BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12484

Length=961
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_012068793.1|  PREDICTED: pectinesterase-like                     396   1e-130   Jatropha curcas
ref|XP_006369079.1|  pectinesterase family protein                      375   3e-127   
ref|XP_010096538.1|  Pectinesterase 1                                   374   6e-127   
emb|CDO97787.1|  unnamed protein product                                374   2e-126   Coffea canephora [robusta coffee]
gb|AFW03480.1|  pectin methylesterase 1                                 385   5e-126   Gossypium hirsutum [American cotton]
gb|KHG08631.1|  Pectinesterase 3                                        384   7e-126   Gossypium arboreum [tree cotton]
gb|AFB77929.1|  pectin methylesterase                                   384   7e-126   Gossypium hirsutum [American cotton]
gb|KJB57093.1|  hypothetical protein B456_009G147900                    384   8e-126   Gossypium raimondii
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     383   2e-125   Populus euphratica
ref|XP_002304257.2|  pectinesterase family protein                      384   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             382   3e-125   Populus trichocarpa [western balsam poplar]
ref|NP_001274969.1|  pectin methyl esterase                             382   5e-125   Solanum tuberosum [potatoes]
gb|AFW03475.1|  pectin methylesterase 1                                 381   1e-124   Gossypium barbadense [Egyptian cotton]
ref|NP_001233857.2|  pectinesterase/pectinesterase inhibitor U1 p...    381   1e-124   Solanum lycopersicum
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     380   2e-124   Populus euphratica
gb|AFI23411.1|  pectin methylesterase                                   380   3e-124   Coffea arabica [arabica coffee]
ref|XP_002265171.1|  PREDICTED: pectinesterase                          380   7e-124   Vitis vinifera
emb|CAC01624.1|  putative pectin methylesterase                         378   2e-123   Populus tremula x Populus tremuloides
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    378   2e-123   Nicotiana sylvestris
sp|Q43143.1|PMEU1_SOLLC  RecName: Full=Pectinesterase/pectinester...    377   3e-123   Solanum lycopersicum
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     378   4e-123   Nicotiana tomentosiformis
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     377   4e-123   Nicotiana sylvestris
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  377   6e-123   
emb|CAB95025.1|  pectin methylesterase                                  377   7e-123   Nicotiana tabacum [American tobacco]
gb|AFK42744.1|  unknown                                                 365   7e-123   Lotus japonicus
ref|XP_004141734.1|  PREDICTED: pectinesterase-like                     377   8e-123   Cucumis sativus [cucumbers]
gb|AAO85706.1|  pectin methyl-esterase                                  376   1e-122   Nicotiana benthamiana
gb|ABE67980.1|  pectin methylesterase                                   363   1e-122   Citrus bergamia [bergamot orange]
ref|XP_003627458.1|  Pectinesterase                                     375   3e-122   Medicago truncatula
gb|AFQ23194.1|  pectin methylesterase                                   374   5e-122   Theobroma cacao [chocolate]
emb|CBI35795.3|  unnamed protein product                                376   1e-121   Vitis vinifera
emb|CBI27741.3|  unnamed protein product                                366   1e-121   Vitis vinifera
ref|XP_010273801.1|  PREDICTED: pectinesterase                          373   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    373   2e-121   Nicotiana tomentosiformis
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    363   5e-121   Daucus carota [carrots]
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  363   5e-121   Daucus carota [carrots]
emb|CDX97564.1|  BnaA05g25150D                                          372   7e-121   
ref|NP_001265901.1|  pectinesterase 3-like                              370   2e-120   Cicer arietinum [garbanzo]
ref|XP_008361835.1|  PREDICTED: pectinesterase-like                     358   2e-120   
gb|AAL24278.1|  AT3g14310/MLN21_9                                       363   2e-120   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95369.1|  pectin methylesterase like protein                     363   2e-120   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94011.1|  pectin methylesterase like protein                     358   3e-120   Arabidopsis thaliana [mouse-ear cress]
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    369   5e-120   Citrus sinensis [apfelsine]
ref|NP_001275859.1|  pectinesterase 1 precursor                         369   5e-120   Citrus sinensis [apfelsine]
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    369   6e-120   Citrus sinensis [apfelsine]
emb|CDX98441.1|  BnaC05g39340D                                          369   7e-120   
ref|XP_010465323.1|  PREDICTED: pectinesterase/pectinesterase inh...    369   7e-120   Camelina sativa [gold-of-pleasure]
ref|XP_008462453.1|  PREDICTED: pectinesterase-like                     369   8e-120   
gb|KHN15840.1|  Pectinesterase/pectinesterase inhibitor U1              361   1e-119   Glycine soja [wild soybean]
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     368   1e-119   Vitis vinifera
ref|XP_010501842.1|  PREDICTED: pectinesterase/pectinesterase inh...    367   3e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                   364   1e-118   Tarenaya hassleriana [spider flower]
ref|NP_188048.1|  pectin methylesterase 3                               366   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    363   1e-118   
gb|AAC72288.1|  putative pectin methylesterase                          366   2e-118   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38797.1|  hypothetical protein AALP_AA3G161500                    365   2e-118   Arabis alpina [alpine rockcress]
ref|XP_009146386.1|  PREDICTED: pectinesterase/pectinesterase inh...    365   2e-118   Brassica rapa
ref|XP_012077139.1|  PREDICTED: pectinesterase-like                     365   3e-118   Jatropha curcas
ref|XP_007012502.1|  Pectin methylesterase 3                            364   3e-118   
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    365   4e-118   
ref|XP_010029512.1|  PREDICTED: pectinesterase-like                     364   4e-118   Eucalyptus grandis [rose gum]
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             364   9e-118   Eutrema salsugineum [saltwater cress]
ref|XP_008228105.1|  PREDICTED: pectinesterase                          363   9e-118   Prunus mume [ume]
ref|XP_006297218.1|  hypothetical protein CARUB_v10013226mg             365   9e-118   
ref|XP_002885033.1|  ATPME3                                             363   1e-117   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    363   2e-117   Tarenaya hassleriana [spider flower]
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     362   5e-117   
gb|AJH66132.1|  pectin methylesterase                                   362   5e-117   Malus domestica [apple tree]
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             361   1e-116   Prunus persica
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             360   1e-116   Phaseolus vulgaris [French bean]
gb|AAR03544.1|  pectin methylesterase isoform 1                         348   1e-116   Fragaria x ananassa
gb|EYU21270.1|  hypothetical protein MIMGU_mgv1a003278mg                360   2e-116   Erythranthe guttata [common monkey flower]
emb|CDY60700.1|  BnaA01g37100D                                          359   2e-116   Brassica napus [oilseed rape]
emb|CDY33229.1|  BnaC01g37020D                                          358   7e-116   Brassica napus [oilseed rape]
ref|XP_011078159.1|  PREDICTED: pectinesterase-like isoform X1          357   1e-115   Sesamum indicum [beniseed]
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          357   1e-115   
ref|XP_004303758.1|  PREDICTED: pectinesterase-like                     357   2e-115   Fragaria vesca subsp. vesca
gb|AAQ21126.1|  pectinesterase                                          344   2e-115   Fragaria x ananassa
ref|XP_009117000.1|  PREDICTED: pectinesterase/pectinesterase inh...    357   4e-115   Brassica rapa
ref|XP_008460358.1|  PREDICTED: pectinesterase-like                     355   6e-115   Cucumis melo [Oriental melon]
ref|XP_004144447.2|  PREDICTED: pectinesterase-like                     355   8e-115   Cucumis sativus [cucumbers]
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                356   1e-114   Erythranthe guttata [common monkey flower]
ref|XP_009135376.1|  PREDICTED: pectinesterase/pectinesterase inh...    355   2e-114   Brassica rapa
emb|CDY02461.1|  BnaA08g00680D                                          345   6e-114   
emb|CDY39109.1|  BnaA01g29470D                                          352   9e-114   Brassica napus [oilseed rape]
ref|XP_006452919.1|  hypothetical protein CICLE_v10007806mg             353   1e-113   
ref|XP_009116991.1|  PREDICTED: pectinesterase/pectinesterase inh...    352   2e-113   Brassica rapa
ref|XP_006828586.1|  PREDICTED: pectinesterase                          351   4e-113   Amborella trichopoda
ref|NP_001275846.1|  putative thermostable pectinesterase               353   4e-113   Citrus sinensis [apfelsine]
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     350   9e-113   Nelumbo nucifera [Indian lotus]
gb|KDO73733.1|  hypothetical protein CISIN_1g008261mg                   350   1e-112   Citrus sinensis [apfelsine]
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g             365   1e-112   Phaseolus vulgaris [French bean]
gb|KJB54563.1|  hypothetical protein B456_009G039100                    348   6e-112   Gossypium raimondii
gb|EYU29495.1|  hypothetical protein MIMGU_mgv1a005211mg                345   8e-112   Erythranthe guttata [common monkey flower]
emb|CDY33228.1|  BnaC01g37010D                                          348   9e-112   Brassica napus [oilseed rape]
gb|AAG17110.1|AF188895_1  putative pectin methylesterase 3              347   1e-111   Linum usitatissimum
gb|AAC50023.1|  ATPME2 precursor                                        347   3e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175786.1|  pectin methylesterase 2                               346   5e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029511.1|  PREDICTED: pectinesterase-like                     346   6e-111   Eucalyptus grandis [rose gum]
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               345   1e-110   Ricinus communis
gb|AFB77928.1|  pectin methylesterase                                   344   2e-110   Gossypium hirsutum [American cotton]
gb|KHF97383.1|  Pectinesterase/pectinesterase inhibitor U1              344   2e-110   Gossypium arboreum [tree cotton]
ref|XP_012077138.1|  PREDICTED: pectinesterase-like                     344   2e-110   Jatropha curcas
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        344   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     343   3e-110   Sesamum indicum [beniseed]
ref|XP_010479961.1|  PREDICTED: pectinesterase 2-like                   344   4e-110   Camelina sativa [gold-of-pleasure]
gb|KJB70037.1|  hypothetical protein B456_011G055100                    343   6e-110   Gossypium raimondii
ref|XP_006371892.1|  hypothetical protein POPTR_0018s05350g             331   8e-110   
emb|CAB57457.2|  pectin methylesterase                                  332   8e-110   Nicotiana tabacum [American tobacco]
ref|XP_006392745.1|  hypothetical protein EUTSA_v10011343mg             343   1e-109   Eutrema salsugineum [saltwater cress]
ref|XP_010501045.1|  PREDICTED: pectinesterase 2-like                   342   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002891774.1|  ATPME2                                             342   3e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             341   4e-109   Capsella rubella
ref|XP_011012638.1|  PREDICTED: pectinesterase-like                     341   5e-109   Populus euphratica
ref|XP_011069392.1|  PREDICTED: pectinesterase-like                     334   1e-108   Sesamum indicum [beniseed]
ref|XP_006372149.1|  hypothetical protein POPTR_0018s12530g             341   1e-108   
ref|XP_006369081.1|  hypothetical protein POPTR_0001s16280g             341   1e-108   
ref|XP_006369080.1|  putative pectin methylesterase LuPME5 family...    341   1e-108   
ref|XP_006389476.1|  hypothetical protein POPTR_0022s002002g            328   3e-108   
ref|XP_011048629.1|  PREDICTED: pectinesterase-like                     339   3e-108   Populus euphratica
ref|XP_011039649.1|  PREDICTED: pectinesterase-like isoform X2          337   8e-108   Populus euphratica
ref|XP_011039648.1|  PREDICTED: pectinesterase-like isoform X1          337   8e-108   Populus euphratica
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     337   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK69696.1|AF355057_1  putative pectin methylesterase LuPME5         337   1e-107   Linum usitatissimum
emb|CAC18725.1|  putative pectin methylesterase                         338   1e-107   Populus tremula x Populus tremuloides
ref|XP_011039646.1|  PREDICTED: pectinesterase-like                     336   2e-107   Populus euphratica
ref|XP_002532944.1|  Pectinesterase-3 precursor, putative               337   2e-107   Ricinus communis
ref|XP_008340373.1|  PREDICTED: pectinesterase 3-like                   337   2e-107   
ref|XP_006387527.1|  putative pectin methylesterase LuPME5 family...    335   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_006382081.1|  hypothetical protein POPTR_0006s27270g             335   3e-107   
ref|XP_002309641.2|  putative pectin methylesterase LuPME5 family...    335   6e-107   
gb|KFK35693.1|  hypothetical protein AALP_AA4G024900                    335   1e-106   Arabis alpina [alpine rockcress]
ref|XP_006389479.1|  putative pectin methylesterase LuPME5 family...    334   2e-106   
ref|XP_006385198.1|  putative pectin methylesterase LuPME5 family...    333   3e-106   
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   320   3e-106   Citrus sinensis [apfelsine]
ref|XP_011039647.1|  PREDICTED: pectinesterase-like                     333   4e-106   Populus euphratica
emb|CDY08206.1|  BnaA05g14130D                                          333   7e-106   Brassica napus [oilseed rape]
ref|XP_009123661.1|  PREDICTED: pectinesterase 2                        333   1e-105   
ref|XP_011003715.1|  PREDICTED: pectinesterase-like                     332   1e-105   Populus euphratica
ref|XP_006385197.1|  hypothetical protein POPTR_0003s00980g             332   2e-105   
emb|CDY51798.1|  BnaC06g41940D                                          332   2e-105   Brassica napus [oilseed rape]
ref|XP_011047860.1|  PREDICTED: pectinesterase-like                     331   3e-105   Populus euphratica
ref|XP_010047425.1|  PREDICTED: pectinesterase-like                     330   6e-105   Eucalyptus grandis [rose gum]
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        320   7e-105   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     330   2e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010047423.1|  PREDICTED: pectinesterase-like                     328   5e-104   Eucalyptus grandis [rose gum]
emb|CAC18727.1|  putative pectin methylesterase                         322   3e-102   Populus tremula x Populus tremuloides
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          323   4e-102   Phoenix dactylifera
emb|CAC18726.1|  putative pectin methylesterase                         322   6e-102   Populus tremula x Populus tremuloides
ref|XP_010534984.1|  PREDICTED: pectinesterase-like                     322   6e-102   Tarenaya hassleriana [spider flower]
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     320   5e-101   Elaeis guineensis
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     316   2e-99    Eucalyptus grandis [rose gum]
gb|AAN84553.1|  methyl pectinesterase                                   301   2e-98    Lolium perenne [perennial ryegrass]
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     312   5e-98    Elaeis guineensis
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     298   9e-97    Elaeis guineensis
ref|NP_001042866.1|  Os01g0312500                                       302   6e-96    
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   300   4e-95    
dbj|BAJ96804.1|  predicted protein                                      304   5e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS74082.1|  hypothetical protein M569_00674                         301   2e-94    Genlisea aurea
gb|KJB41904.1|  hypothetical protein B456_007G127000                    303   2e-94    Gossypium raimondii
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    302   3e-94    Gossypium arboreum [tree cotton]
gb|EEC70505.1|  hypothetical protein OsI_01594                          302   4e-94    Oryza sativa Indica Group [Indian rice]
gb|EEE54425.1|  hypothetical protein OsJ_01485                          302   5e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     290   7e-94    
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     290   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                     299   5e-93    Eucalyptus grandis [rose gum]
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     299   5e-93    Phoenix dactylifera
gb|EMT27728.1|  Pectinesterase                                          293   7e-93    
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         294   1e-92    Jatropha curcas
ref|XP_006841486.1|  PREDICTED: pectinesterase                          297   2e-92    Amborella trichopoda
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                     297   2e-92    Fragaria vesca subsp. vesca
gb|EMS45437.1|  Pectinesterase                                          289   3e-92    Triticum urartu
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     294   3e-92    Glycine soja [wild soybean]
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             294   5e-92    
emb|CDO97717.1|  unnamed protein product                                286   5e-92    Coffea canephora [robusta coffee]
gb|KJB09419.1|  hypothetical protein B456_001G140500                    296   8e-92    Gossypium raimondii
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     296   8e-92    Brachypodium distachyon [annual false brome]
gb|ABK94644.1|  unknown                                                 288   8e-92    Populus trichocarpa [western balsam poplar]
gb|EMT05022.1|  Pectinesterase 3                                        293   8e-92    
ref|XP_012091398.1|  PREDICTED: pectinesterase                          295   1e-91    Jatropha curcas
ref|XP_002518523.1|  Pectinesterase precursor, putative                 295   1e-91    Ricinus communis
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             295   2e-91    
ref|XP_007038413.1|  Pectinesterase                                     293   2e-91    
ref|XP_004293266.1|  PREDICTED: pectinesterase                          293   3e-91    Fragaria vesca subsp. vesca
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    286   3e-91    Actinidia deliciosa [Chinese gooseberry]
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   290   3e-91    
gb|EYU19222.1|  hypothetical protein MIMGU_mgv1a003983mg                294   4e-91    Erythranthe guttata [common monkey flower]
ref|XP_012082811.1|  PREDICTED: pectinesterase-like                     294   4e-91    Jatropha curcas
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    294   4e-91    Glycine max [soybeans]
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    291   6e-91    
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     294   7e-91    
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               293   8e-91    Ricinus communis
ref|XP_002317208.1|  pectin methylesterase family protein               293   9e-91    
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           284   9e-91    Vigna radiata [mung bean]
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    291   2e-90    Morus notabilis
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   291   2e-90    Nelumbo nucifera [Indian lotus]
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     292   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI24582.3|  unnamed protein product                                282   2e-90    Vitis vinifera
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   281   2e-90    
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     289   2e-90    
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               289   2e-90    
ref|XP_010534985.1|  PREDICTED: pectinesterase-like                     293   3e-90    Tarenaya hassleriana [spider flower]
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     292   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|AGG23325.1|  pectin methylesterase 1                                 292   3e-90    Musa acuminata AAA Group [Cavendish banana]
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             291   3e-90    Phaseolus vulgaris [French bean]
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   290   3e-90    Prunus mume [ume]
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 291   3e-90    Medicago truncatula
gb|ACQ85264.1|  pectin methylesterase                                   292   3e-90    Musa acuminata AAA Group [Cavendish banana]
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             293   3e-90    Phaseolus vulgaris [French bean]
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     291   3e-90    Populus euphratica
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     291   4e-90    Populus euphratica
ref|XP_011000694.1|  PREDICTED: pectinesterase                          291   4e-90    Populus euphratica
ref|XP_012090423.1|  PREDICTED: probable pectinesterase/pectinest...    290   4e-90    Jatropha curcas
ref|XP_002322401.1|  putative pectin methylesterase family protein      290   4e-90    Populus trichocarpa [western balsam poplar]
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   290   5e-90    Pyrus x bretschneideri [bai li]
ref|XP_004307817.2|  PREDICTED: pectinesterase 2-like                   290   6e-90    Fragaria vesca subsp. vesca
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     289   8e-90    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     288   1e-89    
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   285   1e-89    Citrus sinensis [apfelsine]
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 290   1e-89    Sesamum indicum [beniseed]
gb|AHC69829.1|  pectin methylesterase PME2.1                            290   2e-89    Nicotiana tabacum [American tobacco]
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 290   2e-89    Nicotiana sylvestris
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     290   2e-89    Prunus mume [ume]
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     290   2e-89    Nicotiana tomentosiformis
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   288   2e-89    Pyrus x bretschneideri [bai li]
ref|XP_010267745.1|  PREDICTED: pectinesterase                          289   3e-89    Nelumbo nucifera [Indian lotus]
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   288   3e-89    Citrus sinensis [apfelsine]
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             288   3e-89    Citrus clementina [clementine]
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     288   3e-89    Eucalyptus grandis [rose gum]
ref|XP_010321856.1|  PREDICTED: pectinesterase                          289   4e-89    Solanum lycopersicum
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   287   6e-89    Populus euphratica
gb|EPS67019.1|  pectinesterase                                          281   7e-89    Genlisea aurea
ref|XP_004148139.2|  PREDICTED: pectinesterase 2                        288   8e-89    Cucumis sativus [cucumbers]
emb|CBI38888.3|  unnamed protein product                                278   8e-89    Vitis vinifera
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                287   8e-89    Erythranthe guttata [common monkey flower]
gb|EYU46749.1|  hypothetical protein MIMGU_mgv1a0044631mg               280   8e-89    Erythranthe guttata [common monkey flower]
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     288   1e-88    Nicotiana sylvestris
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     288   1e-88    
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     288   1e-88    Nelumbo nucifera [Indian lotus]
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            287   1e-88    Morus notabilis
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   286   1e-88    Citrus sinensis [apfelsine]
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     285   2e-88    Glycine soja [wild soybean]
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   286   2e-88    Populus euphratica
ref|XP_002318285.1|  putative pectin methylesterase family protein      286   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             287   2e-88    
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     284   3e-88    
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            286   3e-88    
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   285   3e-88    Nicotiana sylvestris
gb|KJB49889.1|  hypothetical protein B456_008G143700                    286   5e-88    Gossypium raimondii
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     286   6e-88    Nelumbo nucifera [Indian lotus]
gb|AHB84678.1|  pectin methylesterase                                   286   6e-88    Citrus reticulata [mandarin orange]
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    285   6e-88    Nicotiana tomentosiformis
gb|ABZ89800.1|  pectin methylesterase-like protein                      286   6e-88    Taiwania cryptomerioides
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    286   7e-88    Citrus sinensis [apfelsine]
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     285   9e-88    Nicotiana sylvestris
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   284   1e-87    
gb|EEC82670.1|  hypothetical protein OsI_27314                          285   2e-87    Oryza sativa Indica Group [Indian rice]
emb|CBI24284.3|  unnamed protein product                                275   2e-87    Vitis vinifera
gb|KHN42767.1|  Pectinesterase 2                                        281   2e-87    Glycine soja [wild soybean]
ref|NP_001060620.1|  Os07g0675100                                       285   2e-87    
ref|XP_004136014.1|  PREDICTED: pectinesterase-like                     284   2e-87    Cucumis sativus [cucumbers]
ref|XP_008371117.1|  PREDICTED: pectinesterase                          284   2e-87    
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    284   2e-87    Cicer arietinum [garbanzo]
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             284   2e-87    Prunus persica
gb|ABK24761.1|  unknown                                                 284   3e-87    Picea sitchensis
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     284   3e-87    Nicotiana sylvestris
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             283   3e-87    Citrus clementina [clementine]
ref|XP_004143735.1|  PREDICTED: pectinesterase 2                        283   3e-87    Cucumis sativus [cucumbers]
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     284   3e-87    Nicotiana tomentosiformis
emb|CDP20891.1|  unnamed protein product                                283   3e-87    Coffea canephora [robusta coffee]
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   283   3e-87    Vitis vinifera
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    285   4e-87    Glycine max [soybeans]
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               282   4e-87    Ricinus communis
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   282   4e-87    Pyrus x bretschneideri [bai li]
ref|XP_012083609.1|  PREDICTED: pectinesterase 2 isoform X2             274   5e-87    
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   282   5e-87    Pyrus x bretschneideri [bai li]
gb|KHN25547.1|  Pectinesterase 2                                        277   5e-87    Glycine soja [wild soybean]
gb|AFW03481.1|  pectin methylesterase 2                                 282   6e-87    Gossypium hirsutum [American cotton]
gb|KGN44975.1|  Pectinesterase                                          285   6e-87    Cucumis sativus [cucumbers]
ref|NP_001275775.1|  pectinesterase 2 precursor                         281   7e-87    
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     281   7e-87    
gb|AFC98398.1|  pectin methylesterase                                   283   8e-87    
gb|ABQ42392.1|  pectin methylesterase-like protein                      284   8e-87    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     283   9e-87    
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     282   1e-86    
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    281   1e-86    
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     282   1e-86    
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    280   1e-86    
ref|XP_008389982.1|  PREDICTED: pectinesterase                          281   1e-86    
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    281   2e-86    
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    281   2e-86    
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     281   2e-86    
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    280   2e-86    
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   280   2e-86    
ref|XP_006658118.1|  PREDICTED: pectinesterase 3-like                   282   2e-86    
ref|XP_011047961.1|  PREDICTED: pectinesterase-like                     281   3e-86    
ref|XP_012072269.1|  PREDICTED: pectinesterase                          281   3e-86    
ref|XP_008224789.1|  PREDICTED: pectinesterase                          281   3e-86    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   281   3e-86    
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    281   3e-86    
ref|NP_001146685.1|  pectinesterase precursor                           281   3e-86    
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   280   4e-86    
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    281   4e-86    
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        280   5e-86    
gb|AAF16637.1|AC011661_15  T23J18.24                                    270   5e-86    
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     281   5e-86    
gb|AIZ46897.1|  pectin methylesterase                                   270   5e-86    
ref|XP_007052106.1|  Pectinesterase 2                                   279   6e-86    
gb|ACN40984.1|  unknown                                                 281   7e-86    
ref|XP_009364480.1|  PREDICTED: pectinesterase                          280   7e-86    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   279   8e-86    
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            280   1e-85    
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     279   1e-85    
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   278   1e-85    
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     281   1e-85    
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        279   1e-85    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          280   1e-85    
gb|KHN35618.1|  Pectinesterase 2                                        273   2e-85    
gb|AER38243.1|  PME2                                                    278   2e-85    
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     279   2e-85    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 276   3e-85    
emb|CDP20872.1|  unnamed protein product                                278   3e-85    
emb|CAA96435.1|  pectin methylesterase                                  271   3e-85    
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        277   3e-85    
emb|CAA96434.1|  pectin methylesterase                                  271   3e-85    
emb|CAN83663.1|  hypothetical protein VITISV_017689                     277   4e-85    
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   277   4e-85    
gb|EYU25227.1|  hypothetical protein MIMGU_mgv1a0032971mg               268   4e-85    
ref|XP_008458040.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    280   4e-85    
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             278   5e-85    
pir||S00629  pectinesterase (EC 3.1.1.11) precursor (clone PE1) -...    273   5e-85 
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   275   5e-85    
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     278   5e-85    
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        277   5e-85    
gb|KHN16553.1|  Pectinesterase 2                                        274   5e-85    
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     278   6e-85    
gb|AFW03476.1|  pectin methylesterase 2                                 277   6e-85    
gb|AAF23891.1|  pectin methyl esterase                                  277   6e-85    
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     278   6e-85    
gb|KHG19575.1|  Uncharacterized protein F383_07269                      277   6e-85    
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               277   6e-85    
emb|CDY34642.1|  BnaC08g42010D                                          275   7e-85    
ref|XP_008439965.1|  PREDICTED: pectinesterase                          278   8e-85    
ref|NP_001274785.1|  pectin methyl esterase                             277   8e-85    
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    277   8e-85    
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     276   8e-85    
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     276   8e-85    
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   276   1e-84    
ref|XP_004134752.1|  PREDICTED: pectinesterase                          277   1e-84    
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    277   1e-84    
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     276   2e-84    
ref|XP_004958677.1|  PREDICTED: pectinesterase 3-like                   278   2e-84    
gb|EPS62329.1|  pectinesterase                                          276   2e-84    
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     276   2e-84    
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     276   2e-84    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   275   2e-84    
gb|KJB41089.1|  hypothetical protein B456_007G090100                    275   3e-84    
ref|XP_002463382.1|  hypothetical protein SORBIDRAFT_02g042780          277   3e-84    
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            278   3e-84    
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    276   3e-84    
gb|AFW03479.1|  pectin methylesterase 5                                 275   3e-84    
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    276   3e-84    
ref|XP_010271283.1|  PREDICTED: pectinesterase                          275   3e-84    
emb|CAA96436.1|  pectin methylesterase                                  267   4e-84    
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               276   4e-84    
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   275   4e-84    
gb|EMS66304.1|  Pectinesterase 2.2                                      265   5e-84    
emb|CDP05792.1|  unnamed protein product                                273   5e-84    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     275   5e-84    
ref|XP_012083608.1|  PREDICTED: pectinesterase 2 isoform X1             274   5e-84    
ref|XP_003591484.1|  Pectinesterase                                     268   5e-84    
ref|XP_002314796.1|  pectin methylesterase 6 family protein             275   6e-84    
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    275   7e-84    
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     274   7e-84    
emb|CDY18942.1|  BnaC04g04080D                                          266   7e-84    
emb|CBI24285.3|  unnamed protein product                                271   8e-84    
ref|XP_004139620.2|  PREDICTED: pectinesterase-like                     275   8e-84    
ref|XP_011659194.1|  PREDICTED: pectinesterase                          275   9e-84    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     275   1e-83    
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     274   1e-83    
ref|NP_172624.1|  methylesterase PCR A                                  275   1e-83    
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    273   1e-83    
gb|AAK59760.1|  At1g11580/T23J18_33                                     274   1e-83    
gb|KJB67143.1|  hypothetical protein B456_010G177500                    274   2e-83    
ref|XP_006826911.2|  PREDICTED: pectinesterase                          273   2e-83    
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   273   2e-83    
gb|ERM94148.1|  hypothetical protein AMTR_s00010p00161740               273   2e-83    
ref|XP_003591498.1|  Pectinesterase                                     267   2e-83    
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             273   2e-83    
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    273   3e-83    
gb|AFW03484.1|  pectin methylesterase 5                                 272   3e-83    
ref|XP_011654619.1|  PREDICTED: probable pectinesterase/pectinest...    275   3e-83    
gb|EYU33104.1|  hypothetical protein MIMGU_mgv1a012115mg                264   3e-83    
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   272   3e-83    
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      272   3e-83    
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     272   3e-83    
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    272   4e-83    
emb|CAE76634.1|  pectin methylesterase                                  264   4e-83    
ref|XP_006843574.2|  PREDICTED: pectinesterase 2.1                      266   4e-83    
ref|XP_002889876.1|  At1g11580/T23J18_33                                273   4e-83    
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    272   4e-83    
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    272   5e-83    
pir||T10488  pectinesterase (EC 3.1.1.11) PECS1.2 - sweet orange ...    265   5e-83 
emb|CDP15270.1|  unnamed protein product                                274   5e-83    
ref|NP_001233948.1|  pectinesterase 2.1                                 273   5e-83    
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    270   6e-83    
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        271   6e-83    
ref|XP_007163134.1|  hypothetical protein PHAVU_001G209300g             273   6e-83    
emb|CDX83392.1|  BnaA03g21140D                                          269   6e-83    
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     272   6e-83    
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        272   6e-83    
gb|KEH15723.1|  pectinesterase                                          262   6e-83    
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 271   6e-83    
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     271   7e-83    
gb|ACN40878.1|  unknown                                                 275   8e-83    
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    265   8e-83    
ref|XP_004297462.2|  PREDICTED: pectinesterase                          274   8e-83    
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   271   8e-83    
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             272   9e-83    
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        271   9e-83    
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             272   9e-83    
emb|CDX95641.1|  BnaC03g25220D                                          269   9e-83    
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    272   9e-83    
emb|CAN76835.1|  hypothetical protein VITISV_043176                     270   1e-82    
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     270   1e-82    
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    270   1e-82    
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    271   1e-82    
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     271   1e-82    
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    271   2e-82    
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    270   2e-82    
ref|XP_003564371.1|  PREDICTED: pectinesterase                          271   2e-82    
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             269   2e-82    
gb|AAQ21127.1|  pectinesterase                                          260   2e-82    
ref|XP_006828613.2|  PREDICTED: pectinesterase                          266   2e-82    
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   270   3e-82    
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     270   3e-82    
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   270   3e-82    
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    270   3e-82    
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   270   3e-82    
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    272   3e-82    
emb|CAN78759.1|  hypothetical protein VITISV_000562                     270   3e-82    
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    269   4e-82    
ref|XP_008437596.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    272   4e-82    
gb|AAB67739.1|  pectin methylesterase PME2.1                            270   4e-82    
gb|AER38244.1|  PME5                                                    269   5e-82    
ref|XP_002321999.2|  pectin methylesterase family protein               271   5e-82    
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    269   5e-82    
ref|XP_011006351.1|  PREDICTED: probable pectinesterase/pectinest...    271   6e-82    
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    268   7e-82    
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             270   7e-82    
emb|CDM84519.1|  unnamed protein product                                266   7e-82    
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    268   7e-82    
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    270   8e-82    
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    271   8e-82    
gb|KJB30790.1|  hypothetical protein B456_005G160000                    269   8e-82    
gb|KEH21378.1|  pectinesterase                                          264   8e-82    
ref|XP_002882002.1|  predicted protein                                  268   9e-82    
ref|XP_002266980.1|  PREDICTED: pectinesterase                          269   1e-81    
ref|XP_003591482.1|  Pectinesterase                                     269   1e-81    
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    270   1e-81    
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 269   1e-81    
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     270   1e-81    
ref|NP_566379.1|  pectinesterase 25                                     260   1e-81    
emb|CDX74715.1|  BnaA05g04610D                                          266   2e-81    
ref|XP_006838619.1|  PREDICTED: pectinesterase                          268   2e-81    
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    267   2e-81    
emb|CBI23005.3|  unnamed protein product                                264   2e-81    
gb|AAM67242.1|  putative pectinesterase                                 259   2e-81    
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   267   2e-81    
ref|NP_191632.2|  putative pectinesterase/pectinesterase inhibito...    267   2e-81    
gb|KJB57711.1|  hypothetical protein B456_009G176700                    268   2e-81    
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             266   3e-81    
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    268   3e-81    
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    269   3e-81    
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   267   3e-81    
gb|EPS67025.1|  pectinesterase                                          258   3e-81    
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             268   3e-81    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                269   3e-81    
ref|XP_002876579.1|  pectinesterase family protein                      267   4e-81    
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   4e-81    
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   4e-81    
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   266   4e-81    
gb|EPS63029.1|  hypothetical protein M569_11757                         267   4e-81    
gb|EAY76103.1|  hypothetical protein OsI_04029                          267   5e-81    
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     267   5e-81    
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    266   6e-81    
gb|AAB67740.1|  PME1.9                                                  264   6e-81    
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     269   7e-81    
gb|KHN35620.1|  Pectinesterase 2                                        261   7e-81    
ref|XP_010098738.1|  Pectinesterase 3                                   268   7e-81    
ref|XP_008344546.1|  PREDICTED: probable pectinesterase/pectinest...    257   8e-81    
ref|XP_008465623.1|  PREDICTED: probable pectinesterase/pectinest...    256   8e-81    
gb|ERN05249.1|  hypothetical protein AMTR_s00007p00101250               267   8e-81    
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     267   8e-81    
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    268   9e-81    
gb|KDO36280.1|  hypothetical protein CISIN_1g027636mg                   256   9e-81    
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     267   9e-81    
ref|XP_006401715.1|  hypothetical protein EUTSA_v10013056mg             268   1e-80    
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    266   1e-80    
ref|XP_004290810.1|  PREDICTED: probable pectinesterase/pectinest...    267   1e-80    



