct  361  VIEAGLIGPLLNLLQNAEFDIKKEAAWAISNATSGGSHDQIKYIVSQGCIKPLCDLLVCP  420

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLE LENILK+G+A+K+ G N G N+YA+MID+ EGL+K+ENLQ+HDNNEIYE
Sbjct  421  DPRIVTVCLEALENILKIGQAEKECG-NTGDNVYARMIDDAEGLEKIENLQSHDNNEIYE  479

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFG  439
            KAVKILE YW +E++E  +P G D  Q GF FG
Sbjct  480  KAVKILETYWVEEEDEI-VPPG-DNTQPGFNFG  510



>ref|XP_010434881.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010440203.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
 ref|XP_010449846.1| PREDICTED: importin subunit alpha-1-like [Camelina sativa]
Length=534

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLL+CP
Sbjct  370  VCEAGLICPLVNLLQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVEQGVVKPLCDLLVCP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  430  DPRIITVCLEGLENILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D   QGF FG +   +P
Sbjct  490  KAVKILETYWLEEEDE-TLPPG-DAAAQGFQFGGTDAAIP  527



>ref|XP_001773628.1| predicted protein [Physcomitrella patens]
 gb|EDQ61516.1| predicted protein [Physcomitrella patens]
Length=531

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 127/158 (80%), Gaps = 2/158 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ II P+V LL  AEFDIKKEAAWAISNATSGG+ EQI+FL +QGC+KPLCDLL CP
Sbjct  366  VIDANIIPPVVALLATAEFDIKKEAAWAISNATSGGTPEQIKFLVNQGCIKPLCDLLTCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTV LEGLENILKVGE  K  G N  +N+YA+ IDE EGL+K+ENLQTHDNNEIYE
Sbjct  426  DPRIVTVSLEGLENILKVGEQVKDSGSNGDVNLYARYIDEAEGLEKIENLQTHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPN  424
            KAVKILE YW +EDE+ N    V E  Q F FG+S P+
Sbjct  486  KAVKILETYWLEEDEDQNTAP-VTEG-QNFAFGSSNPS  521



>emb|CDY09716.1| BnaC07g33450D [Brassica napus]
Length=535

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICP
Sbjct  371  VCEAGVICPLVNLLQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVEQGVVKPLCDLLICP  430

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  431  DPRIITVCLEGLENILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYE  490

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D + QGF FG +    P
Sbjct  491  KAVKILETYWLEEEDE-TLPHG-DGSAQGFQFGGNDAAAP  528



>gb|KFK42624.1| hypothetical protein AALP_AA1G019500 [Arabis alpina]
Length=530

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI++ I  PL+ LLQ+ EFD+KKEA WAISNATSGG+++QI+FL S GC+KPLCDLL+CP
Sbjct  366  VIQAGIFEPLIFLLQNGEFDVKKEAVWAISNATSGGNHDQIKFLVSIGCIKPLCDLLLCP  425

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPR+VTV LEGLENIL+VGEA+K+LG +   N YAQMI++ EGL+K+ENLQ+HDNNEIYE
Sbjct  426  DPRVVTVTLEGLENILRVGEAEKELGNSGDYNHYAQMIEDVEGLEKIENLQSHDNNEIYE  485

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVK+LE YW +ED E N  D V  +  GF FGN   N P
Sbjct  486  KAVKMLESYWAEEDNEENGGDVVQSS--GFQFGNQSGNAP  523



>gb|AAK38727.1|AF369707_1 importin alpha 2 [Capsicum annuum]
Length=529

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 129/160 (81%), Gaps = 4/160 (3%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            VI + +I PLV LLQ AEFDIKKEAAWAISNATSGG++EQI+FL SQ C+KPLCDLL+CP
Sbjct  367  VIAAGLISPLVNLLQSAEFDIKKEAAWAISNATSGGTHEQIKFLVSQNCIKPLCDLLVCP  426

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRIVTVCLEGLENILKVGEA+K      GIN YAQ+ D+ EGL+K+ENLQ+HDNNEIYE
Sbjct  427  DPRIVTVCLEGLENILKVGEAEK--ANTGGINYYAQLTDDAEGLEKIENLQSHDNNEIYE  484

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D  Q  F FG +   +P
Sbjct  485  KAVKILETYWLEEEDE-TLPAG-DGTQNEFNFGGNDIQLP  522



>gb|AFW79686.1| importin alpha-1b subunit, mRNA [Zea mays]
Length=328

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  903  RPVIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLI  724
            + VI + II PL+ LLQ AEFDIKKEAAWAISNATSGGS+EQI++L S+GC+KPLCDLL+
Sbjct  161  QAVISAGIIAPLLQLLQTAEFDIKKEAAWAISNATSGGSHEQIKYLVSEGCIKPLCDLLV  220

Query  723  CPDPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEI  544
            CPDPRIVTVCLEGLENILKVG+ DK +G     N+ AQMIDE EGL+K+ENLQ+HDNNEI
Sbjct  221  CPDPRIVTVCLEGLENILKVGQHDKTMGATGDTNVLAQMIDEAEGLEKIENLQSHDNNEI  280

Query  543  YEKAVKILEKYWGDEDEE  490
            YEKAVK+LE YW +E+++
Sbjct  281  YEKAVKLLETYWMEEEDD  298



>ref|XP_009136744.1| PREDICTED: importin subunit alpha-1 [Brassica rapa]
 emb|CDX90544.1| BnaA03g42370D [Brassica napus]
Length=540

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWA+SNATSGGS +QI+++  QG VKPLCDLLICP
Sbjct  376  VCEAGVICPLVNLLQNAEFDIKKEAAWAVSNATSGGSPDQIKYMVEQGVVKPLCDLLICP  435

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  436  DPRIITVCLEGLENILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYE  495

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D + QGF FG +    P
Sbjct  496  KAVKILETYWLEEEDE-TLPHG-DGSAQGFQFGGNDAAAP  533



>ref|XP_006414387.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
 gb|ESQ55840.1| hypothetical protein EUTSA_v10024884mg [Eutrema salsugineum]
Length=534

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -1

Query  897  VIESKIILPLVCLLQHAEFDIKKEAAWAISNATSGGSNEQIRFLASQGCVKPLCDLLICP  718
            V E+ +I PLV LLQ+AEFDIKKEAAWAISNATSGGS +QI+++  QG VKPLCDLLICP
Sbjct  370  VCEAGLICPLVNLLQNAEFDIKKEAAWAISNATSGGSPDQIKYMVEQGVVKPLCDLLICP  429

Query  717  DPRIVTVCLEGLENILKVGEADKKLGMNDGINIYAQMIDECEGLDKLENLQTHDNNEIYE  538
            DPRI+TVCLEGLENILKVGEA+K  G    +N YAQ+ID+ EGL+K+ENLQ+HDN+EIYE
Sbjct  430  DPRIITVCLEGLENILKVGEAEKVTGNTGDVNFYAQLIDDAEGLEKIENLQSHDNSEIYE  489

Query  537  KAVKILEKYWGDEDEEPNLPDGVDENQQGFTFGNSQPNVP  418
            KAVKILE YW +E++E  LP G D + QGF FG +    P
Sbjct  490  KAVKILETYWLEEEDEA-LPPG-DGSAQGFQFGGNDAAAP  527



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2366563193034