>ref|XP_012068793.1| PREDICTED: pectinesterase-like [Jatropha curcas]
 gb|KDP40627.1| hypothetical protein JCGZ_24626 [Jatropha curcas]
Length=581

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF+INCLVAGTVDF FGN
Sbjct  365  FENTAGPSKHQAVALRVGSDLSAFYQCDMLAYQDTLYVHSNRQFFINCLVAGTVDFIFGN  424

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DLKPVQ +FPT+
Sbjct  425  AAAVLQDCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQSSFPTY  484

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQSTISDVI PAGWH WTG FALNTLTYREYQN+GAGAGT  RVTWK
Sbjct  485  LGRPWKEYSRTVIMQSTISDVIHPAGWHLWTGDFALNTLTYREYQNSGAGAGTSNRVTWK  544

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ +TP NFIAGS+WL  TTFPFSLGL
Sbjct  545  GYKVITSASEAQAFTPGNFIAGSNWLRGTTFPFSLGL  581



>ref|XP_006369079.1| pectinesterase family protein, partial [Populus trichocarpa]
 gb|ERP65648.1| pectinesterase family protein, partial [Populus trichocarpa]
Length=229

 Score =   375 bits (963),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLY HS RQF+INCL+AGTVDF FGN
Sbjct  13   FENTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYAHSNRQFFINCLIAGTVDFIFGN  72

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL PVQ +FPT+
Sbjct  73   AAAVFQDCDIHARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTY  132

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW+GTFAL+TL Y EYQN+G+GAGT  RVTW+
Sbjct  133  LGRPWKEYSRTVIMQSSITDVIQPAGWHEWSGTFALSTLFYAEYQNSGSGAGTSSRVTWE  192

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EAQ + P NFIAGSSWL ST+FPFSLGL
Sbjct  193  GYKVITSATEAQAFAPGNFIAGSSWLGSTSFPFSLGL  229



>ref|XP_010096538.1| Pectinesterase 1 [Morus notabilis]
 gb|EXB64658.1| Pectinesterase 1 [Morus notabilis]
Length=233

 Score =   374 bits (961),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+INCLVAGTVDF FGN
Sbjct  17   FQNTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDSLYVHSNRQFFINCLVAGTVDFIFGN  76

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DLKPVQ +FPT+
Sbjct  77   AAAVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQSSFPTY  136

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS IS+VI PAGWHEW+G+FALNTL YREYQNTGAGA T KRVTWK
Sbjct  137  LGRPWKEYSRTVVMQSDISNVIVPAGWHEWSGSFALNTLVYREYQNTGAGADTSKRVTWK  196

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T +SEAQ YT  NFIAG SWL +T FPFSLGL
Sbjct  197  GYKVITGASEAQQYTAGNFIAGGSWLRATGFPFSLGL  233



>emb|CDO97787.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   374 bits (961),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCD+L +QDTLY HS RQFYINCL+AGTVDF FGN
Sbjct  44   FQNTAGSSKHQAVALRVGSDLSAFYQCDILAHQDTLYAHSNRQFYINCLIAGTVDFIFGN  103

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             AAVFQDCDIHAR PGSGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+PVQ+NFPTF
Sbjct  104  GAAVFQDCDIHARLPGSGQKNMVTAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTF  163

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQST++DVIDPAGWHEW G FAL+TL Y EYQNTGAGAGT  RV WK
Sbjct  164  LGRPWKEYSRTVVMQSTVTDVIDPAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWK  223

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EAQ +TP  FI G+SWL +T FPF+LGL
Sbjct  224  GYKVITSAAEAQAFTPGRFIDGNSWLGATGFPFALGL  260



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   385 bits (988),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQFY+NCLVAGTVDF FGN
Sbjct  366  FQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PV+KNFPT+
Sbjct  426  AAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA T  RV W 
Sbjct  486  LGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWG  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ +TP  FIAG SWLSST FPF+LGL
Sbjct  546  GYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   384 bits (987),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQFY+NCLVAGTVDF FGN
Sbjct  366  FQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PV+KNFPT+
Sbjct  426  AAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA T  RV W 
Sbjct  486  LGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWG  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ +TP  FIAG SWLSST FPF+LGL
Sbjct  546  GYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   384 bits (987),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQFY+NCLVAGTVDF FGN
Sbjct  366  FQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PV+KNFPT+
Sbjct  426  AAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA T  RV W 
Sbjct  486  LGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWG  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ +TP  FIAG SWLSST FPF+LGL
Sbjct  546  GYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>gb|KJB57093.1| hypothetical protein B456_009G147900 [Gossypium raimondii]
Length=582

 Score =   384 bits (986),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQFY+NCLVAGTVDF FGN
Sbjct  366  FQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PV+KNFPT+
Sbjct  426  AAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA T  RV W 
Sbjct  486  LGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWG  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ +TP  FIAG SWLSST FPF+LGL
Sbjct  546  GYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_011048630.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=579

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQF+INCL+AGTVDF FGN
Sbjct  363  FQNTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYVHSNRQFFINCLIAGTVDFIFGN  422

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL PVQ +FPT+
Sbjct  423  AAAVFQDCDIHARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTY  482

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW+G+FAL+TL Y EYQN+GAGAGT  RVTW+
Sbjct  483  LGRPWKEYSRTVIMQSSITDVIQPAGWHEWSGSFALSTLFYAEYQNSGAGAGTSSRVTWE  542

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++E Q +TP NFIAGSSWL ST+FPFSLGL
Sbjct  543  GYRVITSATEVQEFTPGNFIAGSSWLGSTSFPFSLGL  579



>ref|XP_002304257.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79236.2| pectinesterase family protein [Populus trichocarpa]
Length=584

 Score =   384 bits (985),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF+INCLVAGTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCLVAGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+PV+ +FPT+
Sbjct  428  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGW EW+G+FALNTL Y EYQN+GAGAGT +RVTWK
Sbjct  488  LGRPWKEYSRTVIMQSSITDVIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EAQ +TP NFIAGSSWL STTFPFSLGL
Sbjct  548  GYRVITSATEAQRFTPGNFIAGSSWLRSTTFPFSLGL  584



>ref|XP_006388348.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
 gb|ERP47262.1| hypothetical protein POPTR_0214s00200g [Populus trichocarpa]
Length=579

 Score =   382 bits (982),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLY HS RQF+INCL+AGTVDF FGN
Sbjct  363  FENTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYAHSNRQFFINCLIAGTVDFIFGN  422

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL PVQ +FPT+
Sbjct  423  AAAVFQDCDIHARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTY  482

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW+GTFAL+TL Y EYQN+G+GAGT  RVTW+
Sbjct  483  LGRPWKEYSRTVIMQSSITDVIQPAGWHEWSGTFALSTLFYAEYQNSGSGAGTSSRVTWE  542

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EAQ + P NFIAGSSWL ST+FPFSLGL
Sbjct  543  GYKVITSATEAQAFAPGNFIAGSSWLGSTSFPFSLGL  579



>ref|NP_001274969.1| pectin methyl esterase [Solanum tuberosum]
 gb|AAF23892.1|AF152172_1 pectin methyl esterase [Solanum tuberosum]
Length=576

 Score =   382 bits (981),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQDTLYVHS RQF++ CLVAGTVDF FGN
Sbjct  360  FQNTAGASKHQAVALRVGSDLSAFYKCDILAYQDTLYVHSNRQFFVQCLVAGTVDFIFGN  419

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             AAV QDCDIHARRPGSGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PVQK+FPT+
Sbjct  420  GAAVLQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTY  479

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW G FALNTL Y EY NTGAGA T  RV WK
Sbjct  480  LGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFALNTLFYGEYANTGAGAATSGRVKWK  539

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TSS+EAQ YTP +FIAG SWLSST FPFSLGL
Sbjct  540  GHKVITSSTEAQAYTPGSFIAGGSWLSSTGFPFSLGL  576



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   381 bits (978),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQFY+NCLVAGTVDF F N
Sbjct  366  FQNTAGPSKHQAVALRVGSDLSAFYNCDMLAYQDTLYVHSNRQFYVNCLVAGTVDFIFEN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PV+KNFPT+
Sbjct  426  AAAVFQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQPVRKNFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTISDVI PAGWHEW+G+FAL TL Y EYQNTGAGA T  RV W 
Sbjct  486  LGRPWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWG  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ +TP  FIAG SWLSST FPF+LGL
Sbjct  546  GYKVITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|NP_001233857.2| pectinesterase/pectinesterase inhibitor U1 precursor [Solanum 
lycopersicum]
Length=583

 Score =   381 bits (978),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQF++ CLVAGTVDF FGN
Sbjct  367  FQNTAGASKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLVAGTVDFIFGN  426

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             AAVFQDCDIHARRPGSGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PVQK+FPT+
Sbjct  427  GAAVFQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTY  486

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW G FAL+TL Y EY NTGAGA T  RV WK
Sbjct  487  LGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFALDTLFYGEYANTGAGAPTSGRVKWK  546

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TSS+EAQ YTP  FIAG SWLSST FPFSLGL
Sbjct  547  GHKVITSSTEAQAYTPGRFIAGGSWLSSTGFPFSLGL  583



>ref|XP_011031815.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=580

 Score =   380 bits (976),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF+INC +AGTVDF FGN
Sbjct  364  FQNTAGPSKHQAVALRVGSDLSAFYDCDMLAYQDTLYVHSNRQFFINCFIAGTVDFIFGN  423

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+PV+ +FPT+
Sbjct  424  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVKSSFPTY  483

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGW EW+G+FALNTL Y EYQN+GAGAGT +RVTWK
Sbjct  484  LGRPWKEYSRTVIMQSSITDVIQPAGWFEWSGSFALNTLYYAEYQNSGAGAGTSRRVTWK  543

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EAQ +TP NFIAGSSWL STTFPFSLGL
Sbjct  544  GYRVITSATEAQRFTPGNFIAGSSWLRSTTFPFSLGL  580



>gb|AFI23411.1| pectin methylesterase [Coffea arabica]
Length=587

 Score =   380 bits (976),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCD+L +QDTLY HS RQFYINCL+AGTVDF FGN
Sbjct  371  FQNTAGSSKHQAVALRVGSDLSAFYQCDILAHQDTLYAHSNRQFYINCLIAGTVDFIFGN  430

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             AAVFQDCDIHAR PGSGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+PVQ+NFPTF
Sbjct  431  GAAVFQDCDIHARLPGSGQKNMVTAQGRIDPNQNTGIVIQKCRIGATSDLRPVQQNFPTF  490

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQST++DVIDPAGWHEW G FAL+TL Y EYQNTGAGAGT  RV WK
Sbjct  491  LGRPWKEYSRTVVMQSTVTDVIDPAGWHEWNGNFALSTLFYAEYQNTGAGAGTSGRVKWK  550

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EAQ +TP  FI G+SWL +T FPF+LGL
Sbjct  551  GYKVITSAAEAQAFTPGRFIDGNSWLGATGFPFALGL  587



>ref|XP_002265171.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=611

 Score =   380 bits (976),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQFYINCLVAGTVDF FGN
Sbjct  395  FQNTAGPSKHQAVALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGN  454

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDIHARRP SGQKNMLTAQGRTDPNQNTGIVIQKCRI AT DL+ V  +F T+
Sbjct  455  AAAVFQDCDIHARRPNSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTY  514

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQ++I++VIDPAGWHEW+G+FAL+TL Y EYQNTGAGAGT KRVTWK
Sbjct  515  LGRPWKEYSRTVVMQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWK  574

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS+SEAQ +TP  FIAGSSWL ST FP+SLGL
Sbjct  575  GFKVITSASEAQGFTPGTFIAGSSWLGSTGFPYSLGL  611



>emb|CAC01624.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=579

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQF+INC VAGTVDF FGN
Sbjct  363  FENTAGPSKHQAVALRVGSDLSAFYECDMLAYQDTLYVHSNRQFFINCFVAGTVDFIFGN  422

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCD HARRP SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL PVQ +FPT+
Sbjct  423  AAAVFQDCDYHARRPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLLPVQSSFPTY  482

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW+G+FAL+TL Y EYQN+GAGAGT  RV W+
Sbjct  483  LGRPWKEYSRTVIMQSSITDVIQPAGWHEWSGSFALSTLFYAEYQNSGAGAGTSSRVKWE  542

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EAQ + P NFIAGSSWL ST+FPFSLGL
Sbjct  543  GYKVITSATEAQAFAPGNFIAGSSWLGSTSFPFSLGL  579



>ref|XP_009762395.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
sylvestris]
Length=589

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQ+++ CL+AGTVDF FGN
Sbjct  373  FQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGN  432

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRPGSGQKNM+TAQGR+DPNQNTGIVIQKCRI AT DL+PVQK+FPT+
Sbjct  433  AAAVLQDCDIHARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTY  492

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGT  RV WK
Sbjct  493  LGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWK  552

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ YTP  FIAG SWLSST FPFSLGL
Sbjct  553  GFKVITSATEAQAYTPGRFIAGGSWLSSTGFPFSLGL  589



>sp|Q43143.1|PMEU1_SOLLC RecName: Full=Pectinesterase/pectinesterase inhibitor U1; Includes: 
RecName: Full=Pectinesterase inhibitor U1; AltName: Full=Pectin 
methylesterase inhibitor U1; Includes: RecName: Full=Pectinesterase 
U1; Short=PE U1; AltName: Full=Pectin methylesterase 
U1; Flags: Precursor [Solanum lycopersicum]
 gb|AAD09283.1| pectin methylesterase [Solanum lycopersicum]
 gb|AAL02367.1| pectin methylesterase [Solanum lycopersicum]
Length=583

 Score =   377 bits (969),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/217 (81%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVAL VG D SAFY+CDML YQDTLYVHS RQF++ CLVAGTVDF FGN
Sbjct  367  FQNTAGASKHQAVALCVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLVAGTVDFIFGN  426

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             AAVFQDCDIHARRPGSGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+PVQK+FPT+
Sbjct  427  GAAVFQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTY  486

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW G FAL+TL Y EY NTGAGA T  RV WK
Sbjct  487  LGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFALDTLFYGEYANTGAGAPTSGRVKWK  546

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TSS+EAQ YTP  FIAG SWLSST FPFSLGL
Sbjct  547  GHKVITSSTEAQAYTPGRFIAGGSWLSSTGFPFSLGL  583



>ref|XP_009601611.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=592

 Score =   378 bits (970),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAGHEKHQAVALRVG D SAFY+CDMLGYQDTLYVHS RQF++ C ++GTVDF FGN
Sbjct  376  FENTAGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRPG GQKNM+TAQGR DPNQNTGIVIQK RI AT DLK VQKNFPT+
Sbjct  436  AAAVLQDCDIHARRPGPGQKNMVTAQGRKDPNQNTGIVIQKSRIGATSDLKSVQKNFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQ +I+DVI P GWHEW G FAL+TL Y EY+NTGAGAGT  RV WK
Sbjct  496  LGRPWKEYSRTVIMQCSIADVISPTGWHEWNGDFALDTLFYGEYENTGAGAGTSGRVKWK  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ YTP+ FIAG+SWLSST FPF+LGL
Sbjct  556  GFKVITSATEAQDYTPNKFIAGNSWLSSTGFPFALGL  592



>ref|XP_009767827.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=593

 Score =   377 bits (969),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAGHEKHQAVALRVG D SAFY+CDMLGYQDTLYVHS RQF++ C ++GTVDF FGN
Sbjct  377  FENTAGHEKHQAVALRVGADLSAFYKCDMLGYQDTLYVHSNRQFFVQCFISGTVDFIFGN  436

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRPG GQKNM+TAQGRTDPNQNTGIVI K RI AT DLK VQKNFPT+
Sbjct  437  AAAVLQDCDIHARRPGPGQKNMVTAQGRTDPNQNTGIVIHKSRIGATSDLKSVQKNFPTY  496

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQ +I+DVI P GWHEW G FAL+TL Y EY+NTGAGAGT +RV WK
Sbjct  497  LGRPWKEYSRTVIMQCSIADVISPTGWHEWNGNFALDTLFYGEYENTGAGAGTSERVKWK  556

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ YTP+ FIAG+SWLSST FP +LGL
Sbjct  557  GFKVITSATEAQDYTPNKFIAGNSWLSSTGFPIALGL  593



>ref|XP_007024770.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
 gb|EOY27392.1| Pectin methylesterase 3 isoform 1 [Theobroma cacao]
Length=582

 Score =   377 bits (967),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLY HS RQFY+NC++AGTVDF FGN
Sbjct  366  FQNTAGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ NFPT+
Sbjct  426  AAAVFQNCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVRSNFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS ISDVI PAGWHEW+ +FAL TL Y EYQNTGAGAGT  RV W+
Sbjct  486  LGRPWKEYSRTVVMQSVISDVIHPAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWE  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ Y+P  FIAG SWLSST FPFSLGL
Sbjct  546  GYKVITSASEAQAYSPGRFIAGGSWLSSTGFPFSLGL  582



>emb|CAB95025.1| pectin methylesterase [Nicotiana tabacum]
Length=579

 Score =   377 bits (967),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQ+++ CL+AGTVDF FGN
Sbjct  363  FQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGN  422

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRPGSGQKNM+TAQGR+DPNQNTGIVIQKCRI AT DL+PVQK+FPT+
Sbjct  423  AAAVLQNCDIHARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPTY  482

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGT  RV WK
Sbjct  483  LGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWK  542

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ YTP  FIAG SWLSST FPFSLGL
Sbjct  543  GFKVITSATEAQAYTPGRFIAGGSWLSSTGFPFSLGL  579



>gb|AFK42744.1| unknown [Lotus japonicus]
Length=260

 Score =   365 bits (937),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CD L YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  44   FQNTAGPSKHQAVALRVGADLSAFYLCDFLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  103

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQDCDIHARRP SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+ +FPTF
Sbjct  104  SAVVFQDCDIHARRPNSGQKNMVTAQGRLDPNQNTGIVIQKCRIGATKDLEAVKSSFPTF  163

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS+I+DVIDPAGWHEW G FALNTL Y EY NTG GA T +RV WK
Sbjct  164  LGRPWKDYSRTVIMQSSITDVIDPAGWHEWNGNFALNTLFYGEYLNTGPGAATSRRVNWK  223

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS+SEAQ +TP+NFIAGS+WLSST FPFSLGL
Sbjct  224  GFKVITSASEAQAFTPANFIAGSTWLSSTGFPFSLGL  260



>ref|XP_004141734.1| PREDICTED: pectinesterase-like [Cucumis sativus]
 gb|KGN45437.1| hypothetical protein Csa_7G447990 [Cucumis sativus]
Length=595

 Score =   377 bits (968),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQFYINCLV+GTVDF FGN
Sbjct  379  FQNTAGPSKHQAVALRVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDFIFGN  438

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAA+FQDCDIHAR+P SGQKNM+TAQGR+DPNQNTGIVIQK RI AT DL+PVQK+FPTF
Sbjct  439  AAAIFQDCDIHARKPNSGQKNMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTF  498

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQ TISDVIDP GWHEW+G+FALNTL Y EYQNTGAGA T  RVTWK
Sbjct  499  LGRPWKEYSRTVIMQCTISDVIDPKGWHEWSGSFALNTLFYGEYQNTGAGASTGGRVTWK  558

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+ S++EA+++T   FI G SWLSST FPFSLGL
Sbjct  559  GFRVIRSATEAESFTAGKFIGGGSWLSSTGFPFSLGL  595



>gb|AAO85706.1| pectin methyl-esterase [Nicotiana benthamiana]
Length=579

 Score =   376 bits (965),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 191/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQ+++ CL+AGTVDF FGN
Sbjct  363  FQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGN  422

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRPGSGQKNM+TAQGR+DPNQNTGIVIQKCRI AT DL+PVQK+FP +
Sbjct  423  AAAVLQDCDIHARRPGSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQKSFPMY  482

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGT  RV WK
Sbjct  483  LGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWK  542

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ YTP  FIAG SWLSST FPFSLGL
Sbjct  543  GFKVITSATEAQAYTPGRFIAGGSWLSSTGFPFSLGL  579



>gb|ABE67980.1| pectin methylesterase, partial [Citrus bergamia]
Length=229

 Score =   363 bits (933),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++NCL+AGTVDF FGN
Sbjct  13   FQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGN  72

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DLKPVQ +FPT+
Sbjct  73   AAAVLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTY  132

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+I PAGWHEW G FALNTL Y E+QN+GAGAGT  RV WK
Sbjct  133  LGRPWKEYSRTVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWK  192

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS++EAQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  193  GFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL  229



>ref|XP_003627458.1| Pectinesterase [Medicago truncatula]
 gb|AET01934.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=589

 Score =   375 bits (964),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CD++ YQDTLYVH+ RQF++NC ++GTVDF FGN
Sbjct  373  FQNTAGPAKHQAVALRVGADLSAFYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGN  432

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQ+CDIHARRP SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+ NFPT+
Sbjct  433  SAVVFQNCDIHARRPNSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGVKGNFPTY  492

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQS+ISDVIDP GWHEW G FALNTL YREYQNTG GAGT KRVTWK
Sbjct  493  LGRPWKEYSRTVFMQSSISDVIDPVGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVTWK  552

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ++TP NFI GSSWL ST FPFSLGL
Sbjct  553  GFKVITSAAEAQSFTPGNFIGGSSWLGSTGFPFSLGL  589



>gb|AFQ23194.1| pectin methylesterase [Theobroma cacao]
Length=582

 Score =   374 bits (961),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLY HS RQFY+NC++AGTVDF FGN
Sbjct  366  FQNTAGPSKHQAVALRVGADLSAFYECDMLAYQDTLYAHSNRQFYVNCIIAGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V  NFPT+
Sbjct  426  AAAVFQNCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVTSNFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS ISDVI PAGWHEW+ +FAL TL Y EYQNTGAGAGT  RV W+
Sbjct  486  LGRPWKEYSRTVVMQSVISDVIHPAGWHEWSESFALRTLFYGEYQNTGAGAGTSGRVKWE  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLG  306
            GYKV+TS+SEAQ Y+P  FIAG SWLSST FPFSLG
Sbjct  546  GYKVITSASEAQAYSPGRFIAGGSWLSSTGFPFSLG  581



>emb|CBI35795.3| unnamed protein product [Vitis vinifera]
Length=670

 Score =   376 bits (966),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQFYINCLVAGTVDF FGN
Sbjct  44   FQNTAGPSKHQAVALRVGSDLSAFYKCDMLAYQDTLYVHSNRQFYINCLVAGTVDFIFGN  103

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDIHARRP SGQKNMLTAQGRTDPNQNTGIVIQKCRI AT DL+ V  +F T+
Sbjct  104  AAAVFQDCDIHARRPNSGQKNMLTAQGRTDPNQNTGIVIQKCRIGATSDLQAVISSFKTY  163

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQ++I++VIDPAGWHEW+G+FAL+TL Y EYQNTGAGAGT KRVTWK
Sbjct  164  LGRPWKEYSRTVVMQTSITNVIDPAGWHEWSGSFALSTLYYGEYQNTGAGAGTSKRVTWK  223

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS+SEAQ +TP  FIAGSSWL ST FP+SLGL
Sbjct  224  GFKVITSASEAQGFTPGTFIAGSSWLGSTGFPYSLGL  260


 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 139/219 (63%), Gaps = 6/219 (3%)
 Frame = -3

Query  956  RFKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFG  777
            RF+ TAG  KHQAVA R G D S FYQC    +QDTLY HS RQFY  C + GT+DF FG
Sbjct  457  RFENTAGAAKHQAVAFRSGSDMSVFYQCSFDAFQDTLYAHSNRQFYRECDITGTIDFIFG  516

Query  776  NAAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPT  597
            NAA VFQ C I  R+P S Q N +TAQG+ DPNQNTGI IQKC I+A   L       PT
Sbjct  517  NAAVVFQACKIQPRQPMSNQFNTITAQGKKDPNQNTGISIQKCSISALNTLTA-----PT  571

Query  596  FLGRPWKEYSRTVIMQSTISDVIDPAGWHEW-TGTFALNTLTYREYQNTGAGAGTFKRVT  420
            +LGRPWK YS T++MQS I   ++P GW EW TG    +T+ Y E+QNTG GA   +RV 
Sbjct  572  YLGRPWKAYSTTIVMQSNIGSFLNPKGWTEWVTGVDPPSTIFYAEFQNTGPGATLDQRVK  631

Query  419  WKGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            W G+    +  EA  +T   FI G+SWLS ++  F   L
Sbjct  632  WAGFMTNITEDEAAKFTVGTFIQGASWLSESSVTFDASL  670



>emb|CBI27741.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQDTLYVHSLRQF++ CLVAGTVDF FGN
Sbjct  150  FQNTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGN  209

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI AT DLKPVQ +FPT+
Sbjct  210  AAAVLQDCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTY  269

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQ++ISDVI+PAGW+ W G FAL+TL Y EYQNTGAGA T KRV WK
Sbjct  270  LGRPWKEYSRTVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWK  329

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS+SEAQ +T  +FI GSSWL ST FPFSLGL
Sbjct  330  GFKVITSASEAQAFTAGSFIGGSSWLPSTGFPFSLGL  366



>ref|XP_010273801.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=580

 Score =   373 bits (958),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D+SAFY+CDML YQDTLYVHSLRQFY++CL+ GTVDF FGN
Sbjct  364  FQNTAGPSKHQAVALRVGSDKSAFYRCDMLAYQDTLYVHSLRQFYVDCLIVGTVDFIFGN  423

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHARRP SGQKNMLTAQGR DPNQNTGIVIQ CRIAAT DL+ V+ +FPT+
Sbjct  424  AAAVFQNCDIHARRPNSGQKNMLTAQGRDDPNQNTGIVIQNCRIAATSDLQAVKSSFPTY  483

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQSTISDVI PAGWHEW+G FAL TL Y EYQNTG GA T  RV+WK
Sbjct  484  LGRPWKEYSRTVIMQSTISDVIHPAGWHEWSGNFALTTLYYAEYQNTGPGAATANRVSWK  543

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EA  +T SNFIAG SWL ST FPFS GL
Sbjct  544  GYKVITSATEALRFTVSNFIAGGSWLGSTGFPFSSGL  580



>ref|XP_009606552.1| PREDICTED: pectinesterase/pectinesterase inhibitor U1 [Nicotiana 
tomentosiformis]
Length=589

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQ+++ CL+AGTVDF FGN
Sbjct  373  FQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGN  432

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRPGSGQKNM+TAQGRTDPNQNTGIVIQ CRI AT DL+PVQK+FPT+
Sbjct  433  AAAVLQNCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQNCRIGATSDLRPVQKSFPTY  492

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGT  RV W+
Sbjct  493  LGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWR  552

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ YTP  FIAG SWL ST FPFSLGL
Sbjct  553  GFKVITSATEAQAYTPGRFIAGGSWLGSTGFPFSLGL  589



>sp|P83218.1|PME_DAUCA RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Daucus carota]
Length=319

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+INC +AGTVDF FGN
Sbjct  103  FQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGN  162

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRPGSGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+PVQ +FPT+
Sbjct  163  AAVVLQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTY  222

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS+I++VI+PAGW  W G FAL+TL Y EYQNTGAGA T  RVTWK
Sbjct  223  LGRPWKEYSRTVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWK  282

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TSS+EAQ +TP +FIAG SWL +TTFPFSLGL
Sbjct  283  GFKVITSSTEAQGFTPGSFIAGGSWLKATTFPFSLGL  319



>pdb|1GQ8|A Chain A, Pectin Methylesterase From Carrot
Length=319

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+INC +AGTVDF FGN
Sbjct  103  FQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGN  162

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRPGSGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+PVQ +FPT+
Sbjct  163  AAVVLQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTY  222

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS+I++VI+PAGW  W G FAL+TL Y EYQNTGAGA T  RVTWK
Sbjct  223  LGRPWKEYSRTVVMQSSITNVINPAGWFPWDGNFALDTLYYGEYQNTGAGAATSGRVTWK  282

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TSS+EAQ +TP +FIAG SWL +TTFPFSLGL
Sbjct  283  GFKVITSSTEAQGFTPGSFIAGGSWLKATTFPFSLGL  319



>emb|CDX97564.1| BnaA05g25150D [Brassica napus]
Length=592

 Score =   372 bits (954),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  436  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RVTWK
Sbjct  496  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVTWK  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  556  GFKVITAAAEAQPYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|NP_001265901.1| pectinesterase 3-like [Cicer arietinum]
 emb|CAE76633.2| pectin methylesterase [Cicer arietinum]
Length=584

 Score =   370 bits (951),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CD++ YQDTLYVH+ RQF++NC ++GTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGGDLSAFYNCDIIAYQDTLYVHNNRQFFVNCFISGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQ+CDIHAR+P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ ++  FPT+
Sbjct  428  SAVVFQNCDIHARKPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLEGLKGTFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVIDP GWHEW G FALNTL YREYQNTG GAGT KRV WK
Sbjct  488  LGRPWKEYSRTVIMQSSISDVIDPIGWHEWNGNFALNTLVYREYQNTGPGAGTSKRVNWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS+SEAQT+TP NFI GS+WL ST FPFSLGL
Sbjct  548  GFKVITSASEAQTFTPGNFIGGSTWLGSTGFPFSLGL  584



>ref|XP_008361835.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=233

 Score =   358 bits (919),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+  CLVAGTVDF FGN
Sbjct  17   FQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGN  76

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI AT DL+  + +F TF
Sbjct  77   AAVVLQNCDIHARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTF  136

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+IDP GWHEW+GTFALNTL Y EY NTGAGAGT KRVTWK
Sbjct  137  LGRPWKEYSRTVIMQSSITDIIDPVGWHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWK  196

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ YTP  FIAG SWLSST FPF+LGL
Sbjct  197  GFKVITSTTEAQAYTPGRFIAGGSWLSSTGFPFALGL  233



>gb|AAL24278.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
Length=388

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  172  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  231

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  232  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTY  291

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  292  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWR  351

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  352  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  388



>dbj|BAD95369.1| pectin methylesterase like protein [Arabidopsis thaliana]
Length=381

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  165  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  224

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  225  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTY  284

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  285  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWR  344

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  345  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  381



>dbj|BAD94011.1| pectin methylesterase like protein [Arabidopsis thaliana]
Length=244

 Score =   358 bits (918),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  28   FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  87

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  88   AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTY  147

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  148  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWR  207

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  208  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  244



>sp|O04886.1|PME1_CITSI RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57667.1| pectinesterase [Citrus sinensis]
Length=584

 Score =   369 bits (948),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++NCL+AGTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DLKPVQ +FPT+
Sbjct  428  AAAVLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+I PAGWHEW G FALNTL Y E+QN+GAGAGT  RV WK
Sbjct  488  LGRPWKEYSRTVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS++EAQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  548  GFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL  584



>ref|NP_001275859.1| pectinesterase 1 precursor [Citrus sinensis]
 ref|XP_006426800.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
 gb|AAB57670.1| pectinesterase [Citrus sinensis]
 gb|ESR40040.1| hypothetical protein CICLE_v10025238mg [Citrus clementina]
Length=584

 Score =   369 bits (948),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 190/217 (88%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++NCL+AGTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DLKPVQ +FPT+
Sbjct  428  AAAVLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+I PAGWHEW G FALNTL Y E+QN+GAGAGT  RV WK
Sbjct  488  LGRPWKEYSRTVIMQSSITDLIHPAGWHEWDGNFALNTLFYGEHQNSGAGAGTSGRVKWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS++EAQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  548  GFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL  584



>sp|P83948.1|PME3_CITSI RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Citrus sinensis]
Length=584

 Score =   369 bits (947),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++NCL+AGTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHAR+P SGQKNM+TAQGR DPNQNTGIVIQK RI AT DLKPVQ +FPT+
Sbjct  428  AAAVLQNCDIHARKPNSGQKNMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI PAGWHEW G FALNTL Y E+QN GAGAGT  RV WK
Sbjct  488  LGRPWKEYSRTVIMQSSITDVIHPAGWHEWDGNFALNTLFYGEHQNAGAGAGTSGRVKWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS++EAQ +TP +FIAGSSWL ST FPFSLGL
Sbjct  548  GFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL  584



>emb|CDX98441.1| BnaC05g39340D [Brassica napus]
Length=572

 Score =   369 bits (946),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  356  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  415

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  416  AAVVIQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTY  475

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFAL+TLTYREY NTGAGAGT  RVTWK
Sbjct  476  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALSTLTYREYANTGAGAGTANRVTWK  535

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  536  GFKVITAAAEAQPYTAGQFIGGGGWLSSTGFPFSLGL  572



>ref|XP_010465323.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Camelina 
sativa]
Length=592

 Score =   369 bits (947),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL PV+ +FPTF
Sbjct  436  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLLPVKGSFPTF  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  496  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  556  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|XP_008462453.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=598

 Score =   369 bits (948),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 170/217 (78%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQFYINCLV+GTVDF FGN
Sbjct  382  FQNTAGPSKHQAVALRVGADLSAFYQCDMLAYQDTLYVHSNRQFYINCLVSGTVDFIFGN  441

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAA+FQDCDIHAR+P SGQKNM+TAQGR+DPNQNTGIVIQK RI AT DL+PVQK+FPTF
Sbjct  442  AAAIFQDCDIHARKPNSGQKNMVTAQGRSDPNQNTGIVIQKSRIGATSDLRPVQKSFPTF  501

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQ +ISDVIDP GWHEW+G+FALNTL Y EYQNTG GA T  RVTWK
Sbjct  502  LGRPWKEYSRTVIMQCSISDVIDPKGWHEWSGSFALNTLFYGEYQNTGPGASTGGRVTWK  561

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+ S++EA+ +T   FI G SWL ST FPFSLGL
Sbjct  562  GFRVIRSATEAEGFTAGKFIGGGSWLRSTGFPFSLGL  598



>gb|KHN15840.1| Pectinesterase/pectinesterase inhibitor U1 [Glycine soja]
Length=362

 Score =   361 bits (926),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAF+ CD L +QDTLYVH+ RQF++ CL+ GTVDF FGN
Sbjct  146  FQNTAGPSKHQAVALRVGGDLSAFFNCDFLAFQDTLYVHNNRQFFVKCLITGTVDFIFGN  205

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQDCDIHAR P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+KNF T+
Sbjct  206  SAVVFQDCDIHARLPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTY  265

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVIDP GWHEW+G FAL+TL YREYQNTG GAGT  RVTWK
Sbjct  266  LGRPWKEYSRTVIMQSSISDVIDPIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWK  325

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EA+ YTP +FI GSSWL ST FPFSLGL
Sbjct  326  GYKVITDAAEARDYTPGSFIGGSSWLGSTGFPFSLGL  362



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   368 bits (944),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQDTLYVHSLRQF++ CLVAGTVDF FGN
Sbjct  362  FQNTAGPSKHQAVALRVGSDLSAFYRCDVLAYQDTLYVHSLRQFFVGCLVAGTVDFIFGN  421

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI AT DLKPVQ +FPT+
Sbjct  422  AAAVLQDCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTY  481

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQ++ISDVI+PAGW+ W G FAL+TL Y EYQNTGAGA T KRV WK
Sbjct  482  LGRPWKEYSRTVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWK  541

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS+SEAQ +T  +FI GSSWL ST FPFSLGL
Sbjct  542  GFKVITSASEAQAFTAGSFIGGSSWLPSTGFPFSLGL  578



>ref|XP_010501842.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Camelina 
sativa]
Length=592

 Score =   367 bits (943),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL PV+ +FPT+
Sbjct  436  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLLPVKGSFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TV+MQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  496  LGRPWKEYSQTVVMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  556  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|XP_010543030.1| PREDICTED: pectinesterase 2-like [Tarenaya hassleriana]
Length=529

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCD+L YQD+LYVHS RQF++ C++AGTVDF FGN
Sbjct  313  FENTAGPSKHQAVALRVGSDFSAFYQCDVLAYQDSLYVHSNRQFFVKCIIAGTVDFIFGN  372

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  373  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQAVKGSFPTY  432

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS ISDVI P GWHEW G FAL+TLTY EY NTGAGAGT  RVTWK
Sbjct  433  LGRPWKEYSRTVVMQSEISDVIRPEGWHEWNGNFALDTLTYGEYANTGAGAGTANRVTWK  492

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ +T   FI G SWLSST FPFSLGL
Sbjct  493  GFKVITSATEAQEFTAGQFIGGGSWLSSTGFPFSLGL  529



>ref|NP_188048.1| pectin methylesterase 3 [Arabidopsis thaliana]
 sp|O49006.2|PME3_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 3; Includes: 
RecName: Full=Pectinesterase inhibitor 3; AltName: Full=Pectin 
methylesterase inhibitor 3; Includes: RecName: Full=Pectinesterase 
3; Short=PE 3; AltName: Full=Pectin methylesterase 
27; Short=AtPME27; AltName: Full=Pectin methylesterase 
3; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01037.1| pectinesterase [Arabidopsis thaliana]
 gb|AAK59769.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAK97722.1| AT3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AAN28889.1| At3g14310/MLN21_9 [Arabidopsis thaliana]
 gb|AEE75500.1| pectin methylesterase 3 [Arabidopsis thaliana]
Length=592

 Score =   366 bits (939),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  436  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  496  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  556  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|XP_006599763.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=492

 Score =   363 bits (931),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAF+ CD L +QDTLYVH+ RQF++ CL+ GTVDF FGN
Sbjct  276  FQNTAGPSKHQAVALRVGGDLSAFFNCDFLAFQDTLYVHNNRQFFVKCLITGTVDFIFGN  335

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQDCDIHAR P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+KNF T+
Sbjct  336  SAVVFQDCDIHARLPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATKDLESVKKNFKTY  395

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVIDP GWHEW+G FAL+TL YREYQNTG GAGT  RVTWK
Sbjct  396  LGRPWKEYSRTVIMQSSISDVIDPIGWHEWSGNFALSTLVYREYQNTGPGAGTSNRVTWK  455

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EA+ YTP +FI GSSWL ST FPFSLGL
Sbjct  456  GYKVITDAAEARDYTPGSFIGGSSWLGSTGFPFSLGL  492



>gb|AAC72288.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=592

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  436  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  496  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYSNTGAGAGTANRVKWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  556  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  592



>gb|KFK38797.1| hypothetical protein AALP_AA3G161500 [Arabis alpina]
Length=593

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  377  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  436

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  437  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTY  496

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TV+MQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT  RV W+
Sbjct  497  LGRPWKEYSQTVVMQSDISDVIRPEGWAEWTGTFALNTLTYREYANRGAGAGTANRVKWR  556

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  557  GFKVITAATEAQRYTAGQFIGGGGWLSSTGFPFSLGL  593



>ref|XP_009146386.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3 [Brassica 
rapa]
Length=592

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDI ARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  436  AAVVLQDCDIPARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKSSFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTG GAGT  RVTWK
Sbjct  496  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGTGAGTANRVTWK  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  556  GFKVITAAAEAQPYTAGQFIGGGGWLSSTGFPFSLGL  592



>ref|XP_012077139.1| PREDICTED: pectinesterase-like [Jatropha curcas]
 gb|KDP33985.1| hypothetical protein JCGZ_07556 [Jatropha curcas]
Length=583

 Score =   365 bits (936),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D+SAFY+CDM+ YQDTLYVHSLRQFY++C+V G+VDF FGN
Sbjct  367  FQNTAGPSKHQAVALRVGSDQSAFYRCDMIAYQDTLYVHSLRQFYVSCIVIGSVDFIFGN  426

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRP  GQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  427  AAAVLQNCDIHARRPNPGQKNMVTAQGRTDPNQNTGIVIQKCRIGATQDLQAVKSSFPTY  486

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTVIMQ+ I+DVI+PAGW EW G FAL+TLTYREYQNTGAG+ T  RV WK
Sbjct  487  LGRPWKLYSRTVIMQTDINDVINPAGWFEWDGNFALDTLTYREYQNTGAGSDTANRVNWK  546

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KVMTS++EAQ YT  NFIAG +WLS+T FPFSLGL
Sbjct  547  GFKVMTSATEAQPYTAGNFIAGGNWLSATGFPFSLGL  583



>ref|XP_007012502.1| Pectin methylesterase 3 [Theobroma cacao]
 gb|EOY30121.1| Pectin methylesterase 3 [Theobroma cacao]
Length=573

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHSLRQFY+ CLVAGTVDF FGN
Sbjct  357  FQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYVQCLVAGTVDFIFGN  416

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL  V+ +F ++
Sbjct  417  AAAVFQNCDIHARRPNPGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFASY  476

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS ISD+I PAGW EW G FAL+TLTYRE+QNTGAGAGT  RVTWK
Sbjct  477  LGRPWKQYSRTVIMQSNISDIIHPAGWFEWNGPFALDTLTYREHQNTGAGAGTSNRVTWK  536

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+ S +EAQ YT  NFIAG SWL++T FPFSLGL
Sbjct  537  GYKVIASVTEAQGYTAGNFIAGGSWLAATGFPFSLGL  573



>ref|XP_003528739.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Glycine 
max]
Length=598

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAF+ CD+L +QDTLYVH+ RQF++ CL+AGTVDF FGN
Sbjct  382  FQNTAGPSKHQAVALRVGGDLSAFFNCDILAFQDTLYVHNNRQFFVKCLIAGTVDFIFGN  441

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQDCDIHAR P SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+KNF T+
Sbjct  442  SAVVFQDCDIHARLPSSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATNDLESVKKNFKTY  501

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVIDP GWHEW+G F L+TL YREYQNTG GAGT  RVTWK
Sbjct  502  LGRPWKEYSRTVIMQSSISDVIDPIGWHEWSGNFGLSTLVYREYQNTGPGAGTSNRVTWK  561

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EA+ YTP +FI GSSWL ST FPFSLGL
Sbjct  562  GYKVITDTAEAREYTPGSFIGGSSWLGSTGFPFSLGL  598



>ref|XP_010029512.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=587

 Score =   364 bits (935),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG   HQAVALRVG D SAFY+CD+L YQDTLYVH+ RQF++ CL+AGTVDF FGN
Sbjct  371  FQNTAGPSNHQAVALRVGADLSAFYECDILAYQDTLYVHNNRQFFVKCLIAGTVDFIFGN  430

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHAR+P  GQKNM+TAQGR DPNQNTGIVIQKCRIA T DL+ V+ +FPT+
Sbjct  431  AAVVIQDCDIHARKPNPGQKNMVTAQGRIDPNQNTGIVIQKCRIAETNDLRSVKSSFPTY  490

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVIDP GWHEW+GTFALNTL Y EYQN GAGAGT KRV WK
Sbjct  491  LGRPWKEYSRTVIMQSSISDVIDPVGWHEWSGTFALNTLYYGEYQNIGAGAGTTKRVNWK  550

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ +T  NFI G+SWLSST FPFSL L
Sbjct  551  GFKVITSATEAQGFTAGNFIGGASWLSSTGFPFSLTL  587



>ref|XP_006407094.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
 gb|ESQ48547.1| hypothetical protein EUTSA_v10020354mg [Eutrema salsugineum]
Length=592

 Score =   364 bits (934),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL  V+ +FPTF
Sbjct  436  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLLSVKSSFPTF  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT  RV WK
Sbjct  496  LGRPWKEYSQTVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANRGAGAGTANRVKWK  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WL+ST FPFSLGL
Sbjct  556  GFKVITAAAEAQRYTAGQFIGGGGWLASTGFPFSLGL  592



>ref|XP_008228105.1| PREDICTED: pectinesterase [Prunus mume]
Length=587

 Score =   363 bits (933),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 189/217 (87%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+ D+L YQD+LYVHS RQF+  CLVAGTVDF FGN
Sbjct  371  FQNTAGPSKHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGN  430

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+ V+ +F TF
Sbjct  431  AAVVLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTF  490

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISD+IDPAGWHEW+GTFAL+TL Y EY NTGAGAGT  RVTWK
Sbjct  491  LGRPWKEYSRTVIMQSSISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTSNRVTWK  550

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQT+TP +FIAG SWLSST FPFSLGL
Sbjct  551  GFKVITSATEAQTFTPGSFIAGGSWLSSTGFPFSLGL  587



>ref|XP_006297218.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
 gb|EOA30116.1| hypothetical protein CARUB_v10013226mg, partial [Capsella rubella]
Length=623

 Score =   365 bits (936),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  407  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  466

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  467  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQAVKGSFPTY  526

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W+
Sbjct  527  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWR  586

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT S FI G  WLSST FPF+LGL
Sbjct  587  GFKVITAAAEAQKYTASQFIGGGGWLSSTGFPFTLGL  623



>ref|XP_002885033.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61292.1| ATPME3 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF+I C++AGTVDF FGN
Sbjct  374  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFIKCIIAGTVDFIFGN  433

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  434  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTY  493

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY NTGAGAGT  RV W 
Sbjct  494  LGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYANTGAGAGTANRVKWG  553

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+++EAQ YT   FI G  WLSST FPFSLGL
Sbjct  554  GFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL  590



>ref|XP_010534986.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
 ref|XP_010534987.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Tarenaya 
hassleriana]
Length=587

 Score =   363 bits (931),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCD+L YQD+LYVHS RQF++ CLV GTVDF FGN
Sbjct  371  FQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDSLYVHSNRQFFVKCLVTGTVDFIFGN  430

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  431  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQSVKGSFPTY  490

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS ISDVI P GWHEWTG FALNTLTYREY N GAGAGT  RV W+
Sbjct  491  LGRPWKEYSRTVVMQSDISDVIRPEGWHEWTGNFALNTLTYREYANRGAGAGTANRVKWR  550

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ +T   FI G  WLSST FPFSLGL
Sbjct  551  GFKVITSATEAQAFTAGRFIGGGGWLSSTGFPFSLGL  587



>ref|XP_008348472.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=585

 Score =   362 bits (928),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+  CLVAGTVDF FGN
Sbjct  369  FQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGN  428

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+  + +F TF
Sbjct  429  AAVVLQNCDIHARKPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQASKSSFKTF  488

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+IDPAGWHEW+GTFAL+TL Y EY NTGAGAGT  RVTWK
Sbjct  489  LGRPWKEYSRTVIMQSSITDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTANRVTWK  548

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EA+ YTP NFIAG SWLSST FPFSL L
Sbjct  549  GFKVITSPTEAEAYTPGNFIAGGSWLSSTGFPFSLAL  585



>gb|AJH66132.1| pectin methylesterase [Malus domestica]
Length=585

 Score =   362 bits (928),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+  CLVAGTVDF FGN
Sbjct  369  FQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGN  428

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+  + +F TF
Sbjct  429  AAVVLQNCDIHARKPDSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQASKSSFKTF  488

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+IDPAGWHEW+GTFAL+TL Y EY NTGAGAGT  RVTWK
Sbjct  489  LGRPWKEYSRTVIMQSSITDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGTANRVTWK  548

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EA+ YTP NFIAG SWLSST FPFSL L
Sbjct  549  GFKVITSPTEAEAYTPGNFIAGGSWLSSTGFPFSLAL  585



>ref|XP_007217169.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
 gb|EMJ18368.1| hypothetical protein PRUPE_ppa003285mg [Prunus persica]
Length=587

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+ D+L YQD+LYVHS RQF+  CLVAGTVDF FGN
Sbjct  371  FQNTAGPSKHQAVALRVGSDLSAFYRVDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGN  430

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQK RI AT DL+ V+ +F TF
Sbjct  431  AAVVLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTF  490

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISD+IDPAGWHEW+GTFAL+TL Y EY NTGAGAG   RVTWK
Sbjct  491  LGRPWKEYSRTVIMQSAISDIIDPAGWHEWSGTFALDTLFYGEYANTGAGAGISNRVTWK  550

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQT+TP +FIAG SWLSST FPFSLGL
Sbjct  551  GFKVITSATEAQTFTPGSFIAGGSWLSSTGFPFSLGL  587



>ref|XP_007139063.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
 gb|ESW11057.1| hypothetical protein PHAVU_009G261700g [Phaseolus vulgaris]
Length=580

 Score =   360 bits (925),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD L YQDTLYVHS RQF+ NC +AG+VDF FGN
Sbjct  364  FQNTAGPSKHQAVALRVGADLSAFYRCDFLAYQDTLYVHSNRQFFSNCYIAGSVDFIFGN  423

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAV Q+ DIHARRP  GQKNM+TAQGR DPNQNTGIVIQK RI AT DL+ V+K+FPTF
Sbjct  424  SAAVIQNSDIHARRPNPGQKNMVTAQGRVDPNQNTGIVIQKSRIGATKDLESVKKSFPTF  483

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS+ISDVIDPAGWH W G FALNTL Y EYQNTG GA T +RVTWK
Sbjct  484  LGRPWKQYSRTVIMQSSISDVIDPAGWHVWDGNFALNTLFYGEYQNTGPGAATSRRVTWK  543

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ++TP+NFIAGSSWL ST FPFSLGL
Sbjct  544  GFKVITSAAEAQSFTPANFIAGSSWLPSTGFPFSLGL  580



>gb|AAR03544.1| pectin methylesterase isoform 1 [Fragaria x ananassa]
Length=224

 Score =   348 bits (892),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQA ALRVG D SAFY+CD+L YQD+LYVHS RQF+  C +AGTVDF FGN
Sbjct  8    FQNTAGPSKHQADALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFGN  67

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI AT DL+ V+ +F T+
Sbjct  68   AAVVLQNCDIHARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTY  127

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+IDPAGW+EW+GTFAL+TL Y EY NTGAGA T  RVTWK
Sbjct  128  LGRPWKEYSRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWK  187

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EAQ +TP NFIAG SWLS+T FPF+LGL
Sbjct  188  GYKVITSATEAQAFTPGNFIAGGSWLSATGFPFTLGL  224



>gb|EYU21270.1| hypothetical protein MIMGU_mgv1a003278mg [Erythranthe guttata]
Length=594

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQDTLYVHS R F++ CL+AGTVDF FGN
Sbjct  378  FQNTAGPTKHQAVALRVGSDLSAFYRCDILAYQDTLYVHSNRHFFVQCLIAGTVDFIFGN  437

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             A V QDCDIHARRP SGQKNM TAQGRTDPNQNTGIVIQKCR+ AT DL+PVQ +FPT+
Sbjct  438  GATVLQDCDIHARRPNSGQKNMFTAQGRTDPNQNTGIVIQKCRLGATSDLRPVQSSFPTY  497

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DV+  AGWHEW G FAL+TL Y E+QNTGAGAGT  RV WK
Sbjct  498  LGRPWKEYSRTVIMQSSITDVVHSAGWHEWDGNFALSTLFYGEHQNTGAGAGTSGRVNWK  557

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ+YT  +FIAG SWLSST FPFSL L
Sbjct  558  GFKVITSATEAQSYTAGSFIAGGSWLSSTGFPFSLAL  594



>emb|CDY60700.1| BnaA01g37100D [Brassica napus]
Length=556

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  340  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  399

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHARRP SGQKN++TAQGRTDPNQNTGI+IQKCRI AT DL+ V+ +FPT+
Sbjct  400  AAVVLQNCDIHARRPNSGQKNIVTAQGRTDPNQNTGIIIQKCRIGATSDLQRVRSHFPTY  459

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT +RV W+
Sbjct  460  LGRPWKEYSQTVIMQSDISDVIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWR  519

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T++SEAQ YT   FI G  WL ST FPFSLGL
Sbjct  520  GFKVITAASEAQRYTAGQFIGGGGWLRSTGFPFSLGL  556



>emb|CDY33229.1| BnaC01g37020D [Brassica napus]
Length=570

 Score =   358 bits (919),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF++ CL+AGTVDF FGN
Sbjct  354  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGN  413

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+  FPT+
Sbjct  414  AAVVLQNCDIHARQPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQRVRSYFPTY  473

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT +RV W+
Sbjct  474  LGRPWKEYSQTVIMQSDISDVIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWR  533

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T++SEAQ YT   FI G  WL ST FPFSLGL
Sbjct  534  GFKVITAASEAQRYTAGQFIGGRGWLRSTGFPFSLGL  570



>ref|XP_011078159.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
Length=567

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D  AFY+CDML YQDTLYVHSLRQFY  C++AGTVDF FGN
Sbjct  351  FQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGN  410

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRP +GQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL+PVQ +FPT+
Sbjct  411  AAAVLQNCDIHARRPNAGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTY  470

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRT++MQ+ IS+VI+PAGW+EW G FALNTL Y EYQNTGAGAGT  RVTW+
Sbjct  471  LGRPWKEYSRTIVMQTDISNVINPAGWYEWNGNFALNTLFYAEYQNTGAGAGTSNRVTWR  530

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS++EAQ +T   FIAG +WL +T FPFSLGL
Sbjct  531  GFRVLTSAAEAQPFTAGRFIAGGNWLGATGFPFSLGL  567



>ref|XP_011078160.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=567

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D  AFY+CDML YQDTLYVHSLRQFY  C++AGTVDF FGN
Sbjct  351  FQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCIIAGTVDFIFGN  410

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRP +GQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL+PVQ +FPT+
Sbjct  411  AAAVLQNCDIHARRPNAGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTY  470

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRT++MQ+ IS+VI+PAGW+EW G FALNTL Y EYQNTGAGAGT  RVTW+
Sbjct  471  LGRPWKEYSRTIVMQTDISNVINPAGWYEWNGNFALNTLFYAEYQNTGAGAGTSNRVTWR  530

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS++EAQ +T   FIAG +WL +T FPFSLGL
Sbjct  531  GFRVLTSAAEAQPFTAGRFIAGGNWLGATGFPFSLGL  567



>ref|XP_004303758.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=578

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+  C +AGTVDF FGN
Sbjct  362  FQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFGN  421

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI AT DL+ V+ +F T+
Sbjct  422  AAVVLQNCDIHARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTY  481

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+D+IDPAGW+EW+GTFAL+TL Y EY NTGAGA T  RVTWK
Sbjct  482  LGRPWKEYSRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWK  541

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++EAQ +TP NFIAG SWLS+T FPF+LGL
Sbjct  542  GYKVITSATEAQAFTPGNFIAGGSWLSATGFPFTLGL  578



>gb|AAQ21126.1| pectinesterase [Fragaria x ananassa]
Length=209

 Score =   344 bits (882),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = -3

Query  929  KHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGNAAAVFQDC  750
            KHQAVALRVG D SAFY+CD+L YQD+LYVHS RQF+  C +AGTVDF FGNAA V Q+C
Sbjct  1    KHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFEGCFIAGTVDFIFGNAAVVLQNC  60

Query  749  DIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTFLGRPWKEY  570
            DIHAR+P SGQKNMLTAQGRTDPNQNTGIVIQK RI AT DL+ V+ +F T+LGRPWKEY
Sbjct  61   DIHARKPNSGQKNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQAVKGSFKTYLGRPWKEY  120

Query  569  SRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWKGYKVMTSS  390
            SRTVIMQS+I+D+IDPAGW+EW+GTFAL+TL Y EY NTGAGA T  RVTWKGYKV+TS+
Sbjct  121  SRTVIMQSSITDIIDPAGWYEWSGTFALDTLFYAEYANTGAGASTSNRVTWKGYKVITSA  180

Query  389  SEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            +EAQ +TP NFIAG SWLS+T FPF+LGL
Sbjct  181  TEAQAFTPGNFIAGGSWLSATGFPFTLGL  209



>ref|XP_009117000.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   357 bits (916),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQF++  L AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSKRQFFVKGLTAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT DL+ V+ +FPT+
Sbjct  436  AAVVLQNCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLQRVRSHFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT +RV W+
Sbjct  496  LGRPWKEYSQTVIMQSDISDVIRPEGWFEWTGTFALNTLTYREYANKGAGAGTARRVKWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T++SEAQ YT   FI G  WL ST FPFSLGL
Sbjct  556  GFKVITAASEAQRYTAGQFIGGGGWLRSTGFPFSLGL  592



>ref|XP_008460358.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=559

 Score =   355 bits (912),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQFY+ C++ GT+DF FGN
Sbjct  343  FQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFYVQCIIVGTIDFIFGN  402

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP  GQ+NM+TAQGRTDPNQNTGIVIQKCRI  T DL+PV  NFPTF
Sbjct  403  AAAVIQDCDIHARRPNPGQRNMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTF  462

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPW+ YSRTV+MQ++IS+VIDPAGWH W G FAL+TL Y EYQN+GAGA T +RV WK
Sbjct  463  LGRPWQRYSRTVVMQTSISNVIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVRWK  522

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+T ++EA+ +T  NFI G +WLSST FPFSLGL
Sbjct  523  GFRVLTRAAEAEAFTAGNFIGGGTWLSSTGFPFSLGL  559



>ref|XP_004144447.2| PREDICTED: pectinesterase-like [Cucumis sativus]
 gb|KGN58477.1| hypothetical protein Csa_3G646640 [Cucumis sativus]
Length=561

 Score =   355 bits (911),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQFY+ C++ GT+DF FGN
Sbjct  345  FQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFYVQCIIVGTIDFIFGN  404

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP  GQ+NM+TAQGRTDPNQNTGIVIQKCRI  T DL+PV  NFPTF
Sbjct  405  AAAVIQDCDIHARRPNPGQRNMVTAQGRTDPNQNTGIVIQKCRIGTTSDLRPVISNFPTF  464

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPW+ YSRTV+MQ++IS+VIDPAGWH W G FAL+TL Y EYQN+GAGA T +RV WK
Sbjct  465  LGRPWQRYSRTVVMQTSISNVIDPAGWHVWDGNFALDTLFYAEYQNSGAGADTSRRVKWK  524

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+T ++EA+ +T  NFI G +WLSST FPFSLGL
Sbjct  525  GFRVLTRAAEAEAFTAGNFIGGGTWLSSTGFPFSLGL  561



>gb|EYU29496.1| hypothetical protein MIMGU_mgv1a003055mg [Erythranthe guttata]
Length=611

 Score =   356 bits (914),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D  AFY+CDML YQDTLYVHSLRQFY  CL+AGTVDF FGN
Sbjct  395  FQNTAGPSKHQAVALRVNADLCAFYRCDMLAYQDTLYVHSLRQFYTGCLIAGTVDFIFGN  454

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL+PVQ +FPT+
Sbjct  455  AAAVLQNCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLRPVQSSFPTY  514

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS IS+VI+PAGW  W G FALNTL Y EYQNTGAGAGT  RVTW+
Sbjct  515  LGRPWKEYSRTVVMQSEISNVINPAGWFMWDGNFALNTLFYAEYQNTGAGAGTGSRVTWR  574

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS+S+A  +T  NFI G +WLS+T FPFSLGL
Sbjct  575  GFRVLTSASQATPFTAGNFIGGGNWLSATGFPFSLGL  611



>ref|XP_009135376.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=591

 Score =   355 bits (911),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K QAVALRVG D SAFYQCDML YQDTLYVHS RQF++NCL+ GTVDF FGN
Sbjct  375  FQNTAGPSKEQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQFFVNCLIVGTVDFIFGN  434

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRPG GQKNM+TAQGRTDPNQNTGIVIQ CRI AT DL  V+ +FPT+
Sbjct  435  AAVVLQDCDIHARRPGPGQKNMVTAQGRTDPNQNTGIVIQNCRIGATSDLLSVKSSFPTY  494

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS TVIMQS ISDVI P GW EW+GTFALNTLTYREY NTGAGAGT  RV WK
Sbjct  495  LGRPWKEYSHTVIMQSDISDVIRPEGWFEWSGTFALNTLTYREYANTGAGAGTGDRVKWK  554

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
             +KV+T ++EA+ YT   FI G  WL+ST FPFSLGL
Sbjct  555  DFKVITDAAEAEPYTAGQFIGGGGWLASTGFPFSLGL  591



>emb|CDY02461.1| BnaA08g00680D [Brassica napus]
Length=336

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCD+L YQDTLYVHS RQ++I CL+AGTVDF FGN
Sbjct  120  FQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDTLYVHSNRQYFIKCLIAGTVDFIFGN  179

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI  T DL+ V+ +FPT+
Sbjct  180  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGVTSDLQSVKGSFPTY  239

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT +RV W+
Sbjct  240  LGRPWKEYSQTVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWR  299

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T++SEAQ YT   FI G  WL ST FPFSLGL
Sbjct  300  GFKVITAASEAQRYTAGQFIGGGGWLGSTGFPFSLGL  336



>emb|CDY39109.1| BnaA01g29470D [Brassica napus]
Length=558

 Score =   352 bits (904),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQ+++ CL+AGTVDF FGN
Sbjct  342  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQYFVKCLIAGTVDFIFGN  401

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI AT DL+PV+ +FPT+
Sbjct  402  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGATSDLQPVKGSFPTY  461

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT +RV W+
Sbjct  462  LGRPWKEYSQTVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWR  521

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T++SEAQ YT   FI G  WL ST FPFSLGL
Sbjct  522  GFKVITAASEAQRYTAGQFIGGGGWLGSTGFPFSLGL  558



>ref|XP_006452919.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
 gb|ESR66159.1| hypothetical protein CICLE_v10007806mg [Citrus clementina]
Length=594

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHSLRQFY +C++AGTVDF FGN
Sbjct  378  FQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYTSCIIAGTVDFIFGN  437

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI AT DL  V+ +F T+
Sbjct  438  AAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETY  497

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV+MQS ISDVI+PAGW+EW+G FAL+TL Y EYQNTGAGA T  RV W 
Sbjct  498  LGRPWKRYSRTVVMQSDISDVINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWS  557

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
             +KV+TS++EAQTYT +NFIAGS+WL ST FPFSLGL
Sbjct  558  TFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL  594



>ref|XP_009116991.1| PREDICTED: pectinesterase/pectinesterase inhibitor 3-like [Brassica 
rapa]
Length=592

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDML YQDTLYVHS RQ+++ CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYQCDMLAYQDTLYVHSNRQYFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI AT DL+PV+ +FPT+
Sbjct  436  AAVVLQNCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGATSDLQPVKGSFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT +RV W+
Sbjct  496  LGRPWKEYSQTVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T++SEAQ YT   FI G  WL ST FPFSLGL
Sbjct  556  GFKVITAASEAQRYTAGQFIGGGGWLGSTGFPFSLGL  592



>ref|XP_006828586.1| PREDICTED: pectinesterase [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDM+ YQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  348  FQNTAGPSKHQAVALRVGSDFSAFYRCDMIAYQDTLYVHSLRQFYRECFIYGTVDFIFGN  407

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDI ARRP SGQKNM+TAQGR DPNQNTGI I KCRI+A  DL PV+ +FPT+
Sbjct  408  AAAVLQNCDILARRPNSGQKNMVTAQGREDPNQNTGISIHKCRISADSDLAPVKSSFPTY  467

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQSTISDVI+PAGWHEW G FALNTL Y EYQNTGAGAGT  RV WK
Sbjct  468  LGRPWKEYSRTVIMQSTISDVINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWK  527

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEA+ +T  +FI G SWL ST FPF+ G 
Sbjct  528  GYKVITSASEAKQFTVGDFINGGSWLGSTGFPFTAGF  564



>ref|NP_001275846.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84485.1| putative thermostable pectinesterase [Citrus sinensis]
 gb|AAK84486.1| putative thermostable pectinesterase [Citrus sinensis]
Length=631

 Score =   353 bits (905),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHSLRQFY +C++AGTVDF FGN
Sbjct  415  FQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYTSCIIAGTVDFIFGN  474

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI AT DL  V+ +F T+
Sbjct  475  AAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETY  534

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV+MQS ISDVI+PAGW+EW+G FAL+TL Y EYQNTGAGA T  RV W 
Sbjct  535  LGRPWKRYSRTVVMQSDISDVINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWS  594

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
             +KV+TS++EAQTYT +NFIAGS+WL ST FPFSLGL
Sbjct  595  TFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL  631



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   350 bits (899),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K QAVALRVG D+SAFY+C+++ YQDTLYVHSLRQFY++ L+ GTVDF FGN
Sbjct  360  FQNTAGPSKDQAVALRVGSDKSAFYRCNIIAYQDTLYVHSLRQFYVDSLIVGTVDFIFGN  419

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAA+FQ+CDIHARRP  GQKNM+TAQGR DPNQNTGI+IQKCRI AT DLKPV+++FPT+
Sbjct  420  AAAIFQNCDIHARRPNRGQKNMVTAQGRDDPNQNTGIIIQKCRIGATSDLKPVKRSFPTY  479

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS I+DVI P GWH W G FALNTL Y EY+NTGAGA T KRV WK
Sbjct  480  LGRPWKEYSRTVIMQSFITDVIHPEGWHAWNGNFALNTLYYGEYRNTGAGAATAKRVKWK  539

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS++ AQ +T  NFI G  WL ST FPFS GL
Sbjct  540  GYKVITSATVAQQFTVKNFILGDHWLGSTGFPFSAGL  576



>gb|KDO73733.1| hypothetical protein CISIN_1g008261mg [Citrus sinensis]
Length=572

 Score =   350 bits (898),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHSLRQFY +C++AGTVDF FGN
Sbjct  356  FQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSLRQFYTSCIIAGTVDFIFGN  415

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI AT DL  V+ +F T+
Sbjct  416  AAAVLQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETY  475

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV+MQS ISDVI+PAGW+EW+G FAL+TL Y EYQNTGAGA T  RV W 
Sbjct  476  LGRPWKRYSRTVVMQSDISDVINPAGWYEWSGNFALDTLFYAEYQNTGAGADTSNRVKWS  535

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
             +KV+T+++EAQTYT +NFIAGS+WL ST FPFSLGL
Sbjct  536  TFKVITNAAEAQTYTAANFIAGSTWLGSTGFPFSLGL  572



>ref|XP_007135363.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
 gb|ESW07357.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
Length=1192

 Score =   365 bits (936),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CD+L YQDTLYVH+ RQF++NCL+AGTVDF FGN
Sbjct  395  FQNTAGASKHQAVALRVGGDLSAFYNCDILAYQDTLYVHNNRQFFVNCLIAGTVDFIFGN  454

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQDCDIHARRP SGQKNM+TAQGR DPNQNTGIVIQKCRI AT DL+ V+K+F T+
Sbjct  455  SAVVFQDCDIHARRPDSGQKNMVTAQGRVDPNQNTGIVIQKCRIGATSDLESVKKSFKTY  514

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVIDP GWHEW+G FAL+TL YREYQNTG GAGT  RV+WK
Sbjct  515  LGRPWKEYSRTVIMQSSISDVIDPVGWHEWSGNFALSTLVYREYQNTGPGAGTSSRVSWK  574

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+T + EA+ +TP +FI GSSWL ST FPFSLG 
Sbjct  575  GFQVITDAGEARAFTPGSFIGGSSWLGSTGFPFSLGF  611


 Score =   220 bits (560),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 134/220 (61%), Gaps = 9/220 (4%)
 Frame = -3

Query  953   FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             F   AG  KHQAVALR G DRS F++C   G+QDTLY HS RQFY +C + GT+DF FGN
Sbjct  979   FVNNAGASKHQAVALRSGSDRSVFFRCSFDGFQDTLYAHSNRQFYRDCDITGTIDFIFGN  1038

Query  773   AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNF--P  600
             AA VFQ C I  R+P   Q N +TAQG+ DPNQNTGI+IQK  I       P   N   P
Sbjct  1039  AAVVFQSCKIMPRQPLPNQFNTITAQGKKDPNQNTGIIIQKSTIT------PFGNNLTAP  1092

Query  599   TFLGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFA-LNTLTYREYQNTGAGAGTFKRV  423
             T+LGRPWK++S TVIMQS I  +++P GW  W        T+ Y EYQN+G GA   +RV
Sbjct  1093  TYLGRPWKDFSTTVIMQSDIGALLNPVGWMSWVPNVEPPTTIFYAEYQNSGPGADVSQRV  1152

Query  422   TWKGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
              W GYK   +   A+ +T  +FI G  WL +    F   L
Sbjct  1153  KWAGYKPTITDRNAEEFTVQSFIQGPEWLPNAAVQFDSTL  1192



>gb|KJB54563.1| hypothetical protein B456_009G039100 [Gossypium raimondii]
Length=567

 Score =   348 bits (893),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CD+L YQDTLYVHSLRQFY  CLVAGTVDF FGN
Sbjct  351  FQNTAGPSKHQAVALRVGSDLSAFYRCDILAYQDTLYVHSLRQFYSQCLVAGTVDFIFGN  410

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP   Q+NM+TAQGR+DPN+NTGIVIQKCRI AT DL+ V+ +F T+
Sbjct  411  AAAVLQDCDIHARRPNPNQRNMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFATY  470

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK +SRTVIMQS ISD+I PAGW  W   FAL+TLTYREYQNTG GA T  RVTWK
Sbjct  471  LGRPWKTHSRTVIMQSVISDIIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWK  530

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T+ SEAQTYT  NFI G++WL++T FPFSL L
Sbjct  531  GYSVITNISEAQTYTARNFIGGANWLNATGFPFSLDL  567



>gb|EYU29495.1| hypothetical protein MIMGU_mgv1a005211mg [Erythranthe guttata]
Length=493

 Score =   345 bits (886),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 181/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALRV  D SAF++C M+ YQDTLYVHSLRQFY  C VAGTVDF FGN
Sbjct  277  FQNSAGPSKHQAVALRVNADLSAFHRCGMIAYQDTLYVHSLRQFYTGCYVAGTVDFIFGN  336

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRP  GQKNM+TAQGR DPNQNTGIVIQKCRI AT DL PVQ +FPT+
Sbjct  337  AAAVLQNCDIHARRPNPGQKNMVTAQGRDDPNQNTGIVIQKCRIGATADLVPVQSSFPTY  396

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQ+ IS+VI+PAGW EW G FALNTL Y EY+NTGAGAGT  RVTWK
Sbjct  397  LGRPWKEYSRTVVMQTQISNVINPAGWFEWDGNFALNTLFYAEYKNTGAGAGTANRVTWK  456

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+ S +EAQ +T   FI+G SWL++T FPF+LGL
Sbjct  457  GFRVLKSDAEAQPFTAGRFISGGSWLAATGFPFTLGL  493



>emb|CDY33228.1| BnaC01g37010D [Brassica napus]
Length=592

 Score =   348 bits (893),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCD+L YQDTLYVHS RQ++I CL+AGTVDF FGN
Sbjct  376  FQNTAGPSKHQAVALRVGSDFSAFYQCDILAYQDTLYVHSNRQYFIKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQ+CRI  T DL+ V+ +FPT+
Sbjct  436  AAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQRCRIGVTSDLQSVKGSFPTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYS+TVIMQS ISDVI P GW EWTGTFALNTLTYREY N GAGAGT +RV W+
Sbjct  496  LGRPWKEYSQTVIMQSDISDVIRPEGWSEWTGTFALNTLTYREYANKGAGAGTARRVKWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T++SEAQ YT   FI G  WL ST FPFSLGL
Sbjct  556  GFKVITTASEAQRYTAGQFIGGGGWLGSTGFPFSLGL  592



>gb|AAG17110.1|AF188895_1 putative pectin methylesterase 3 [Linum usitatissimum]
Length=555

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D +AFY+CD L YQDTLYVHS RQF+INCLV GTVDF FGN
Sbjct  339  FQNTAGPSKHQAVALRVGADLAAFYRCDFLAYQDTLYVHSNRQFFINCLVVGTVDFIFGN  398

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQ+CDIHARRP  GQKNMLTA GRTDPNQNTGIVIQK RIAAT DL+ V+ +F T+
Sbjct  399  SAAVFQNCDIHARRPNPGQKNMLTAHGRTDPNQNTGIVIQKSRIAATSDLQSVKGSFGTY  458

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK Y+RTVIMQSTISDV+ PAGWHEW G FALNTL Y E++N+GAG+G   RV WK
Sbjct  459  LGRPWKAYARTVIMQSTISDVVHPAGWHEWDGNFALNTLFYGEHKNSGAGSGVNGRVKWK  518

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV++S +EA  +TP  FIAG SWL STTFPF+LGL
Sbjct  519  GHKVISSDAEAAGFTPGRFIAGGSWLGSTTFPFTLGL  555



>gb|AAC50023.1| ATPME2 precursor, partial [Arabidopsis thaliana]
Length=582

 Score =   347 bits (889),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDM  YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  366  FQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+ARRP SGQKNM+TAQGR+DPNQNTGIVIQ CRI  T DL  V+  FPT+
Sbjct  426  AAAVLQDCDINARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N G GAGT  RV WK
Sbjct  486  LGRPWKEYSRTVIMQSDISDVIRPEGWHEWSGSFALDTLTYREYLNRGGGAGTANRVKWK  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS +EAQ +T   FI G  WL+ST FPFSL L
Sbjct  546  GYKVITSDTEAQPFTAGQFIGGGGWLASTGFPFSLSL  582



>ref|NP_175786.1| pectin methylesterase 2 [Arabidopsis thaliana]
 sp|Q42534.2|PME2_ARATH RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase 2; Short=AtPME2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02856.1|AC009324_5 pectinesterase 2 [Arabidopsis thaliana]
 gb|AAK32805.1|AF361637_1 At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AAM91439.1| At1g53830/T18A20_6 [Arabidopsis thaliana]
 gb|AEE33007.1| pectin methylesterase 2 [Arabidopsis thaliana]
Length=587

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDM  YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  371  FQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDFIFGN  430

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+ARRP SGQKNM+TAQGR+DPNQNTGIVIQ CRI  T DL  V+  FPT+
Sbjct  431  AAAVLQDCDINARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTY  490

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N G GAGT  RV WK
Sbjct  491  LGRPWKEYSRTVIMQSDISDVIRPEGWHEWSGSFALDTLTYREYLNRGGGAGTANRVKWK  550

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS +EAQ +T   FI G  WL+ST FPFSL L
Sbjct  551  GYKVITSDTEAQPFTAGQFIGGGGWLASTGFPFSLSL  587



>ref|XP_010029511.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=577

 Score =   346 bits (887),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 180/217 (83%), Gaps = 1/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG   HQAVALRVG D SA Y+CD+L YQDTLYVH  RQF++ CL+AGTVDF FGN
Sbjct  362  FQNTAGPSNHQAVALRVGADLSAIYECDILAYQDTLYVHKNRQFFVKCLIAGTVDFIFGN  421

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQDCDIHAR+P  GQKNM+TAQGR DPNQNTGIVIQKCRIA T DL+ V+ +FPT+
Sbjct  422  AAVVFQDCDIHARKPDPGQKNMVTAQGRIDPNQNTGIVIQKCRIAETNDLQSVKSSFPTY  481

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVID  GWH+W GTFAL+TL Y EYQNTG GAG  KRV W 
Sbjct  482  LGRPWKEYSRTVIMQSSISDVIDEVGWHDWNGTFALDTLYYGEYQNTGTGAGISKRVNWT  541

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T +NFI+G SWLSST  PFSL L
Sbjct  542  GYKVIT-ATEAQGFTAANFISGGSWLSSTGVPFSLTL  577



>ref|XP_002516186.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG   HQAVALRV  D SAFY+CDM+ +QDTLYVH LRQFY++C+V GTVDF FGN
Sbjct  373  FQNTAGPSGHQAVALRVSADLSAFYRCDMIAFQDTLYVHRLRQFYVSCIVIGTVDFIFGN  432

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+CDIHARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL+  + +F ++
Sbjct  433  AAVVFQNCDIHARRPNPGQRNMVTAQGREDPNQNTGIVIQKCRIGATQDLEAAKNSFQSY  492

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTVIMQS ISD+I PAGW  W GTFAL+TLTYREYQNTG GA T  RVTW 
Sbjct  493  LGRPWKLYSRTVIMQSQISDIIHPAGWFMWDGTFALDTLTYREYQNTGPGANTANRVTWM  552

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKVMTS+SEA  YT  NFI+G +WLSST FPFSLGL
Sbjct  553  GYKVMTSASEALPYTAGNFISGGNWLSSTGFPFSLGL  589



>gb|AFB77928.1| pectin methylesterase [Gossypium hirsutum]
Length=567

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+C +L YQDTLYVHSLRQFY  CLVAG+VDF FGN
Sbjct  351  FQNTAGPSKHQAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGN  410

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP   Q+NM+TAQGR+DPN+NTGIVIQKCRI AT DL+ V+ +F T+
Sbjct  411  AAAVLQDCDIHARRPNPNQRNMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFETY  470

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK +SRTVIMQS ISD+I PAGW  W   FAL+TLTYREYQNTG GA T  RVTWK
Sbjct  471  LGRPWKTHSRTVIMQSVISDIIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWK  530

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T+ SEAQTYT  NFI G++WLS+T FPFSL L
Sbjct  531  GYSVITNISEAQTYTARNFIGGANWLSATGFPFSLDL  567



>gb|KHF97383.1| Pectinesterase/pectinesterase inhibitor U1 [Gossypium arboreum]
Length=567

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+C +L YQDTLYVHSLRQFY  CLVAG+VDF FGN
Sbjct  351  FQNTAGPSKHQAVALRVGSDLSAFYRCGILAYQDTLYVHSLRQFYSQCLVAGSVDFIFGN  410

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP   Q+NM+TAQGR+DPN+NTGIVIQKCRI AT DL+ V+ +F T+
Sbjct  411  AAAVLQDCDIHARRPNPNQRNMVTAQGRSDPNENTGIVIQKCRIGATSDLEAVKSDFETY  470

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK +SRTVIMQS ISD+I PAGW  W   FAL+TLTYREYQNTG GA T  RVTWK
Sbjct  471  LGRPWKTHSRTVIMQSVISDIIHPAGWFPWDKDFALDTLTYREYQNTGPGANTSSRVTWK  530

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T+ SEAQTYT  NFI G++WLS+T FPFSL L
Sbjct  531  GYSVITNISEAQTYTARNFIGGANWLSATGFPFSLDL  567



>ref|XP_012077138.1| PREDICTED: pectinesterase-like [Jatropha curcas]
 gb|KDP33984.1| hypothetical protein JCGZ_07555 [Jatropha curcas]
Length=583

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALRVG D+SAFY+C  + +QDTLYVH+LRQFY+ C++ GT+DF FGN
Sbjct  367  FQNSAGPSKHQAVALRVGSDKSAFYRCSFIAFQDTLYVHTLRQFYVKCVIIGTIDFIFGN  426

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             A V QD +IHARRP   QKNMLTAQGRTDPN+NTGIVIQ CRI AT DL+ V+ +FPT+
Sbjct  427  GAVVIQDSNIHARRPNPKQKNMLTAQGRTDPNENTGIVIQNCRIGATKDLEEVKSSFPTY  486

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRT++MQ+ ISD+I PAGW+EW G FAL+TLTYREYQNTG GA T  RV WK
Sbjct  487  LGRPWKLYSRTIVMQTYISDIIHPAGWYEWDGNFALDTLTYREYQNTGEGANTANRVNWK  546

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KVMTS+SEA+ YT  NFIAGSSWL ST FP+SLGL
Sbjct  547  GFKVMTSASEARPYTAENFIAGSSWLPSTGFPYSLGL  583



>ref|XP_010462289.1| PREDICTED: pectinesterase 2 [Camelina sativa]
Length=584

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+ARRP  GQKNM+TAQGR+DPNQNTGIVIQ CRI  T DL  V++ FPT+
Sbjct  428  AAAVLQDCDINARRPNPGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTPDLLAVKETFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N GAGAGT  RVTWK
Sbjct  488  LGRPWKEYSRTVIMQSAISDVIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EAQ YT   FI G  WL+ST FPF L L
Sbjct  548  GFKVITSVTEAQQYTAGQFIGGGGWLASTGFPFLLSL  584



>ref|XP_011072691.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=551

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 178/217 (82%), Gaps = 13/217 (6%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+CDML YQDTLYVHS RQF++ CL++GTVDF FGN
Sbjct  348  FQNTAGPSKHQAVALRVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLISGTVDFIFGN  407

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDIHARRP SGQKNM+TAQGRTDPNQNTGIVIQKCRI AT D           
Sbjct  408  AAAVFQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDW----------  457

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
               PWKEYSRTV+MQS+I+DVIDPAGWHEW G FALNTL Y EYQNTGAGA T  RV W+
Sbjct  458  ---PWKEYSRTVVMQSSITDVIDPAGWHEWNGNFALNTLFYGEYQNTGAGASTSGRVRWR  514

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++EAQ+YT   FIAG SWLSST FPFSLGL
Sbjct  515  GFKVITSATEAQSYTAGRFIAGGSWLSSTGFPFSLGL  551



>ref|XP_010479961.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   344 bits (882),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  378  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIFGN  437

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+ARRP  GQKNM+TAQGR+DPNQNTGIVIQ CRI  + DL  V++ FPT+
Sbjct  438  AAAVLQDCDINARRPNPGQKNMVTAQGRSDPNQNTGIVIQNCRIGGSPDLLAVKETFPTY  497

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N GAGAGT  RVTWK
Sbjct  498  LGRPWKEYSRTVIMQSAISDVIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWK  557

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EAQ YT   FI G  WL+ST FPF L L
Sbjct  558  GFKVITSVTEAQQYTAGQFIGGGGWLASTGFPFMLSL  594



>gb|KJB70037.1| hypothetical protein B456_011G055100 [Gossypium raimondii]
Length=579

 Score =   343 bits (880),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D +AFYQC+M+ YQDTLYVHS RQF++NCL+ GTVDF FGN
Sbjct  363  FENTAGPSKHQAVALRVSADLTAFYQCNMIAYQDTLYVHSQRQFFVNCLITGTVDFIFGN  422

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDI ARRP  GQKNM+TAQGRTD NQNTGIV QKCRI AT DL+ V+  FPT+
Sbjct  423  AAAVFQNCDIRARRPHRGQKNMVTAQGRTDRNQNTGIVFQKCRIGATSDLQSVKNKFPTY  482

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVI+QS ISDVI PAGWH+W G+FAL TL Y EYQNTGA AGT  RV W 
Sbjct  483  LGRPWKEYSRTVILQSDISDVIHPAGWHDWNGSFALKTLFYGEYQNTGASAGTHARVKWD  542

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+T+ SEAQ+YT   FI+G SWL ST FPFSL L
Sbjct  543  GHKVITNESEAQSYTAGEFISGGSWLYSTGFPFSLDL  579



>ref|XP_006371892.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
 gb|ERP49689.1| hypothetical protein POPTR_0018s05350g, partial [Populus trichocarpa]
Length=229

 Score =   331 bits (848),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVA+RVG D SAFY+CDM+ YQDTLYVHSLRQFY++C++ G+VDF FGN
Sbjct  13   FQNSAGPSKHQAVAIRVGSDLSAFYRCDMIAYQDTLYVHSLRQFYVSCIIIGSVDFIFGN  72

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQDCDIHARRP  GQKNM+TAQGR+DPN+NTGIVIQKCRI AT DL   + +F ++
Sbjct  73   AAVVFQDCDIHARRPNPGQKNMVTAQGRSDPNENTGIVIQKCRIGATQDLLAAKSSFRSY  132

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRT++MQ+ ISD+IDPAGW EW G FAL+TL YREYQNTG GA T  RV WK
Sbjct  133  LGRPWKLYSRTIVMQTEISDIIDPAGWFEWDGDFALDTLVYREYQNTGPGANTANRVNWK  192

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS+ E Q +   NFI G+SWL ST FP+S  L
Sbjct  193  GFKVVTSAIEVQPFIARNFIRGASWLPSTGFPYSFDL  229



>emb|CAB57457.2| pectin methylesterase [Nicotiana tabacum]
Length=266

 Score =   332 bits (852),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY+ D+L YQD+LYVHS RQ+++ CL+AGTVDF FGN
Sbjct  69   FQNTAGAAKHQAVALRVGSDLSAFYRRDILAYQDSLYVHSNRQYFVQCLIAGTVDFIFGN  128

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+CDIHARRPGSGQKNM+TAQGRTDPNQNTG+VIQ CRI AT DL+PVQK+FPT+
Sbjct  129  AAAVLQNCDIHARRPGSGQKNMVTAQGRTDPNQNTGVVIQNCRIGATSDLRPVQKSFPTY  188

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+I+DVI+ AGWHEW G FALNTL Y EYQNTGAGAGT  RV W+
Sbjct  189  LGRPWKEYSRTVIMQSSITDVINSAGWHEWNGNFALNTLFYGEYQNTGAGAGTSGRVKWR  248

Query  413  GYKVMTSSSEAQTYTP  366
            G+KV+TS++EAQ YTP
Sbjct  249  GFKVITSATEAQAYTP  264



>ref|XP_006392745.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
 gb|ESQ30031.1| hypothetical protein EUTSA_v10011343mg [Eutrema salsugineum]
Length=584

 Score =   343 bits (879),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI+ARRP S QKNM+TAQGR+DPNQNTGIVIQ CRI AT DL  V+ +FPT+
Sbjct  428  AAAVFQDCDINARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCRIGATSDLLAVKGSFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N G GAGT  RV WK
Sbjct  488  LGRPWKQYSRTVIMQSDISDVIRPAGWLEWSGSFALDTLTYREYLNRGGGAGTANRVKWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EA+ YT   FI G SWL+ST FPF L L
Sbjct  548  GFKVITSVTEAEQYTAGQFIGGGSWLASTGFPFLLSL  584



>ref|XP_010501045.1| PREDICTED: pectinesterase 2-like [Camelina sativa]
Length=594

 Score =   342 bits (878),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  378  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIIGTVDFIFGN  437

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+ARRP  GQKNM+TAQGR+DPNQNTGIVI  CRI  T DL  V++ FPT+
Sbjct  438  AAAVLQDCDINARRPNPGQKNMVTAQGRSDPNQNTGIVIHNCRIGGTPDLLAVKETFPTY  497

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISDVI PAGW EW+G+FAL+TLTYREY N GAGAGT  RVTWK
Sbjct  498  LGRPWKEYSRTVIMQSAISDVIRPAGWLEWSGSFALDTLTYREYLNRGAGAGTANRVTWK  557

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EAQ YT   FI G  WL+ST FPF L L
Sbjct  558  GFKVITSITEAQQYTAGQFIGGGGWLASTGFPFLLSL  594



>ref|XP_002891774.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68033.1| ATPME2 [Arabidopsis lyrata subsp. lyrata]
Length=586

 Score =   342 bits (876),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 175/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFYQCDM  YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  370  FQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDFIFGN  429

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+ARRP  GQKNM+TAQGR+DPNQNTGIVIQ CRI  T DL  V+  FPT+
Sbjct  430  AAAVLQDCDINARRPNPGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTY  489

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISDVI P GW EW+G+FAL+TLTYREY N G GAGT  RVTWK
Sbjct  490  LGRPWKEYSRTVIMQSDISDVIRPEGWLEWSGSFALDTLTYREYLNRGGGAGTTNRVTWK  549

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EAQ +T   FI G  WL+ST FPFSL L
Sbjct  550  GFKVITSDTEAQQFTAGQFIGGGGWLASTGFPFSLSL  586



>ref|XP_006307088.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
 gb|EOA39986.1| hypothetical protein CARUB_v10008673mg [Capsella rubella]
Length=584

 Score =   341 bits (875),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C + GTVDF FGN
Sbjct  368  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIVGTVDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+AR+P SGQKNM+TAQGR+DPNQNTGIVIQ  RI  T DL  V+  FPT+
Sbjct  428  AAAVLQDCDINARKPNSGQKNMVTAQGRSDPNQNTGIVIQNSRIGGTPDLSAVKGTFPTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N GAGAGT  RV WK
Sbjct  488  LGRPWKQYSRTVIMQSAISDVIRPEGWHEWSGSFALDTLTYREYLNRGAGAGTANRVKWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS +EAQ YT   FI G+ WL+ST FPF L L
Sbjct  548  GFKVITSVTEAQQYTAGQFIGGAGWLASTGFPFLLSL  584



>ref|XP_011012638.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=573

 Score =   341 bits (874),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVA+RVG D SAFY+C M+ YQDTLYVHSLRQFY++C++ G+VDF FGN
Sbjct  357  FQNSAGPSKHQAVAIRVGSDLSAFYRCGMIAYQDTLYVHSLRQFYVSCIIIGSVDFIFGN  416

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+CDIHARRP  GQKNM+TAQGR DPN+NTGIVIQKCRI AT DL   + NF ++
Sbjct  417  AAAVFQNCDIHARRPNPGQKNMVTAQGRNDPNENTGIVIQKCRIGATQDLLAEKSNFRSY  476

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRT+IMQ+ ISD+IDPAGW EW G FAL+TL YREYQNTG GA T  RV WK
Sbjct  477  LGRPWKLYSRTIIMQTEISDIIDPAGWFEWDGDFALDTLVYREYQNTGPGANTTIRVNWK  536

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+KV+TS++E Q +T  NF+ G+SWL ST+FP+SL L
Sbjct  537  GFKVVTSATEVQPFTARNFVGGASWLPSTSFPYSLDL  573



>ref|XP_011069392.1| PREDICTED: pectinesterase-like, partial [Sesamum indicum]
Length=398

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALRV  D  AFY+C+ML YQDTLYVHSLRQFY  C + GT+DF FGN
Sbjct  182  FQNSAGPSKHQAVALRVNADLCAFYRCNMLAYQDTLYVHSLRQFYTGCNIVGTIDFIFGN  241

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDI ARRP   Q+NM+TAQGR DPNQNTGIVIQKCRI AT DLKPVQ +FPT+
Sbjct  242  AAVVLQNCDIQARRPNPRQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLKPVQSSFPTY  301

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRT++MQ+ IS+VI+PAGW+EW G FALNTL Y EYQN GAGA T  RVTW+
Sbjct  302  LGRPWKKYSRTIVMQTDISNVINPAGWYEWDGNFALNTLFYAEYQNRGAGARTSNRVTWR  361

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS++EAQ +T   FIAG +WL +T FPFSLGL
Sbjct  362  GFRVLTSAAEAQPFTAGRFIAGGNWLGATGFPFSLGL  398



>ref|XP_006372149.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
 gb|ERP49946.1| hypothetical protein POPTR_0018s12530g [Populus trichocarpa]
Length=623

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG    QAVALRV  DR+AFY+C++LGYQDTL+VH+ RQF+INCL+AGTVDF FGN
Sbjct  407  FQNTAGPSNRQAVALRVSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGN  466

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+D NQNTGIVIQK RI AT DL PV+ NF  +
Sbjct  467  SAAVFQDCDIHARRPNPGQTITITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAY  526

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS+ISDVI+PAGW EW G +ALNTL Y EY N+GAGA T +RV WK
Sbjct  527  LGRPWKEYSRTVVMQSSISDVINPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWK  586

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T+++EA+++TP NFIAGS+WL STTFPFSL L
Sbjct  587  GYKVITAATEAKSFTPRNFIAGSTWLKSTTFPFSLDL  623



>ref|XP_006369081.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
 gb|ERP65650.1| hypothetical protein POPTR_0001s16280g [Populus trichocarpa]
Length=623

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG    QAVALRV  DR+AFY+C++LGYQDTL+VH+ RQF+INCL+AGTVDF FGN
Sbjct  407  FQNTAGPSNRQAVALRVSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGN  466

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+D NQNTGIVIQK RI AT DL PV+ NF  +
Sbjct  467  SAAVFQDCDIHARRPNPGQTITITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAY  526

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS+ISDVI+PAGW EW G +ALNTL Y EY N+GAGA T +RV WK
Sbjct  527  LGRPWKEYSRTVVMQSSISDVINPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWK  586

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T+++EA+++TP NFIAGS+WL STTFPFSL L
Sbjct  587  GYKVITAATEAKSFTPRNFIAGSTWLKSTTFPFSLDL  623



>ref|XP_006369080.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP65649.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=623

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG    QAVALRV  DR+AFY+C++LGYQDTL+VH+ RQF+INCL+AGTVDF FGN
Sbjct  407  FQNTAGPSNRQAVALRVSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGN  466

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+D NQNTGIVIQK RI AT DL PV+ NF  +
Sbjct  467  SAAVFQDCDIHARRPNPGQTITITAQGRSDLNQNTGIVIQKSRIHATSDLLPVRSNFSAY  526

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS+ISDVI+PAGW EW G +ALNTL Y EY N+GAGA T +RV WK
Sbjct  527  LGRPWKEYSRTVVMQSSISDVINPAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWK  586

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T+++EA+++TP NFIAGS+WL STTFPFSL L
Sbjct  587  GYKVITAATEAKSFTPRNFIAGSTWLKSTTFPFSLDL  623



>ref|XP_006389476.1| hypothetical protein POPTR_0022s002002g, partial [Populus trichocarpa]
 gb|ERP48390.1| hypothetical protein POPTR_0022s002002g, partial [Populus trichocarpa]
Length=255

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C ML YQ+TLYVHS RQF+ NC +AGTVDF FGN
Sbjct  39   FQNTAGASKYQAVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  98

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDI ARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +
Sbjct  99   SAAVFQDCDIRARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSAY  158

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGT  RV WK
Sbjct  159  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTAGRVPWK  218

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  219  GYKVITDATEAQAFTARNFITGSSWLKSTTFPFSLGL  255



>ref|XP_011048629.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=587

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG    QAVALRV  DR+AFY+C++LGYQDTL+VH+ RQF+INCL+AGT+DF FGN
Sbjct  371  FQNTAGPSGRQAVALRVSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTIDFIFGN  430

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL PV+ NF  +
Sbjct  431  SAAVFQDCDIHARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIHATSDLLPVRSNFSAY  490

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS+ISDVI+ AGW EW G +ALNTL Y EY N+GAGA T +RV WK
Sbjct  491  LGRPWKEYSRTVVMQSSISDVINRAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVNWK  550

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T+++EA+++TP NFIAG +WL STTFPFSL L
Sbjct  551  GYKVITAATEAKSFTPRNFIAGGTWLKSTTFPFSLDL  587



>ref|XP_011039649.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=548

 Score =   337 bits (864),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C MLGYQ+TLYVHS RQF+ NC +AGT+DF FGN
Sbjct  332  FQNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGN  391

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  T DL PV+ NF  +
Sbjct  392  AAAVFQDCDIRARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAY  451

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEY+RTVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGT KRVTW+
Sbjct  452  LGRPWKEYARTVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWE  511

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYK++TS++EAQ++TP NFIAGSSWL STTFPFSL L
Sbjct  512  GYKMITSATEAQSFTPRNFIAGSSWLKSTTFPFSLDL  548



>ref|XP_011039648.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=548

 Score =   337 bits (863),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C MLGYQ+TLYVHS RQF+ NC +AGT+DF FGN
Sbjct  332  FQNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGN  391

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  T DL PV+ NF  +
Sbjct  392  AAAVFQDCDIRARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAY  451

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEY+RTVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGT KRVTW+
Sbjct  452  LGRPWKEYARTVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWE  511

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYK++TS++EAQ++TP NFIAGSSWL STTFPFSL L
Sbjct  512  GYKMITSATEAQSFTPRNFIAGSSWLKSTTFPFSLDL  548



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 178/218 (82%), Gaps = 0/218 (0%)
 Frame = -3

Query  956  RFKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFG  777
            R + TAG  KHQAVALRVG D SAFY CD+LGYQDTLY+HSLRQF+  CL+ GTVDF FG
Sbjct  349  RIENTAGPSKHQAVALRVGADLSAFYDCDILGYQDTLYLHSLRQFFRGCLIQGTVDFIFG  408

Query  776  NAAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPT  597
            NAAAV QDCDI  RRP   QKNM+TA GR DPN+ TGIVI + RI A  DL PVQ +F T
Sbjct  409  NAAAVLQDCDIQVRRPNPNQKNMVTASGRDDPNEPTGIVIHRSRITAAPDLAPVQGSFRT  468

Query  596  FLGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTW  417
            +LGRPWKEY+RTVIM+S ISDVI+P GWHEW+GTFAL+TL Y EY+NTGAGAGT  RV W
Sbjct  469  YLGRPWKEYARTVIMESEISDVIEPEGWHEWSGTFALDTLYYGEYRNTGAGAGTGSRVQW  528

Query  416  KGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            KGYKV+TS++EA  +TP +FIAGSSWL +T FP+SLGL
Sbjct  529  KGYKVITSAAEAAEFTPGSFIAGSSWLEATGFPYSLGL  566



>gb|AAK69696.1|AF355057_1 putative pectin methylesterase LuPME5 [Linum usitatissimum]
Length=553

 Score =   337 bits (863),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D +AFY+CDML YQDTLYVHSLRQFY++C +AGTVDF FGN
Sbjct  337  FQNTAGPSKHQAVALRVNADFTAFYRCDMLAYQDTLYVHSLRQFYVSCFIAGTVDFIFGN  396

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+CDIHARRP SGQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL  VQ +  ++
Sbjct  397  AAVVLQNCDIHARRPNSGQRNMVTAQGRDDPNQNTGIVIQKCRIGATQDLLQVQSSVESY  456

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTVIMQ+ IS+VI PAGW  W G FAL TLTYREY NTGAG+GT  RV W 
Sbjct  457  LGRPWKMYSRTVIMQTDISNVIRPAGWFMWDGNFALATLTYREYANTGAGSGTSGRVRWG  516

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS+SEAQ + P +FI G+SWL +T FPFSL L
Sbjct  517  GYKVITSASEAQPFAPRSFIGGASWLPATGFPFSLDL  553



>emb|CAC18725.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=588

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG    QAVALRV  DR+AFY+C++LGYQDTL+VH+ RQF+INCL+AGTVDF FGN
Sbjct  372  FENTAGPSNRQAVALRVSSDRAAFYKCNVLGYQDTLHVHANRQFFINCLIAGTVDFIFGN  431

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQDCDIHARRP  GQ   +TAQGR+DPNQ TGIVIQK RI AT DL PV+ NF  +
Sbjct  432  SAVVFQDCDIHARRPNPGQTITITAQGRSDPNQKTGIVIQKSRIHATSDLLPVRSNFSAY  491

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKE+SRTV+MQS+ISDVI+ AGW EW G +ALNTL Y EY N+GAGA T +RVTWK
Sbjct  492  LGRPWKEHSRTVVMQSSISDVINRAGWLEWRGKYALNTLYYGEYNNSGAGAATSERVTWK  551

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T+++EA+++TP NFIAGS+WL STTFPFSL L
Sbjct  552  GYKVITATAEAKSFTPRNFIAGSTWLKSTTFPFSLDL  588



>ref|XP_011039646.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=548

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C MLGYQ+TLYVHS RQF+ NC +AGT+DF FGN
Sbjct  332  FQNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGN  391

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  T DL PV+ NF  +
Sbjct  392  AAAVFQDCDIRARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRGNFSAY  451

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEY+RTVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGT KRVTW+
Sbjct  452  LGRPWKEYARTVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWE  511

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYK++TS++EAQ++TP NFIAGSSWL STTFPFSL L
Sbjct  512  GYKMITSATEAQSFTPRNFIAGSSWLKSTTFPFSLDL  548



>ref|XP_002532944.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29428.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=577

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALRVG D +AFY+CDM+ YQDTLYVHS RQF+INC +AGTVDF FGN
Sbjct  366  FENKAGPSKHQAVALRVGADLAAFYECDMIAYQDTLYVHSNRQFFINCYIAGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHAR+P SGQKNM+TAQGR+DPNQNTGIVIQKCRI AT DL+PVQ +FPT+
Sbjct  426  SAAVFQDCDIHARKPNSGQKNMVTAQGRSDPNQNTGIVIQKCRIGATSDLRPVQSSFPTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQ+ ISDVI PAGWHEW+G+FAL+TL Y EYQN+GAGAGT KRV+WK
Sbjct  486  LGRPWKEYSRTVVMQTAISDVIHPAGWHEWSGSFALSTLFYGEYQNSGAGAGTSKRVSWK  545

Query  413  GYKVMTSSSEAQ  378
            G+KV+TS++EAQ
Sbjct  546  GFKVITSATEAQ  557



>ref|XP_008340373.1| PREDICTED: pectinesterase 3-like [Malus domestica]
Length=573

 Score =   337 bits (863),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -3

Query  896  DRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGNAAAVFQDCDIHARRPGSGQ  717
            D SAFY+CD+L YQD+LYVHS RQF+  CLVAGTVDF FGNAA V Q+CDIHAR+P SGQ
Sbjct  376  DLSAFYRCDILAYQDSLYVHSNRQFFEGCLVAGTVDFIFGNAAVVLQNCDIHARKPNSGQ  435

Query  716  KNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTFLGRPWKEYSRTVIMQSTIS  537
            KNMLTAQGRTDPNQNTGIVIQK RI AT DL+  + +F TFLGRPWKEYSRTVIMQS+I+
Sbjct  436  KNMLTAQGRTDPNQNTGIVIQKSRIGATSDLQASKGSFKTFLGRPWKEYSRTVIMQSSIT  495

Query  536  DVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWKGYKVMTSSSEAQTYTPSNF  357
            D+IDP GWHEW+GTFALNTL Y EY NTGAGAGT KRVTWKG+KV+TS++EAQ YTP  F
Sbjct  496  DIIDPVGWHEWSGTFALNTLFYGEYANTGAGAGTSKRVTWKGFKVITSTTEAQAYTPGXF  555

Query  356  IAGSSWLSSTTFPFSLGL  303
            IAG SWLSST FPF+LGL
Sbjct  556  IAGGSWLSSTGFPFALGL  573



>ref|XP_006387527.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP46441.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=542

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 181/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C MLGYQ+TLYVHS RQF+ NC +AGT+DF FGN
Sbjct  326  FQNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGN  385

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  T DL PV+ NF  +
Sbjct  386  AAAVFQDCDIRARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAY  445

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEY+RTVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGT KRVTW+
Sbjct  446  LGRPWKEYARTVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWE  505

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYK++TS++EAQ++TP NFI GSSWL STTFPFSL L
Sbjct  506  GYKMITSATEAQSFTPRNFIGGSSWLKSTTFPFSLDL  542



>ref|XP_006382081.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
 gb|ERP59878.1| hypothetical protein POPTR_0006s27270g [Populus trichocarpa]
Length=542

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C MLGYQ+TLYVHS RQF+ NC +AGT+DF FGN
Sbjct  326  FQNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGN  385

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  T DL PV+ NF  +
Sbjct  386  AAAVFQDCDIRARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAY  445

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEY+RTVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGT +RVTW+
Sbjct  446  LGRPWKEYARTVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSERVTWE  505

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYK++TS++EAQ++TP NFIAGSSWL STTFPFSL L
Sbjct  506  GYKMITSATEAQSFTPRNFIAGSSWLKSTTFPFSLDL  542



>ref|XP_002309641.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|EEE93164.2| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=567

 Score =   335 bits (859),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C MLGYQ+TLYVHS RQF+ NC +AGT+DF FGN
Sbjct  351  FQNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGN  410

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  T DL PV+ NF  +
Sbjct  411  AAAVFQDCDIRARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAY  470

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEY+RTVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGT +RVTW+
Sbjct  471  LGRPWKEYARTVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYKNSGAGAGTSERVTWE  530

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYK++TS++EAQ++TP NFIAGSSWL STTFPFSL L
Sbjct  531  GYKMITSATEAQSFTPRNFIAGSSWLKSTTFPFSLDL  567



>gb|KFK35693.1| hypothetical protein AALP_AA4G024900 [Arabis alpina]
Length=588

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 179/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY C+ML YQDTLYVHS RQF++ CL+ GTVDF FGN
Sbjct  372  FQNTAGPSKHQAVALRVGSDFSAFYNCEMLAYQDTLYVHSNRQFFVKCLITGTVDFIFGN  431

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDI+ARRP SGQKNM+TAQGR+DPNQNTGIVIQ CRI AT DL  V+ +FPT+
Sbjct  432  AAAVLQDCDINARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGATSDLLAVKGSFPTY  491

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS ISDVI P GWHEW+G+FAL+TLTYREY N+GAGAGT  RV WK
Sbjct  492  LGRPWKEYSRTVIMQSEISDVIRPEGWHEWSGSFALDTLTYREYLNSGAGAGTANRVKWK  551

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+TS ++AQ YT   FI G  WL ST FPF L L
Sbjct  552  GFEVITSVTDAQQYTAGQFIGGGGWLGSTGFPFLLSL  588



>ref|XP_006389479.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP48393.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C ML YQ+TLYVHS RQF+ NC +AGTVDF FGN
Sbjct  356  FQNTAGASKYQAVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  415

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +
Sbjct  416  SAAVFQDCDIHARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSAY  475

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGT  RV WK
Sbjct  476  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTSGRVPWK  535

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  536  GYKVITDATEAQAFTARNFITGSSWLKSTTFPFSLGL  572



>ref|XP_006385198.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
 gb|ERP62995.1| putative pectin methylesterase LuPME5 family protein [Populus 
trichocarpa]
Length=572

 Score =   333 bits (855),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C ML YQ+TLYVHS RQF+ NC +AGTVDF FGN
Sbjct  356  FQNTAGASKYQAVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  415

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +
Sbjct  416  SAAVFQDCDIHARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATADLQHARSNFSAY  475

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FALNTL + EY+N+G GAGT  RV WK
Sbjct  476  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGVGAGTAGRVPWK  535

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  536  GYKVITDATEAQAFTARNFITGSSWLKSTTFPFSLGL  572



>gb|KDO36003.1| hypothetical protein CISIN_1g029714mg [Citrus sinensis]
Length=189

 Score =   320 bits (820),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  869  MLGYQDTLYVHSLRQFYINCLVAGTVDFXFGNAAAVFQDCDIHARRPGSGQKNMLTAQGR  690
            ML YQDTLYVHS RQF++NCL+AGTVDF FGNAAAV Q+CDIHAR+P SGQKNM+TAQGR
Sbjct  1    MLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKPNSGQKNMVTAQGR  60

Query  689  TDPNQNTGIVIQKCRIAATFDLKPVQKNFPTFLGRPWKEYSRTVIMQSTISDVIDPAGWH  510
             DPNQNTGIVIQK RI AT DLKPVQ +FPT+LGRPWKEYSRTVIMQS+I+DVI PAGWH
Sbjct  61   ADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDVIHPAGWH  120

Query  509  EWTGTFALNTLTYREYQNTGAGAGTFKRVTWKGYKVMTSSSEAQTYTPSNFIAGSSWLSS  330
            EW G FALNTL Y E+QN GAGAGT  RV WKG++V+TS++EAQ +TP +FIAGSSWL S
Sbjct  121  EWDGNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWLGS  180

Query  329  TTFPFSLGL  303
            T FPFSLGL
Sbjct  181  TGFPFSLGL  189



>ref|XP_011039647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=565

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 180/217 (83%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C MLGYQ+TLYVHS RQF+ NC +AGT+DF FGN
Sbjct  349  FQNTAGPSKYQAVALRVESDFAAFYKCGMLGYQNTLYVHSNRQFFRNCFIAGTIDFIFGN  408

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQDCDI ARRP  GQ   +TAQGR+DP QNTGIVIQKCRI  T DL PV+ NF  +
Sbjct  409  AAAVFQDCDIRARRPNPGQTITITAQGRSDPTQNTGIVIQKCRIGVTSDLHPVRSNFSAY  468

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEY+RTVIMQS+ISDVI PAGW+   G FAL+TL++ EY+N+GAGAGT KRVTW+
Sbjct  469  LGRPWKEYARTVIMQSSISDVIHPAGWNGLKGRFALSTLSFAEYENSGAGAGTSKRVTWE  528

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYK++TS++EAQ++TP NFI GSSWL STTFPF L L
Sbjct  529  GYKMITSATEAQSFTPRNFIGGSSWLKSTTFPFCLDL  565



>emb|CDY08206.1| BnaA05g14130D [Brassica napus]
Length=585

 Score =   333 bits (853),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 174/217 (80%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C +AGTVDF FGN
Sbjct  369  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDFIFGN  428

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDC I+ARRP S QKNM+TAQGR+DPNQNTGIVIQ C+I AT DL  V+ +F T+
Sbjct  429  AAAVLQDCVINARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTY  488

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS ISDVI P GW EW+G FAL+TLTYREY N GAG+GT  RV WK
Sbjct  489  LGRPWKQYSRTVIMQSDISDVIRPEGWLEWSGDFALDTLTYREYLNRGAGSGTANRVKWK  548

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+ +EAQ YT   FI G  WL ST FPFSL L
Sbjct  549  GYQVITNVTEAQQYTAGQFIGGEGWLGSTGFPFSLSL  585



>ref|XP_009123661.1| PREDICTED: pectinesterase 2 [Brassica rapa]
Length=604

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 174/217 (80%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C +AGTVDF FGN
Sbjct  388  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDFIFGN  447

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDC I+ARRP S QKNM+TAQGR+DPNQNTGIVIQ C+I AT DL  V+ +F T+
Sbjct  448  AAAVLQDCVINARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTY  507

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS ISDVI P GW EW+G FAL+TLTYREY N GAG+GT  RV WK
Sbjct  508  LGRPWKQYSRTVIMQSDISDVIRPEGWLEWSGDFALDTLTYREYLNRGAGSGTANRVKWK  567

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+ +EAQ YT   FI G  WL ST FPFSL L
Sbjct  568  GYQVITNVTEAQQYTAGQFIGGEGWLGSTGFPFSLSL  604



>ref|XP_011003715.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=575

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C +L YQ+TLYVHS RQF+ NC +AGTVDF FGN
Sbjct  359  FQNTAGASKYQAVALRVESDFAAFYKCGILAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  418

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +
Sbjct  419  SAAVFQDCDIHARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATRDLQHARSNFSAY  478

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FAL+TL + EY+N+GAGAGT  RV WK
Sbjct  479  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALDTLHFAEYENSGAGAGTSGRVPWK  538

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  539  GYKVITDATEAQAFTARNFITGSSWLKSTTFPFSLGL  575



>ref|XP_006385197.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
 gb|ERP62994.1| hypothetical protein POPTR_0003s00980g [Populus trichocarpa]
Length=572

 Score =   332 bits (850),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C ML YQ+TLYVHS RQF+ NC +AGTVDF FGN
Sbjct  356  FQNTAGASKYQAVALRVESDFAAFYKCGMLAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  415

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDI ARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +
Sbjct  416  SAAVFQDCDIRARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATADLQHARSNFSAY  475

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGT  RV WK
Sbjct  476  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTAGRVPWK  535

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  536  GYKVITDTTEAQAFTARNFITGSSWLKSTTFPFSLGL  572



>emb|CDY51798.1| BnaC06g41940D [Brassica napus]
Length=585

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 173/217 (80%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAFY CDML YQDTLYVHS RQF++ C +AGTVDF FGN
Sbjct  369  FQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCHIAGTVDFIFGN  428

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDC I+ARRP S QKNM+TAQGR+DPNQNTGIVIQ C+I AT DL  V+ +F T+
Sbjct  429  AAAVLQDCVINARRPNSNQKNMVTAQGRSDPNQNTGIVIQNCKIGATSDLMAVKGSFSTY  488

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS ISDVI P GW EW+G FAL+TLTYREY N GAGAGT  RV WK
Sbjct  489  LGRPWKQYSRTVIMQSDISDVIRPEGWLEWSGDFALDTLTYREYLNRGAGAGTANRVKWK  548

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+ +EAQ YT   FI G  WL ST FPF L L
Sbjct  549  GYQVITNVTEAQQYTAGQFIGGEGWLGSTGFPFLLSL  585



>ref|XP_011047860.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=574

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C +L YQ+TLYVHS RQF+ NC +AGTVDF FGN
Sbjct  358  FQNTAGASKYQAVALRVESDFAAFYKCGILAYQNTLYVHSNRQFFTNCYIAGTVDFIFGN  417

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDIHARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +
Sbjct  418  SAAVFQDCDIHARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATRDLQHARSNFSAY  477

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FAL+TL + EY+N+GAGAGT  RV WK
Sbjct  478  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALDTLHFAEYENSGAGAGTAGRVPWK  537

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  538  GYKVITDATEAQAFTARNFITGSSWLKSTTFPFSLGL  574



>ref|XP_010047425.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=585

 Score =   330 bits (847),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 175/217 (81%), Gaps = 1/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAF++CDML YQDTLYVHSLRQFY+ CLVAGTVDF FGN
Sbjct  370  FQNTAGPSKHQAVALRVGADFSAFHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFIFGN  429

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL  V+ +F T+
Sbjct  430  AAAVLQDCDIHARRPNPGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTY  489

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTVIMQ+ ISDVI+PAGW+EW G FAL+TL Y E+ NTG GA T  RVTWK
Sbjct  490  LGRPWKMYSRTVIMQTAISDVINPAGWYEWNGNFALDTLYYAEHANTGPGASTANRVTWK  549

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ S+ EAQ +T + FI   SWL  T FP+  GL
Sbjct  550  GYRVI-SAPEAQPFTANQFIVAGSWLKPTGFPYYPGL  585



>ref|XP_008800483.1| PREDICTED: pectinesterase 3-like isoform X2 [Phoenix dactylifera]
Length=262

 Score =   320 bits (819),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 170/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  956  RFKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFG  777
            R + TAG  KHQAVALRVG D SAFY CD++GYQDTLY+HSLR F+ +CL+ GTVDF FG
Sbjct  43   RIQNTAGPSKHQAVALRVGSDLSAFYDCDIIGYQDTLYLHSLRHFFRSCLIQGTVDFIFG  102

Query  776  NAAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPT  597
            NAA V QDCDI  RRP + QKNM+TA GR DPN+ TGI I + RI A  DL+PV+ +F +
Sbjct  103  NAATVLQDCDIQVRRPNANQKNMVTADGRDDPNEPTGIAIHRSRITAAPDLEPVKSSFRS  162

Query  596  FLGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTW  417
            +LGRPWKEYSR VIM+S ISDVIDPAGWHEW G F L+TL Y EY+NTGAGAGT  RV W
Sbjct  163  YLGRPWKEYSRAVIMESEISDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKW  222

Query  416  KGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            KGY+V+T   EA+ + P N + GS+WL ST FP+SLGL
Sbjct  223  KGYRVLTDVQEAKQFAPGNLLGGSNWLDSTGFPYSLGL  260



>ref|XP_010685210.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=592

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 174/217 (80%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D +AFYQCD+L YQDTLYVH  RQF++ CL+AGTVDF FGN
Sbjct  376  FENTAGPSKHQAVALRVGADLAAFYQCDILAYQDTLYVHKNRQFFVKCLIAGTVDFIFGN  435

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQDCDIHAR+P S QKNM+TAQ RTD NQNTGIVIQKCRI  T DL+  + +F T+
Sbjct  436  AAVVFQDCDIHARKPNSNQKNMITAQSRTDINQNTGIVIQKCRIDGTSDLQATKNSFSTY  495

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQS ISDV+   GWHEW G +AL TL Y EY+N+G GA T KRV W+
Sbjct  496  LGRPWKDYSRTVIMQSFISDVVHENGWHEWEGEYALKTLHYMEYKNSGPGADTSKRVQWR  555

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G + ++   +AQ +TP NFIAG SWL+STTFP+SLGL
Sbjct  556  GVQEISEVDKAQEFTPGNFIAGGSWLASTTFPYSLGL  592



>ref|XP_010047423.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=578

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRVG D SAF++CDML YQDTLYVHSLRQFY+ CLVAGTVDF FGN
Sbjct  363  FQNTAGPSKHQAVALRVGADFSAFHRCDMLAYQDTLYVHSLRQFYVGCLVAGTVDFIFGN  422

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP  GQ+NM+TAQGR DPNQNTGIVIQKCRI AT DL  V+ +F T+
Sbjct  423  AAAVLQDCDIHARRPNPGQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFQTY  482

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTVIMQ+ ISDVI+P GW+EW G FAL+TL Y E+ NTG GA T  RVTWK
Sbjct  483  LGRPWKMYSRTVIMQTEISDVINPTGWYEWDGNFALDTLYYAEHANTGPGASTANRVTWK  542

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ S+ EAQ +T + FI   SWL  T FP+  GL
Sbjct  543  GYRVI-SAPEAQPFTANQFIVAGSWLKPTGFPYYPGL  578



>emb|CAC18727.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=536

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 175/217 (81%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C ++ YQ+TL+VHS RQF+ N  +AGTVDF FGN
Sbjct  320  FQNTAGASKYQAVALRVESDFAAFYKCGVVAYQNTLHVHSNRQFFTNSYIAGTVDFIFGN  379

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDI ARRP  GQ   +TAQGR+DPNQNTGIVIQK RI AT DL+  + NF  +
Sbjct  380  SAAVFQDCDIRARRPNPGQTITITAQGRSDPNQNTGIVIQKSRIGATPDLQHARSNFSVY  439

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FALNTL + EY+N+GAGAGT  RV WK
Sbjct  440  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALNTLHFAEYENSGAGAGTSGRVPWK  499

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  500  GYKVITDATEAQAFTARNFITGSSWLKSTTFPFSLGL  536



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   323 bits (828),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 170/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  956  RFKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFG  777
            R + TAG  KHQAVALRVG D SAFY CD++GYQDTLY+HSLR F+ +CL+ GTVDF FG
Sbjct  366  RIQNTAGPSKHQAVALRVGSDLSAFYDCDIIGYQDTLYLHSLRHFFRSCLIQGTVDFIFG  425

Query  776  NAAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPT  597
            NAA V QDCDI  RRP + QKNM+TA GR DPN+ TGI I + RI A  DL+PV+ +F +
Sbjct  426  NAATVLQDCDIQVRRPNANQKNMVTADGRDDPNEPTGIAIHRSRITAAPDLEPVKSSFRS  485

Query  596  FLGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTW  417
            +LGRPWKEYSR VIM+S ISDVIDPAGWHEW G F L+TL Y EY+NTGAGAGT  RV W
Sbjct  486  YLGRPWKEYSRAVIMESEISDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKW  545

Query  416  KGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            KGY+V+T   EA+ + P N + GS+WL ST FP+SLGL
Sbjct  546  KGYRVLTDVQEAKQFAPGNLLGGSNWLDSTGFPYSLGL  583



>emb|CAC18726.1| putative pectin methylesterase [Populus tremula x Populus tremuloides]
Length=574

 Score =   322 bits (826),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 174/217 (80%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  K+QAVALRV  D +AFY+C M+ YQ+TL+VHS RQF+ NC +AGTVDF FGN
Sbjct  358  FQNTAGASKYQAVALRVESDFAAFYKCGMVAYQNTLHVHSNRQFFTNCYIAGTVDFIFGN  417

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAVFQDCDI ARR   GQ   +TAQGR+DPNQNTGIVIQK RI  T DL+  + NF  F
Sbjct  418  SAAVFQDCDIRARRANPGQTITITAQGRSDPNQNTGIVIQKSRIGGTPDLQHARSNFSAF  477

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIMQS+ISDVI PAGW EW G FAL+TL + EY+N+GAGAGT  RV WK
Sbjct  478  LGRPWKEYSRTVIMQSSISDVISPAGWREWKGRFALDTLHFAEYENSGAGAGTSGRVPWK  537

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T ++EAQ +T  NFI GSSWL STTFPFSLGL
Sbjct  538  GYKVITDATEAQAFTARNFITGSSWLKSTTFPFSLGL  574



>ref|XP_010534984.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=567

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG    QAVALRVG D+SAFY+C++  YQDTLYVHS RQF++ C V+GTVDF FGN
Sbjct  351  FENTAGPSNDQAVALRVGSDKSAFYRCNISAYQDTLYVHSKRQFFVKCHVSGTVDFIFGN  410

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQDCDIHARRP   Q+NM+TAQGRTDPNQNTGIVIQ CRI AT DL+  + +FPT+
Sbjct  411  AAVVFQDCDIHARRPNPEQRNMVTAQGRTDPNQNTGIVIQNCRIGATLDLREAEDDFPTY  470

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK +SRTV+MQS ISDVI P GWH W G FAL+TL YREY N G GA T  RV WK
Sbjct  471  LGRPWKRFSRTVVMQSDISDVIRPEGWHLWNGNFALDTLIYREYANRGPGANTEFRVNWK  530

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+T   EA+ YT   FI G+ WLS T FPF+L L
Sbjct  531  GFEVITDPEEAEEYTADRFIDGADWLSETGFPFNLAL  567



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score =   320 bits (821),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 170/218 (78%), Gaps = 0/218 (0%)
 Frame = -3

Query  956  RFKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFG  777
            R + TAG  KHQAVALRV  D SAFY CD++GYQDTLY+HSLR F+ +CL+ GTVDF FG
Sbjct  372  RIENTAGPSKHQAVALRVSSDLSAFYDCDLIGYQDTLYLHSLRHFFRSCLIQGTVDFIFG  431

Query  776  NAAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPT  597
            NAA V QDCDI  RRP   QKNM+TA GR DPN+ TGI I + RIAA  DL+PV+ +F +
Sbjct  432  NAATVLQDCDIQLRRPNPNQKNMVTADGRDDPNEPTGITIHRSRIAAAPDLEPVKSSFRS  491

Query  596  FLGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTW  417
            +LGRPWKE+SRTVIM+S I DVIDPAGWHEW G FAL+TL Y EY+NTGAGAGT  RV W
Sbjct  492  YLGRPWKEHSRTVIMESDIGDVIDPAGWHEWNGPFALDTLYYGEYKNTGAGAGTAGRVKW  551

Query  416  KGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
             GY+V+T   EA+ +TP N + GS+WL ST FP+SLGL
Sbjct  552  NGYRVLTDVREAEQFTPGNLLGGSNWLGSTGFPYSLGL  589



>ref|XP_010047424.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=564

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D SAFY+C ML YQDTLYVHSLRQFY  C +AGTVDF FGN
Sbjct  349  FENTAGPSKHQAVALRVNSDFSAFYRCCMLAYQDTLYVHSLRQFYFGCFIAGTVDFIFGN  408

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDCDIHARRP   Q+NM+TAQGR DPNQNTGIVIQ+CRI AT DL   + +F ++
Sbjct  409  AAAVLQDCDIHARRPNPSQRNMVTAQGRDDPNQNTGIVIQRCRIGATSDLLEAKDSFESY  468

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTVIMQ+ ISD+I PAGW+ W G FAL+TL Y E+ NTG GA T  RVTWK
Sbjct  469  LGRPWKMYSRTVIMQTVISDIIHPAGWYPWDGDFALDTLYYAEHANTGDGADTANRVTWK  528

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ S+SEAQ +T   FI G SWL ST FP+  GL
Sbjct  529  GYRVI-SASEAQAFTVDPFITGGSWLDSTGFPYYPGL  564



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+  C + GT+DF FGN
Sbjct  10   IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFVFGN  69

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A V Q C+++ARRP + Q N+ TAQGRTDPNQNTGI IQKC++AA  DL  VQ +F T+
Sbjct  70   SAVVLQSCNLYARRPLASQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLAAVQTSFRTY  129

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV +QS +  V+DP GW EW GTFAL+TL Y EYQNTGAGA T  RV WK
Sbjct  130  LGRPWKQYSRTVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGAGASTSNRVKWK  189

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V++SSSEA T+T  +FI G  WL+ T+ PFS GL
Sbjct  190  GYRVISSSSEASTFTVGSFIDGDVWLAGTSIPFSTGL  226



>ref|XP_010937249.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=582

 Score =   312 bits (800),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 169/217 (78%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + TAG  KHQAVALRV  D SAFY CD++ YQDTLY+HSLR F+ +CL+ GTVDF FGN
Sbjct  364  IQNTAGPSKHQAVALRVSSDLSAFYDCDIIAYQDTLYLHSLRHFFRSCLIQGTVDFIFGN  423

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
             A V QDCDI   RPG+ QKNM+TA GR DP++ TGI I + RI A  DL+PV+ +F ++
Sbjct  424  GATVLQDCDIQLWRPGANQKNMVTADGREDPDEPTGIAIHRSRITAAADLEPVKSSFRSY  483

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRT+IM+S I DVIDPAGWHEW G F L+TL Y EY+NTGAGAGT  RV WK
Sbjct  484  LGRPWKEYSRTLIMESEIGDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTAGRVKWK  543

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+T + EA+ +TP NF+ GS+WL ST FP+SLGL
Sbjct  544  GHEVITDAGEAEKFTPGNFLGGSNWLGSTGFPYSLGL  580



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   298 bits (762),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQFY +C V GTVDF FG+
Sbjct  23   IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRDCDVYGTVDFIFGD  82

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN+ TAQGR DPNQNTGI IQKC++AA  DL PVQ NF T+
Sbjct  83   AAVVFQNCNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTY  142

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ T +RVTW 
Sbjct  143  LGRPWKQYSRTVFMQSYLGSLINPAGWLEWDGDFALSTLYYGEYMNLGPGSNTSRRVTWP  202

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T  +FI G  WL +T+ PF+ GL
Sbjct  203  GYRVITSAAEASNFTVQSFIQGDQWLGATSVPFTSGL  239



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+  C + GT+DF FGN
Sbjct  210  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFIFGN  269

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQ C+++ARRP   Q N+ TAQGR DPNQNTGI IQKC++AA  DL  VQ +F T+
Sbjct  270  SAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTY  329

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQS +  V++PAGW EW+G FAL+TL Y EYQNTG GA T  RV WK
Sbjct  330  LGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWK  389

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS+SEA T+T  NFI G  WL+ T+ PF++GL
Sbjct  390  GYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  426



>ref|XP_006645812.1| PREDICTED: pectinesterase 2-like [Oryza brachyantha]
Length=406

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAF++C  +GYQDTLYVHSLRQF+  C + GTVDF FGN
Sbjct  190  IENSAGPSKHQAVALRVGADLSAFHRCSFVGYQDTLYVHSLRQFFRECDIYGTVDFIFGN  249

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQ C+++ARRP   Q N  TAQGR DPNQNTGI IQKC++AA  DL  VQ +F T+
Sbjct  250  SAVVFQSCNLYARRPLPNQSNAYTAQGREDPNQNTGISIQKCKVAAASDLAAVQSSFKTY  309

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQS +  V++PAGW EW G FAL+TL Y EYQNTG GA T  RV WK
Sbjct  310  LGRPWKQYSRTVFMQSQLDSVVNPAGWLEWNGNFALDTLYYGEYQNTGDGASTANRVKWK  369

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSSSEA T+T  +FI G  WL+ T+ PFS+GL
Sbjct  370  GYRVITSSSEASTFTVGSFIDGDVWLAGTSVPFSVGL  406



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   304 bits (779),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             +  AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+  C + GT+DF FGN
Sbjct  350  IENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFVFGN  409

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAV Q C+++ARRP   Q N+ TAQGRTDPNQNTGI IQKC++AA  DL  VQ +F T+
Sbjct  410  SAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLAAVQSSFKTY  469

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQS +  V++PAGW  W GTFAL+TL Y EYQNTG GAGT  RVTWK
Sbjct  470  LGRPWKQYSRTVFMQSELDSVVNPAGWLAWDGTFALDTLYYGEYQNTGPGAGTSGRVTWK  529

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS+SEA T+T  +FI G  WL+ T+ PFS GL
Sbjct  530  GYRVITSASEASTFTVGSFIDGDVWLAGTSIPFSAGL  566



>gb|EPS74082.1| hypothetical protein M569_00674, partial [Genlisea aurea]
Length=502

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D +AFY+C +  YQDTLY HSLRQFY NC ++GTVDF FGN
Sbjct  286  FQNTAGAAKHQAVALRVNADLTAFYRCGIYAYQDTLYTHSLRQFYTNCYISGTVDFIFGN  345

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A V Q+ DI AR P + QKNM+TAQGR DPNQNTGIVIQ+  I  T DL PV KNFPT+
Sbjct  346  SAVVIQESDIRARVPLANQKNMVTAQGREDPNQNTGIVIQRSTIDGTSDLLPVIKNFPTY  405

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVIMQ+TIS VI P GW+ W G FAL+TL Y EY NTG GA T  RV W 
Sbjct  406  LGRPWKQYSRTVIMQTTISAVIRPEGWYPWEGDFALSTLFYAEYANTGPGASTANRVNWV  465

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G+ V TSSS+A+ YT  NFI  +SWL +T FPF+ GL
Sbjct  466  GFTVFTSSSQAKPYTAENFIGANSWLPATGFPFNAGL  502



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 165/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFY+C  + YQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  343  FENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGN  402

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQDC+++AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA  DL PV+ +F T+
Sbjct  403  AAVVFQDCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFKTY  462

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIM+S I D +DPAGW EW GTFAL+TL Y EY N G G+ T  RVTW 
Sbjct  463  LGRPWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWP  522

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T   FI G+ WL+S+  PF+LGL
Sbjct  523  GYRVINSSTEATQFTIEPFIQGNEWLNSSNIPFALGL  559



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 165/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFY+C  + YQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  343  FENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGN  402

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQDC+++AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA  DL PV+ +F T+
Sbjct  403  AAVVFQDCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKIAAAADLVPVKSSFKTY  462

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIM+S I D +DPAGW EW GTFAL+TL Y EY N G G+ T  RVTW 
Sbjct  463  LGRPWKEYSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGPGSSTSARVTWP  522

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T   FI G+ WL+S+  PF+LGL
Sbjct  523  GYRVINSSTEATQFTIEPFIQGNEWLNSSNIPFALGL  559



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+  C + GT+DF FGN
Sbjct  349  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFIFGN  408

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQ C+++ARRP   Q N+ TAQGR DPNQNTGI IQKC++AA  DL  VQ +F T+
Sbjct  409  SAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTY  468

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQS +  V++PAGW EW+G FAL+TL Y EYQNTG GA T  RV WK
Sbjct  469  LGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWK  528

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS+SEA T+T  NFI G  WL+ T+ PF++GL
Sbjct  529  GYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  565



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score =   302 bits (774),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+  C + GT+DF FGN
Sbjct  368  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFIFGN  427

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A VFQ C+++ARRP   Q N+ TAQGR DPNQNTGI IQKC++AA  DL  VQ +F T+
Sbjct  428  SAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTY  487

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQS +  V++PAGW EW+G FAL+TL Y EYQNTG GA T  RV WK
Sbjct  488  LGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWK  547

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS+SEA T+T  NFI G  WL+ T+ PF++GL
Sbjct  548  GYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL  584



>ref|XP_008386773.1| PREDICTED: pectinesterase-like, partial [Malus domestica]
Length=238

 Score =   290 bits (743),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFY+C  +GYQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  20   FENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGN  79

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++ A  DL PV+ NF T+
Sbjct  80   AAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTY  139

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S I D++DPAGW EW G+FAL+TL Y EY N G G+ T  RVTW 
Sbjct  140  LGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWP  199

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS EA  +T   FI GS WL+ST  P+ LGL
Sbjct  200  GYRVINSSVEASQFTVGEFIQGSDWLNSTNIPYFLGL  236



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             +  AG  K QAVALRVG D SAFY+C  +GYQDTLYVHSLRQFY  C V GT+DF FG+
Sbjct  22   IENAAGPSKLQAVALRVGADLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGD  81

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P S Q+N+ TAQGR DPNQNTGI I KC++AA  DL PVQ NF T+
Sbjct  82   AAVVLQNCNLYARKPMSNQQNVFTAQGREDPNQNTGISIHKCKVAAAADLIPVQSNFSTY  141

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKE+SRTV MQS + ++IDPAGW EW G FALNTL Y EY N G G+ T  RV W 
Sbjct  142  LGRPWKEFSRTVFMQSYLDNLIDPAGWLEWNGDFALNTLYYGEYMNRGPGSNTTGRVKWP  201

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ S++EA  +T ++FI G  WL ST+ PF+ GL
Sbjct  202  GYRVINSTAEASNFTVTSFIQGDQWLGSTSVPFTSGL  238



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVA R G D SAFY C  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  344  FENYAGPSKHQAVAFRSGSDLSAFYSCSFIGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  403

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++AA  DL PV+ +F T+
Sbjct  404  AAVVFQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFKTY  463

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV M S I DV+DPAGW EW GTFALNTL Y EY+N G G+ T  RVTW 
Sbjct  464  LGRPWKEYSRTVYMLSNIEDVVDPAGWLEWNGTFALNTLYYAEYRNQGPGSNTSARVTWP  523

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T+ +EA  +T S+FI G+ WL+ T+ P+ LGL
Sbjct  524  GYKVLTNVTEATQFTVSSFIQGNDWLNGTSIPYYLGL  560



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score =   299 bits (765),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  + YQDTLYVHSLRQFY +C V GTVDF FGN
Sbjct  341  IENSAGPSKHQAVALRVGADLSAFYRCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q C+++AR+P   QKN+ TAQGR DPNQNTGI IQKC++AA  DL PVQ NF T+
Sbjct  401  AAVVLQSCNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTY  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQS +  +IDPAGW EW G FAL+TL Y EY N G G+ T +RVTW 
Sbjct  461  LGRPWKQYSRTVFMQSFLGSLIDPAGWLEWDGDFALSTLYYGEYMNQGPGSNTSRRVTWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T ++FI G  WL +T+ PF+ GL
Sbjct  521  GYRVITSAAEASNFTVASFIQGDQWLGATSVPFTSGL  557



>gb|EMT27728.1| Pectinesterase [Aegilops tauschii]
Length=389

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 162/216 (75%), Gaps = 0/216 (0%)
 Frame = -3

Query  950  KXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGNA  771
            +  AG  KHQAVALRV  D SAFY+C   GYQDTLY HSLRQFY +C V GTVDF FG+A
Sbjct  173  ENAAGPAKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVDFVFGDA  232

Query  770  AAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTFL  591
            A V Q+C+++ARRPG GQKN+ TAQGR DPNQNTGI +Q C+IAA  DL PVQ NF ++L
Sbjct  233  AVVLQNCNLYARRPGPGQKNVFTAQGREDPNQNTGIAVQGCKIAAAADLVPVQANFSSYL  292

Query  590  GRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWKG  411
            GRPWK YSRTV MQS +  ++ P GW EW GTFAL+TL Y EY N G GA T  RV W G
Sbjct  293  GRPWKTYSRTVFMQSKMESLVHPRGWLEWNGTFALDTLYYAEYMNRGPGANTSARVAWPG  352

Query  410  YKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            Y+V+T++++A  +T   FI G  WL+ST+FP+SLGL
Sbjct  353  YRVITTAADAGNFTAQAFIQGDLWLNSTSFPYSLGL  388



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG   HQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C V GT+DF FGN
Sbjct  213  FENSAGPSMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGN  272

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN++TAQGR DPNQNTGI I  C++AA  DL PV+ +F T+
Sbjct  273  AAVVFQNCNLYARQPNENQKNIVTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFKTY  332

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV + S I D+IDPAGW EW G FAL TL Y EY N G G+ T  RVTW 
Sbjct  333  LGRPWKEYSRTVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGPGSNTSGRVTWP  392

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ +S+EA  +    FI GS WL++T  PFSLGL
Sbjct  393  GYRVINNSAEASQFAVEPFIQGSEWLNATGVPFSLGL  429



>ref|XP_006841486.1| PREDICTED: pectinesterase [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFY+C  +GYQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  323  FENSAGPSKHQAVALRSGADLSAFYRCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGN  382

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V QDC+++ARRP   Q+N+ TAQGR DPNQNTGI IQ C++AA  DL PVQ +F  +
Sbjct  383  AAVVLQDCNLYARRPNPNQRNLFTAQGRVDPNQNTGISIQNCKVAAAADLIPVQSSFKNY  442

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRT+ MQS I D+IDPAGW EW+G FAL+TL Y EY N G GA T  RV W 
Sbjct  443  LGRPWKQYSRTIFMQSDIGDLIDPAGWFEWSGDFALSTLYYGEYMNRGPGADTSNRVKWP  502

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SSSEA  +T ++FI G+ WL ++   F  GL
Sbjct  503  GYRVINSSSEASQFTVASFIQGNEWLPASNVAFYAGL  539



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  350  FENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  409

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P  GQKN+ TAQGR DPNQNTGI I  C++ A  DL PV+  F T+
Sbjct  410  AAVVFQNCNLYARKPNDGQKNIFTAQGREDPNQNTGISILNCKVTAASDLIPVKSTFKTY  469

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S I D +DPAGW EW GTFAL+TL Y EY N G G+GT  RVTW 
Sbjct  470  LGRPWKEYSRTVYLRSNIDDTVDPAGWLEWNGTFALSTLYYGEYLNRGNGSGTTARVTWP  529

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ +S+EA  +T   FI G+ WL+ST  P+  GL
Sbjct  530  GYRVINNSTEASQFTVGAFIQGNEWLNSTGIPYFAGL  566



>gb|EMS45437.1| Pectinesterase [Triticum urartu]
Length=311

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 159/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  950  KXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGNA  771
            +  AG  KHQAVALRV  D SAFY+C   GYQDTLY HSLRQFY +C V GTVDF FG+A
Sbjct  95   ENAAGPAKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDVYGTVDFVFGDA  154

Query  770  AAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTFL  591
            A V Q+C ++ARRPG GQKN+ TAQGR DPNQNTGI +Q C+IAA  DL PV  NF ++L
Sbjct  155  AVVLQNCSLYARRPGPGQKNVFTAQGREDPNQNTGIAVQGCKIAAAADLVPVLSNFSSYL  214

Query  590  GRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWKG  411
            GRPWK YSRTV MQS +  ++ P GW EW GTFAL+TL Y EY N G GA T  RV W G
Sbjct  215  GRPWKTYSRTVFMQSKMESLVHPRGWLEWNGTFALDTLYYAEYMNRGPGANTSARVAWPG  274

Query  410  YKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            Y+V+TS ++A  +T   FI G  WL+ST+FP++LGL
Sbjct  275  YRVITSDADAGNFTAQAFIQGDLWLNSTSFPYTLGL  310



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG +KHQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  254  FENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  313

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA  DL PV+ +F ++
Sbjct  314  AAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVKSSFKSY  373

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV+++S + D+IDPAGW EW  TFAL+TL Y EY N G GA T  RVTW 
Sbjct  374  LGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANTNGRVTWP  433

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T   FI G+ WL+ST  PF  GL
Sbjct  434  GYRVINSSTEATQFTVGQFIQGNDWLNSTGIPFFSGL  470



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG E HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C V GTVDF FGN
Sbjct  266  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGTVDFIFGN  325

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP +GQKN +TAQGRTDPNQNTGI I   R+ A  DLKPV  +  T+
Sbjct  326  AAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKTY  385

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV +QS +  ++DPAGW EW G FAL TL Y EY+NTG G+ T  RV W 
Sbjct  386  LGRPWKEYSRTVFLQSYLDTLVDPAGWLEWDGNFALKTLYYGEYKNTGPGSSTSGRVNWG  445

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TSSSEA  +T  NFIAGSSWL +T  PF+ GL
Sbjct  446  GYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  482



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 160/217 (74%), Gaps = 1/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FYQC   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  44   FRNTAGAQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  103

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ C+I+AR P   + N +TAQGRTDPNQNTGI I   R+ A  DLKPVQ +  T+
Sbjct  104  AAVVFQSCNIYARNP-PNKTNTITAQGRTDPNQNTGISILNSRVTAASDLKPVQSSVKTY  162

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV M++ +  +I+PAGW  W+G FALNTL Y EY NTG G+ T KRV WK
Sbjct  163  LGRPWKEYSRTVFMKTFLDGLINPAGWMPWSGNFALNTLYYGEYANTGPGSSTAKRVNWK  222

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TS++EA  +T  NFIAGSSWL +T  PF+ GL
Sbjct  223  GYHVITSATEASKFTVGNFIAGSSWLPATNVPFTSGL  259



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score =   296 bits (757),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALR G D SAFY+C  + YQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  343  IENSAGPSKHQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDFIFGN  402

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ C+++AR+P   QKN+ TAQGR DPNQNTGI I   +IAA  DL P++ +F T+
Sbjct  403  AAAVFQACNLYARKPNPNQKNIFTAQGREDPNQNTGISILNSKIAAAADLIPLKSSFKTY  462

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKE+SRTVIM+S I D +DPAGW EW GTFAL+TL Y EY N GAG+ T  RVTW 
Sbjct  463  LGRPWKEFSRTVIMRSYIDDSVDPAGWLEWNGTFALSTLYYGEYLNRGAGSNTSARVTWP  522

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T   FI G+ WL+ST  PFSLGL
Sbjct  523  GYRVINSSTEADQFTAGAFIQGNDWLNSTDIPFSLGL  559



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   296 bits (757),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+ +C V GTVDF FGN
Sbjct  345  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDVYGTVDFVFGN  404

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A V Q C ++ARRP +GQ N  TAQGRTDPNQNTGI +Q+C+++A  DL  VQ +F T+
Sbjct  405  SAVVLQGCSLYARRPLAGQSNTYTAQGRTDPNQNTGISVQRCKVSAASDLAAVQSSFRTY  464

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPW++YSRTV M+S +  V++PAGW EW G FAL+TL Y EYQNTGAGA T  RV WK
Sbjct  465  LGRPWQQYSRTVFMESQMDSVVNPAGWLEWNGNFALDTLYYGEYQNTGAGAATSNRVKWK  524

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS+SEA  +T  +FI G  WL  T+ PFS GL
Sbjct  525  GYRVITSASEASAFTVGSFIDGDVWLPRTSVPFSTGL  561



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   288 bits (738),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG EKHQAVALRVG D+S   +  +  YQDTLY HSLRQFY +  + GTVDF FGN
Sbjct  111  FQNTAGPEKHQAVALRVGADQSVINRSRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGN  170

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C +  R+P SGQKNM+TAQGRTDPNQNTG  IQKC I A+ DL PV+ +F +F
Sbjct  171  AAVVLQNCKLVPRKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSF  230

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS I D+IDPAGW  W G FAL TL Y EY N GAGAGT KRV W 
Sbjct  231  LGRPWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWA  290

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TS++EA+ +T +  I G  WL ST   ++ GL
Sbjct  291  GYHVITSANEAKKFTVAELIQGGVWLKSTGVSYTEGL  327



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             +  AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+  C + GT+DF FGN
Sbjct  256  IENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFVFGN  315

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +AAV Q C+++ARRP   Q N+ TAQGRTDPNQNTGI +QKCR AA  DL  VQ +F T+
Sbjct  316  SAAVLQSCNLYARRPLPNQSNIYTAQGRTDPNQNTGISVQKCRGAAASDLAAVQSSFRTY  375

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV +QS +  V+DPAGW  W GTFAL+TL Y EYQNTG GAGT  RV+W 
Sbjct  376  LGRPWKQYSRTVFIQSELDSVVDPAGWLAWDGTFALDTLYYAEYQNTGPGAGTSGRVSWM  435

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+ + S+SEA T+T  +FI G  WL+ T+ PFS GL
Sbjct  436  GYRGVISASEASTFTVGSFIDGDVWLAGTSIPFSGGL  472



>ref|XP_012091398.1| PREDICTED: pectinesterase [Jatropha curcas]
 gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG EKHQAVALRVG D+S   +C M  YQDTLY HS RQFY + L+ GTVDF FGN
Sbjct  328  FQNTAGPEKHQAVALRVGADQSVINRCRMDAYQDTLYTHSNRQFYRDSLITGTVDFIFGN  387

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C + AR+P +GQKNM+TAQGR DPNQNTG  IQKC I A+ DL+PV+ +  ++
Sbjct  388  AAVVFQNCKLVARKPMNGQKNMVTAQGRIDPNQNTGTSIQKCEIIASSDLEPVKSSVKSY  447

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS I+D IDPAGW  W G FAL TL Y EY N GAGAGT KRV W 
Sbjct  448  LGRPWKEYSRTVVMQSNIADHIDPAGWSIWEGDFALKTLYYGEYMNRGAGAGTSKRVKWA  507

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EAQ +T +  I G  WL ST   F+ GL
Sbjct  508  GYRVITSATEAQKFTVAELIQGGVWLKSTGVAFTEGL  544



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG +KHQAVALRVG D+S   +C +  YQDTLY HS R FY +  + GTVDF FGN
Sbjct  331  FQNTAGPQKHQAVALRVGSDQSVINRCRIDAYQDTLYAHSDRHFYRDSFITGTVDFIFGN  390

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ+C I AR+P +GQKNM+TAQGRTDPNQNTG  IQKC + A+ DL+PV+ +FP++
Sbjct  391  AAAVFQNCKIVARKPMAGQKNMVTAQGRTDPNQNTGTSIQKCDVIASSDLQPVKGSFPSY  450

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS I D IDPAGW  W G FAL TL Y EY N GAGAGT KRV W 
Sbjct  451  LGRPWKEYSRTVVMQSNIGDHIDPAGWSIWDGEFALKTLYYGEYMNKGAGAGTSKRVKWP  510

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TS++EA+ +T +  I G +WL ST   F+ GL
Sbjct  511  GYHVITSATEAKKFTVAELIQGGAWLKSTGVAFTEGL  547



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFYQC  +GYQDTLYVH+LRQFY  C + GT+DF FGN
Sbjct  341  FENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHTLRQFYRECDIYGTIDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+ +++AR+P S QKN+ TAQGR DPNQNTGI I  C++AA  DL PV+ +F TF
Sbjct  401  AAVVFQNSNLYARKPNSNQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTF  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S I D++DPAGW EW  +FAL+TL YREY N G G+ T  RVTW 
Sbjct  461  LGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYREYMNRGPGSNTSARVTWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+++T+S+EA  +T   FI G++WL+ST  P+ L L
Sbjct  521  GYRIITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  300  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  359

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A  DL PV  +F TF
Sbjct  360  AAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQNTGISIHNSRVMAANDLTPVLSSFKTF  419

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQ+ +  ++DPAGW EW G FALNTL Y EY+N G  A T +RVTWK
Sbjct  420  LGRPWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGPAAPTSRRVTWK  479

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T +NFIAG SWL  T  PF+ GL
Sbjct  480  GYRVITSATEASKFTVTNFIAGRSWLPDTGIPFTSGL  516



>ref|XP_004293266.1| PREDICTED: pectinesterase [Fragaria vesca subsp. vesca]
Length=528

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG +KHQAVALRVG D+S   +C +  YQDTLY HS RQFY +C + GTVDF FGN
Sbjct  312  FQNTAGPDKHQAVALRVGADQSVINRCRIDAYQDTLYAHSNRQFYRDCYITGTVDFIFGN  371

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I AR+P SGQ NM+TAQGRTDPNQNTG  IQKC++ A+ DL+PV+    ++
Sbjct  372  AAVVLQNCKIVARKPASGQNNMVTAQGRTDPNQNTGTSIQKCQVIASSDLEPVKGTVRSY  431

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTI D IDP GW  W+G FAL TL Y EY N+G GAGT KRVTW 
Sbjct  432  LGRPWKEYSRTVVMQSTIGDHIDPTGWSIWSGDFALKTLYYGEYANSGPGAGTSKRVTWA  491

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+ ++SEAQ++T +  I G SWL ST   F+ GL
Sbjct  492  GYHVIKTASEAQSFTVAGLIQGGSWLKSTGVSFTEGL  528



>sp|P85076.1|PME_ACTDE RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase [Actinidia deliciosa]
Length=321

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C V GT+DF FGN
Sbjct  104  FENYAGPSKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYSECDVYGTIDFIFGN  163

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++AA  DL PV  +F T+
Sbjct  164  AAAVLQKCNLYARKPNENQKNIFTAQGRDDPNQNTGISILNCKVAAAADLIPVLSSFKTY  223

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV + S +  +IDPAGW EW+G FAL TL YREY+NTG G+ T  RVTW 
Sbjct  224  LGRPWKEYSRTVFLLSQMESLIDPAGWLEWSGDFALTTLYYREYKNTGPGSNTTARVTWP  283

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V T+ +E   +T  NFI GS WL+S   P  L L
Sbjct  284  GYAVTTNETEVIQFTVGNFIQGSQWLTSYNIPVYLNL  320



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 166/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQF+ +C + GT+DF FGN
Sbjct  212  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDIYGTIDFIFGN  271

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ C+++AR+P   Q N+ TAQGR DPNQNTGI IQ+C++AA  DL   + +  T+
Sbjct  272  AAVVFQSCNLYARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAASDLAGQESSTKTY  331

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV +QS +  +IDPAGW EW G+FAL+TL Y EY NTGAGAGT  RV WK
Sbjct  332  LGRPWKQYSRTVFLQSELDSLIDPAGWLEWNGSFALDTLYYGEYMNTGAGAGTAGRVKWK  391

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T  +FI G  WL+ T+ PF+ GL
Sbjct  392  GYRVITSAAEASAFTVGSFIDGDVWLAGTSIPFTTGL  428



>gb|EYU19222.1| hypothetical protein MIMGU_mgv1a003983mg [Erythranthe guttata]
Length=551

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + TAG EKHQAVALRVG D+S   +C +  YQDTLY HSLRQFY    V GTVDF FGN
Sbjct  335  IQNTAGPEKHQAVALRVGADKSVINRCRIDAYQDTLYTHSLRQFYRESYVTGTVDFIFGN  394

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ C + AR+P   QKNM+TAQGRTDPNQNTG  IQ C I A+ DL PV+ +FPT+
Sbjct  395  AAVVFQKCKLVARKPMKSQKNMVTAQGRTDPNQNTGTSIQDCEIIASADLAPVKGSFPTY  454

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTI D+IDPAGW EW+G FAL TL Y EY N G GAGT KRV W 
Sbjct  455  LGRPWKEYSRTVVMQSTIGDLIDPAGWAEWSGDFALKTLYYGEYMNKGGGAGTSKRVNWT  514

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T ++EA  +T    I G  WL ST   F+ GL
Sbjct  515  GYHVITDAAEATKFTVKELIQGGDWLGSTGVTFTEGL  551



>ref|XP_012082811.1| PREDICTED: pectinesterase-like [Jatropha curcas]
Length=557

 Score =   294 bits (752),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG   HQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C V GT+DF FGN
Sbjct  340  FENSAGPSMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGN  399

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN++TAQGR DPNQNTGI I  C++AA  DL PV+ +F T+
Sbjct  400  AAVVFQNCNLYARQPNENQKNIVTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFKTY  459

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV + S I D+IDPAGW EW G FAL TL Y EY N G G+ T  RVTW 
Sbjct  460  LGRPWKEYSRTVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGPGSNTSGRVTWP  519

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ +S+EA  +    FI GS WL++T  PFSLGL
Sbjct  520  GYRVINNSAEASQFAVEPFIQGSEWLNATGVPFSLGL  556



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG +KHQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  345  FENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  404

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA  DL PV+ +F ++
Sbjct  405  AAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVKSSFKSY  464

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV+++S + D+IDPAGW EW  TFAL+TL Y EY N G GA T  RVTW 
Sbjct  465  LGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANTNGRVTWP  524

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T   FI G+ WL+ST  PF  GL
Sbjct  525  GYRVINSSTEATQFTVGQFIQGNDWLNSTGIPFFSGL  561



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C V GTVDF FGN
Sbjct  259  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYVFGTVDFIFGN  318

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN +TAQGRTDPNQNTGI I   R+ A+ DL PV  +F +F
Sbjct  319  AAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMASADLVPVLGSFRSF  378

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQ+ +  ++DPAGW EW G FALNTL Y EY+NTG G+ T +RV W+
Sbjct  379  LGRPWKEYSRTVFMQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGPGSSTSRRVRWR  438

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T +NFIAG SWL +T  PF+ GL
Sbjct  439  GYRVITSAAEAGRFTVANFIAGQSWLPATGVPFTAGL  475



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFY+C  +GYQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  361  FENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGN  420

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++ A  DL PV+ NF T+
Sbjct  421  AAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTY  480

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S I D++DPAGW EW G+FAL+TL Y EY N G G+ T  RVTW 
Sbjct  481  LGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWP  540

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS EA  +T   FI GS WL+ST  P+ LGL
Sbjct  541  GYRVINSSVEASQFTVGEFIQGSDWLNSTNIPYFLGL  577



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score =   293 bits (750),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG + HQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  340  FENSAGPDMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  399

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C I+AR+P S Q+N+ TAQGR DPNQNTGI I   ++ A  DL PV+K+F T+
Sbjct  400  AAVVFQNCSIYARKPNSNQQNIFTAQGREDPNQNTGISIMNSKVTAAADLIPVKKSFKTY  459

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S I DV+DP GW EW G FAL+TL Y EY N G G+ T  RVTW 
Sbjct  460  LGRPWKEYSRTVFLRSYIDDVVDPVGWLEWNGAFALSTLYYGEYMNRGPGSNTSARVTWP  519

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ S++EA  +T   FI GS WL++T  PF LGL
Sbjct  520  GYRVINSTTEASQFTVRPFIQGSEWLNATGIPFFLGL  556



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   293 bits (749),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG EKHQAVALRVG D+S   +C +  YQDTLY HSLRQFY +  + GTVDF FGN
Sbjct  333  FQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGN  392

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C +  R+P SGQKNM+TAQGRTDPNQNTG  IQKC I A+ DL PV+ +F +F
Sbjct  393  AAVVLQNCKLVPRKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSF  452

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS I D+IDPAGW  W G FAL TL Y EY N GAGAGT KRV W 
Sbjct  453  LGRPWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWA  512

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TS++EA+ +T +  I G  WL ST   ++ GL
Sbjct  513  GYHVITSANEAKKFTVAELIQGGVWLKSTGVSYTEGL  549



>gb|AAF35897.1|AF229849_1 pectin methylesterase isoform alpha [Vigna radiata]
Length=277

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFYQC  + YQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  60   FENSAGPSKHQAVALRNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  119

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+C+++AR+P   Q+N+ TAQGR DPNQ+TGI I  C++AA  DL PV+  F  +
Sbjct  120  AAAVLQNCNLYARKPNKNQRNLFTAQGREDPNQSTGISIINCKVAAAADLIPVKSEFRNY  179

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV + S + D+I+PAGW EW GTFAL+TL Y EY N G GA T  RVTW 
Sbjct  180  LGRPWKMYSRTVFLNSLMEDLIEPAGWLEWNGTFALDTLYYGEYNNRGPGANTSGRVTWP  239

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+S+EA  +T  NFI G+ WL+S   PF  GL
Sbjct  240  GYRVITNSTEASQFTVQNFIQGNEWLNSYGIPFFSGL  276



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG E HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  307  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  366

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+C I+ARRP S QKN +TAQGRTDPNQNTGI I   R+ A  DLKPV  +F T+
Sbjct  367  AAAVLQNCMIYARRPMSKQKNTITAQGRTDPNQNTGISIHNSRVMAAADLKPVLSSFKTY  426

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV MQ+ +  ++DPAGW EW G FALNTL Y EY+N G  A T +RV W 
Sbjct  427  LGRPWKQYSRTVFMQTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNLGPAASTSRRVKWS  486

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSSSEA  +T +NFIAG SWL +T   F+ GL
Sbjct  487  GYRVITSSSEASQFTVANFIAGQSWLPATGVRFTAGL  523



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  312  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGN  371

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I  RRP  GQ N++TAQGRTDPNQNTGI I  CR+ A+ DLKPVQ +F TF
Sbjct  372  AAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQNTGISIHNCRVMASSDLKPVQSSFKTF  431

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV +Q+ +  ++DPAGW EW+G FALNTL Y EY+N G  + T +RV W+
Sbjct  432  LGRPWKEYSRTVYLQTYLDTLVDPAGWMEWSGNFALNTLYYGEYRNFGPASSTARRVKWR  491

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+ SEA  +T  NFI+G SWL +T  PF+ GL
Sbjct  492  GYRVITNPSEASRFTVGNFISGGSWLPATGVPFNSGL  528



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             +  AG  KHQAVALRVG D SAFY+C  +GYQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  350  IENAAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRECNVYGTVDFIFGN  409

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   Q+N+ TAQGR DPNQNTGI IQ+C++AA  DL PVQ NF T+
Sbjct  410  AAVVLQNCNLYARKPLPNQQNIFTAQGREDPNQNTGISIQRCKVAAAADLIPVQANFSTY  469

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQS +  +I PAGW EW G+FAL+TL Y EY N G G+ T  RV W 
Sbjct  470  LGRPWKEYSRTVFMQSYLDSLISPAGWLEWNGSFALSTLYYGEYMNRGPGSNTSSRVAWP  529

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            G++V+  ++EA  +T + F+ G  WL ST+ PFSLGL
Sbjct  530  GFRVIGDAAEASNFTAAAFVQGDQWLGSTSVPFSLGL  566



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FYQC   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  44   FRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  103

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A  DLKPV  +F T+
Sbjct  104  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATDLKPVLSSFKTY  163

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV + + +  ++D AGW EW G FALNTL Y EY+N G G+ T  RV W+
Sbjct  164  LGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWR  223

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  ++ +NFIAG SWL +T  PF  GL
Sbjct  224  GYRVITSATEASKFSVANFIAGQSWLPATGVPFRSGL  260



>ref|XP_009590338.1| PREDICTED: pectinesterase 3-like, partial [Nicotiana tomentosiformis]
Length=244

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + TAG EKHQAVALRVG D S   +C +  YQDTLY HSLRQFY +C V GTVDF FGN
Sbjct  26   IQNTAGPEKHQAVALRVGADMSLINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGN  85

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ C +  R+PG  QKNM+TAQGRTDPNQ TG  IQ C I A+ DL+PV+  + T+
Sbjct  86   AAVVFQKCQLVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTY  145

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+M+S + D+IDPAGW EW+G FAL TL Y EY N G GAGT KRV W 
Sbjct  146  LGRPWKEYSRTVVMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVKWS  205

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY ++T+ +EA  +T +  I G SWLSST   F  GL
Sbjct  206  GYHIITNPAEAMPFTVAELIQGGSWLSSTGVTFVQGL  242



>ref|XP_008781656.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=460

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALR   D S F+QC   GYQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  244  FRNTAGPAKHQAVALRSNSDLSVFHQCSFEGYQDTLYVHSLRQFYRECEVYGTVDFIFGN  303

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ C+I+ RRP S QKN +TAQGRTDPNQNTGI IQ CR+ A  DL+P Q +F TF
Sbjct  304  AAVVFQSCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQYCRVRAAKDLRPAQSSFETF  363

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKE SRTV M++ + D+I PAGW EW+G FAL TL Y E++NTG G+ T KRV W 
Sbjct  364  LGRPWKENSRTVYMETYMDDLISPAGWLEWSGGFALETLFYGEFRNTGPGSNTSKRVKWG  423

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T  S A  +T  N IAG  WL ST  PF+L L
Sbjct  424  GYHVITDPSAASEFTARNLIAGEMWLPSTGVPFTLDL  460



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLY+HS RQFY  C + GTVDF FGN
Sbjct  239  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYIHSQRQFYKECYIYGTVDFIFGN  298

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN +TAQGRTDPNQNTGI I   R+ A  DLKPV  +F TF
Sbjct  299  AAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLKPVLSSFKTF  358

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV +Q+ +  ++DPAGW EW G FALNTL Y EY+N G  + T  RV W+
Sbjct  359  LGRPWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRVKWR  418

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T +NFIAG SWL +T  PFS GL
Sbjct  419  GYRVITSATEASQFTVANFIAGRSWLPATGVPFSSGL  455



>ref|XP_010534985.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=589

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 163/218 (75%), Gaps = 1/218 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG    QAVA+R+G D SAFY+C    YQDTLYVHS RQF+ NC VAGTVDF FGN
Sbjct  372  FENTAGPANAQAVAIRLGADHSAFYRCGFSAYQDTLYVHSKRQFFRNCFVAGTVDFIFGN  431

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            +A V Q+CDI AR PG G++NM+TAQGRTD NQ+TGIVIQ CRI AT DL PV   +P++
Sbjct  432  SAVVLQNCDIDARIPGRGKQNMVTAQGRTDKNQDTGIVIQNCRINATSDLWPVMDEYPSY  491

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEW-TGTFALNTLTYREYQNTGAGAGTFKRVTW  417
            LGRPW+EYSRTV+MQS+IS+VI+P GW  W +  F L+TLTYREY N G GA T  RV W
Sbjct  492  LGRPWQEYSRTVVMQSSISEVINPKGWRPWNSSNFYLDTLTYREYSNRGPGANTKYRVKW  551

Query  416  KGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            KG+KV+T   EA+ YT   FI GSSW+  T FP+  GL
Sbjct  552  KGFKVITDPKEAEPYTADEFIDGSSWVPETGFPYQPGL  589



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLY HSLRQFY  C V GT+DF FGN
Sbjct  349  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGN  408

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            A  V Q+C+++AR+P S QKN+ TAQGR DPNQNTGI IQ C++AA  DL PVQ NF T+
Sbjct  409  AGVVLQNCNLYARKPLSNQKNVFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTY  468

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ T  RV W 
Sbjct  469  LGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWP  528

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T  +FI G  WL ST+ PF+ GL
Sbjct  529  GYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLY HSLRQFY  C V GT+DF FGN
Sbjct  349  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGN  408

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            A  V Q+C+++AR+P S QKN+ TAQGR DPNQNTGI IQ C++AA  DL PVQ NF T+
Sbjct  409  AGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTY  468

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ T  RV W 
Sbjct  469  LGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWP  528

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T  +FI G  WL ST+ PF+ GL
Sbjct  529  GYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG EKHQAVALR G D SAF++C  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  336  FENSAGPEKHQAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  395

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++ARRP   QKN+ TAQGR DPNQNTGI I  C+IAA  DL PV+ +F ++
Sbjct  396  AAVVFQNCNLYARRPNENQKNLFTAQGREDPNQNTGISIFNCKIAAASDLIPVKSSFKSY  455

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV ++S I D+IDPAGW EW  TFAL+TL Y EY N G G+ T  RVTW 
Sbjct  456  LGRPWKTYSRTVYLKSYIEDLIDPAGWLEWNDTFALDTLYYGEYMNRGPGSNTSARVTWP  515

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+++ SS+EA  +T + FI G+ WL++T  PF  GL
Sbjct  516  GYRIINSSTEASQFTVAQFIQGNDWLNTTGIPFLSGL  552



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG E HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C V GTVDF FGN
Sbjct  301  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGTVDFIFGN  360

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP +GQKN +TAQGRTDPNQNTGI I   R+ A  DLKPV  +  T+
Sbjct  361  AAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKTY  420

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV +QS +  ++D AGW EW G FAL TL Y EY+NTG G+ T  RV W 
Sbjct  421  LGRPWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGPGSSTRGRVNWG  480

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TSSSEA  +T  NFIAGSSWL +T  PF+ GL
Sbjct  481  GYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  517



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVA+R G D SAFYQC  + YQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  340  FENSAGPSKHQAVAVRNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  399

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C+IAA  DL PVQ  F ++
Sbjct  400  AAVVFQNCNLYARKPDPKQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVQSTFKSY  459

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV + S I ++IDPAGW EW GTFAL+TL Y EY+N G G+ T  RVTW 
Sbjct  460  LGRPWKKYSRTVYLNSFIDNLIDPAGWLEWNGTFALDTLFYGEYKNRGPGSNTSARVTWP  519

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+T+++EA  +T   FI G+ WL+ST  PF L L
Sbjct  520  GYKVITNATEASQFTVRQFIQGNEWLNSTGVPFFLDL  556



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + +AG  KHQAVALRVG D SAFY+C  +GYQDTLY HSLRQFY  C V GT+DF FGN
Sbjct  348  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGN  407

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            A  V Q+C+++AR+P S QKN+ TAQGR DPNQNTGI IQ C++AA  DL PVQ NF T+
Sbjct  408  AGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTY  467

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV MQS +  +I+PAGW EW G FAL+TL Y EY N G G+ T  RV W 
Sbjct  468  LGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWP  527

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T  +FI G  WL ST+ PF+ GL
Sbjct  528  GYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  564



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFYQC  + YQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  384  FENSAGPSKHQAVALRSGADLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  443

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV Q+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++AA  DL PV+  F  +
Sbjct  444  AAAVLQNCNLYARKPNPNQKNLFTAQGREDPNQNTGISIINCKVAAAADLIPVKSEFKNY  503

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV + S + D+IDPAGW EW G FAL+TL Y EY N G GA T +RVTW 
Sbjct  504  LGRPWKKYSRTVYLNSLMEDLIDPAGWLEWDGNFALDTLYYGEYNNRGPGANTSRRVTWP  563

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+S+EA  +T +NFI G+ WL+S   PF  GL
Sbjct  564  GYRVITNSTEASQFTVANFIQGNEWLTSLGIPFFSGL  600



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C V GT+DF FGN
Sbjct  341  FENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ  +++AR+P S Q+N+ TAQGR DPNQNTGI I  C++AA  DL PV+ +F TF
Sbjct  401  AAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTF  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S I D++DPAGW EW  +FAL+TL Y EY N G G+ T  RVTW 
Sbjct  461  LGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSARVTWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+S+EA  +T   FI G++WL+ST  P+ L L
Sbjct  521  GYRVITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFYQC  +GYQDTLYVHSLRQFY  C V GT+DF FGN
Sbjct  341  FENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ  +++AR+P S Q+N+ TAQGR DPNQNTGI I  C++AA  DL PV+ +F TF
Sbjct  401  AAVVFQTSNLYARKPNSNQRNIFTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFQTF  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S I D++DPAGW EW  +FAL+TL Y EY N G G+ T  RVTW 
Sbjct  461  LGRPWKEYSRTVFLRSYIDDLVDPAGWLEWNASFALSTLYYGEYMNRGPGSNTSARVTWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+S+EA  +T   FI G++WL+ST  P+ L L
Sbjct  521  GYRVITNSTEASQFTVGAFIQGNTWLNSTDIPYFLNL  557



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG EKHQAVALRVG D+S   +C +  YQDTLY HSLRQFY +  + GTVDF FGN
Sbjct  341  FQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYTHSLRQFYRDSYITGTVDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C +  R+P SGQKNM+TAQGRTDPNQNTG  IQKC I A+ DL PV+ +F ++
Sbjct  401  AAVVLQNCKLVPRKPMSGQKNMVTAQGRTDPNQNTGTSIQKCDIIASSDLTPVKSSFKSY  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS I D+IDPAGW  W G FAL TL Y EY N GAGAGT KRV W 
Sbjct  461  LGRPWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVKWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TS++EA+ +T +  I G  WL ST   ++ GL
Sbjct  521  GYHVITSANEAKKFTVAELIQGGVWLKSTGVSYTEGL  557



>ref|XP_012090423.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Jatropha curcas]
 gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 164/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  307  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  366

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A+ DLKPV  +F T+
Sbjct  367  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLKPVLSSFKTY  426

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV +Q+ +  ++DPAGW EW G FALNTL Y EY+N G  A T  RVTW+
Sbjct  427  LGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGPSASTSGRVTWR  486

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSS+EA  +T +NFIAG SWL +++ PF+ GL
Sbjct  487  GYRVITSSTEANRFTVANFIAGGSWLPASSVPFTSGL  523



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  301  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  360

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA + Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A+ DL+PV  +F T+
Sbjct  361  AAVILQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTY  420

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV +Q+ +  ++DPAGW EW G FALNTL Y EY+N+G GA T  RV W+
Sbjct  421  LGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTRGRVKWR  480

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSS+EA  +T +NFIAG SWL +T  PF  GL
Sbjct  481  GYRVITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG E HQAVALR G D S FY C   GYQDTLY HS RQFY +C V GTVDF FGN
Sbjct  303  FRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFGN  362

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+AR+P SGQKN +TAQGRTDPNQNTGI I   R+ A  D K    +  TF
Sbjct  363  AAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTF  422

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQS +  ++DPAGW EW+G FAL TL Y EY+N G GA T +RV W 
Sbjct  423  LGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSRRVKWG  482

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSSSEA  +T +NFIAGSSWL +T  PF+ GL
Sbjct  483  GYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_004307817.2| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=518

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLY HS RQFY  C + GTVDF FGN
Sbjct  302  FRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDTLYTHSQRQFYKECYIYGTVDFIFGN  361

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+AR+P SGQKN +TAQGRTDPNQNTGI I   RI A  DL PV K+  TF
Sbjct  362  AAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAAADLAPVIKSVKTF  421

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV +QS +  ++DPAGW EW G FAL TL Y EY+N G G+GT  RV W 
Sbjct  422  LGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGPGSGTSGRVKWG  481

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSSSEA  +T  N IAGSSWL +T  PF+ GL
Sbjct  482  GYRVITSSSEASKFTVGNLIAGSSWLPATGVPFTSGL  518



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 165/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG +K QAVALR G D S FYQC   GYQDTLYV+S RQFY NC + GTVDF FG+
Sbjct  300  FENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIFGD  359

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C++H R+P SGQKN +TAQGRTDPN+NTGI I    + A  DLKPVQ +F T+
Sbjct  360  AAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQGSFETY  419

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPW+EYSRTV M++++  +IDPAGW EW+G FAL+TL Y EY NTG GA T +RV W 
Sbjct  420  LGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGADTSQRVKWP  479

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TS++EA  +T  NF++G+SW+ +T  PF+ GL
Sbjct  480  GYHVITSAAEASKFTVGNFLSGNSWIPATEVPFTSGL  516



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFYQC  + YQDTLYVHSLRQFY NC V GTVDF FGN
Sbjct  260  FENYAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRNCDVYGTVDFIFGN  319

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++ A  DL PV  +F  +
Sbjct  320  AAVVLQNCNLYARKPNPNQKNLFTAQGREDPNQNTGISILNCKVEAASDLVPVLSSFKNY  379

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVI+ S I  +IDPAGW EW+G FALNTL Y EY N G G+ T  RV W 
Sbjct  380  LGRPWKQYSRTVILFSNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWP  439

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T  NFI GS W+ +T  PF  GL
Sbjct  440  GYRVINSSTEASQFTVGNFIQGSEWIPATEVPFYSGL  476



>gb|KDO87160.1| hypothetical protein CISIN_1g015794mg [Citrus sinensis]
Length=400

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 160/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  950  KXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGNA  771
            + +AG  KHQAVALR G D SAFY+C  +GYQDTLYVHSLRQFY  C V GTVDF FGNA
Sbjct  183  ENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNA  242

Query  770  AAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTFL  591
            A VFQ C+++AR+P + QKN++TAQGR DPNQNTGI I  C++AA  DL P Q  F T+L
Sbjct  243  AVVFQICNLYARKPNANQKNIITAQGREDPNQNTGISILNCKVAAASDLIPYQTEFKTYL  302

Query  590  GRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWKG  411
            GRPWKEYSRTV M S + D+I PAGW EW GTFAL+TL Y EY+N G G+ T  RVTW G
Sbjct  303  GRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPG  362

Query  410  YKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            Y+V+ +S+ A  +T   F+ GS WL+ST  PF L L
Sbjct  363  YRVINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNL  398



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 158/218 (72%), Gaps = 0/218 (0%)
 Frame = -3

Query  956  RFKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFG  777
            R + TAG EKHQAVALRVG D+S   +C +  YQDTLY HSLRQFY +  + GTVDF FG
Sbjct  333  RIQNTAGPEKHQAVALRVGADKSVINRCRIDAYQDTLYAHSLRQFYRDSYITGTVDFIFG  392

Query  776  NAAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPT  597
            NAA VFQ C + AR+P   QKNM+TAQGRTDPNQNTG  IQ C I A+ DL+PV+ +FPT
Sbjct  393  NAAVVFQKCKLVARKPMKSQKNMVTAQGRTDPNQNTGTSIQDCEIRASEDLEPVKSSFPT  452

Query  596  FLGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTW  417
            +LGRPWKEYSRTV+MQS I D IDP GW EW+G FAL TL Y EY N G GAGT KRV W
Sbjct  453  YLGRPWKEYSRTVVMQSYIGDHIDPVGWSEWSGDFALKTLYYGEYMNKGPGAGTSKRVKW  512

Query  416  KGYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
             GY V+T+++EA  +T    I G  WL ST   ++ GL
Sbjct  513  AGYHVITNAAEAAKFTVKELIQGVEWLGSTGVAYTEGL  550



>gb|AHC69829.1| pectin methylesterase PME2.1 [Nicotiana tabacum]
Length=559

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + TAG EKHQAVALRVG D S   +C +  YQDTLY HSLRQFY +C V GTVDF FGN
Sbjct  341  IQNTAGPEKHQAVALRVGADMSVINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ C +  R+PG  QKNM+TAQGRTDPNQ TG  IQ C I A+ DL+PV+  + T+
Sbjct  401  AAVVFQKCQLVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTY  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+M+S + D+IDPAGW EW+G FAL TL Y EY N G GAGT KRVTW 
Sbjct  461  LGRPWKEYSRTVVMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVTWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T ++EA+ +T +  I G SWLSST   F  GL
Sbjct  521  GYHVITDAAEARPFTVAELIQGGSWLSSTGVTFVEGL  557



>ref|XP_009768199.1| PREDICTED: pectinesterase 2.1-like [Nicotiana sylvestris]
Length=559

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + TAG EKHQAVALRVG D S   +C +  YQDTLY HSLRQFY +C V GTVDF FGN
Sbjct  341  IQNTAGPEKHQAVALRVGADMSVINRCRIDAYQDTLYAHSLRQFYRDCYVTGTVDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ C +  R+PG  QKNM+TAQGRTDPNQ TG  IQ C I A+ DL+PV+  + T+
Sbjct  401  AAVVFQKCQLVPRKPGKNQKNMVTAQGRTDPNQATGTSIQFCDIIASPDLEPVKSEYKTY  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+M+S + D+IDPAGW EW+G FAL TL Y EY N G GAGT KRVTW 
Sbjct  461  LGRPWKEYSRTVVMESYLGDLIDPAGWSEWSGDFALKTLYYGEYMNNGPGAGTSKRVTWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T ++EA+ +T +  I G SWLSST   F  GL
Sbjct  521  GYHVITDAAEARPFTVAELIQGGSWLSSTGVTFVEGL  557



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVA R G D SAFY+C  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  344  FENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  403

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   QKNM TAQGR DPNQNTGI I  C++AA  DL PV+  F T+
Sbjct  404  AAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTGISILNCKVAAASDLVPVKSTFKTY  463

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV M+S I D++ PAGW EW GTFAL+TL Y EY N G G+ T  RV W 
Sbjct  464  LGRPWKEYSRTVYMKSYIDDLVQPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVKWP  523

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS EA  +T   FI G+ WL+ST  P+ +GL
Sbjct  524  GYRVINSSDEANQFTVGPFIQGNEWLNSTNIPYFIGL  560



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFYQC  + YQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  341  FENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++AA  DL PV  +F  +
Sbjct  401  AAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKVAAASDLVPVLSSFKNY  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV ++S I  +IDPAGW EW G FALNTL Y EY N G G+ T  RV W 
Sbjct  461  LGRPWKQYSRTVFLRSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNNGPGSITSARVKWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T  NFI GS WL +T FPF L L
Sbjct  521  GYRVINSSAEASQFTVGNFIQGSQWLPATGFPFFLSL  557



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG E HQAVALR G D S FY C   GYQDTLY HS RQFY +C V GTVDF FGN
Sbjct  303  FRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFGN  362

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+AR+P SGQKN +TAQGRTDPNQNTGI I   R+ A  D K    +  TF
Sbjct  363  AAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTF  422

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQS +  ++DPAGW EW+G FAL TL Y EY+N G GA T  RV W 
Sbjct  423  LGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSGRVKWG  482

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSSSEA  +T +NFIAGSSWL +T  PF+ GL
Sbjct  483  GYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG EKHQAVALRVG D+S   +C +  YQDTLYVHSLRQFY +  + GTVDF FG+
Sbjct  337  FQNTAGPEKHQAVALRVGADQSVINRCRIDAYQDTLYVHSLRQFYRDSYITGTVDFIFGD  396

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C + AR+P + QKNM+TAQGR DPNQNTGI IQKC I A+ DL PV+ +FP++
Sbjct  397  AAVVFQNCKLVARKPMASQKNMVTAQGRVDPNQNTGISIQKCDIIASSDLAPVKNSFPSY  456

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQS I D I PAGW  W+G FAL TL Y EY N+G GAG  KRVTW 
Sbjct  457  LGRPWKEYSRTVVMQSYIGDHIAPAGWSIWSGEFALKTLYYGEYLNSGPGAGISKRVTWP  516

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T+S+EA  +T +  I G +WL ST   ++ GL
Sbjct  517  GYHVITNSAEALKFTVAELIQGGAWLKSTGVDYTEGL  553



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FYQC   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  302  FRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  361

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A  DL PV   F TF
Sbjct  362  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTF  421

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQ+ +  ++DPAGW EW+G FALNTL Y EY+N G  A T  RV W+
Sbjct  422  LGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWR  481

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T  +FIAG+SWL +T  PF  GL
Sbjct  482  GYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FYQC   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  302  FRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  361

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A  DL PV   F TF
Sbjct  362  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTF  421

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQ+ +  ++DPAGW EW+G FALNTL Y EY+N G  A T  RV W+
Sbjct  422  LGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWR  481

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T  +FIAG+SWL +T  PF  GL
Sbjct  482  GYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  303  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYKECYIYGTVDFIFGN  362

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP SGQKN +TAQGRTDPNQNTGI I   R+ A  DLKPV  +F ++
Sbjct  363  AAVVLQNCMIYARRPMSGQKNTITAQGRTDPNQNTGISIHNSRVMAAPDLKPVLSSFKSY  422

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV +Q+ +  +IDPAGW EW G FAL+TL Y EY+N G  A T  RV W 
Sbjct  423  LGRPWKQYSRTVYLQTYLDTLIDPAGWLEWDGNFALSTLYYGEYKNLGPAAWTSGRVKWP  482

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSSSEA  +T +NFIAG SWL ST  PF+ GL
Sbjct  483  GYRVITSSSEASKFTVANFIAGQSWLPSTGVPFTPGL  519



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 157/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFYQC  + YQDTLYVHSLRQFY +C V GTVDF FGN
Sbjct  345  FENYAGPSKHQAVALRSGSDLSAFYQCSFIAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  404

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   QKNM TAQGR DPNQNTGI I  C++ A  DL PV  +F  +
Sbjct  405  AAVVLQNCNLYARKPNPNQKNMFTAQGREDPNQNTGISILNCKVEAASDLVPVVSSFKNY  464

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTVI+ S I  +IDPAGW EW+G FALNTL Y EY N G G+ T  RV W 
Sbjct  465  LGRPWKQYSRTVILISNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWP  524

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SSSEA  +T  NFI GS W+ +T  PF  GL
Sbjct  525  GYRVINSSSEASQFTVGNFIQGSEWIPATGVPFYSGL  561



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   287 bits (735),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  303  FRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGTVDFIFGN  362

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A+ DL+PV  +F TF
Sbjct  363  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTF  422

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV +Q+ +  ++D AGW EW G FALNTL Y EY+N+G GA T  RV W+
Sbjct  423  LGRPWKAYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWR  482

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T +NFIAG SWL +T  PFS GL
Sbjct  483  GYRVITSATEASRFTAANFIAGRSWLPATGVPFSSGL  519



>gb|EPS67019.1| pectinesterase, partial [Genlisea aurea]
Length=335

 Score =   281 bits (719),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 165/217 (76%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALRV  D +AFY+C +  YQDTLY HSLRQFY NC + GTVDF FGN
Sbjct  119  FQNTAGAVKHQAVALRVSADLTAFYRCGINAYQDTLYAHSLRQFYTNCTITGTVDFIFGN  178

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA+VFQ C I ARRP +GQ+N +TAQGRTDPNQNTGIVIQ+  I A  +L PV  NFPT+
Sbjct  179  AASVFQGCHISARRPLAGQENTVTAQGRTDPNQNTGIVIQQSTIDAAAELLPVIANFPTY  238

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPW++YSRTVIMQS I+  I P GW  W G FAL+TL Y EY NTGAGA T  RV W 
Sbjct  239  LGRPWQQYSRTVIMQSAITAAIRPEGWLPWNGDFALSTLYYAEYANTGAGAATANRVKWP  298

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GYKV+TS ++A  +T +NFI+ S+WL +T FPF+ GL
Sbjct  299  GYKVLTSPTQATPFTAANFISASNWLPATGFPFNAGL  335



>ref|XP_004148139.2| PREDICTED: pectinesterase 2 [Cucumis sativus]
 gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   288 bits (738),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG E HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  355  FRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  414

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+AR+P +GQKN +TAQGRTDPNQNTGI I   R+ AT DLKPV+    T+
Sbjct  415  AAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTY  474

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV M++ I  ++DPAGW EW G FALNTL Y EY N G G+   +RV WK
Sbjct  475  LGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWK  534

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+T+ +EA  +T  NFIAG SWL  T  PF+ GL
Sbjct  535  GYHVITNLTEASEFTVQNFIAGQSWLPDTEVPFTPGL  571



>emb|CBI38888.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 155/217 (71%), Gaps = 1/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + TAG   HQAVALR G D S FYQC   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  44   IRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  103

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+I+ R P   + N +TAQGRTDPNQNTGI I  C++ A  DLK VQ +  T+
Sbjct  104  AAVVLQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  162

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV M++ +  +I+PAGW EW+G FAL TL Y EY NTG G+ T  RV W 
Sbjct  163  LGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWA  222

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TSSSEA  +T  NFIAG+SWL +T  PF+ GL
Sbjct  223  GYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  259



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             + TAG E HQAVALR G D S FY+C    YQDTLYVHS RQFY  C + GT+DF FGN
Sbjct  314  IRNTAGPENHQAVALRSGADLSVFYRCSFEAYQDTLYVHSQRQFYKECDIYGTIDFIFGN  373

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAV QDC I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A+ DL PV  +F +F
Sbjct  374  AAAVLQDCKIYARRPMVKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLVPVLGSFRSF  433

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV MQ+ I  +IDP GW EW G+FAL+TL Y EY+N+G G+ T +RV W 
Sbjct  434  LGRPWKLYSRTVYMQTYIDSLIDPVGWLEWDGSFALDTLYYGEYRNSGPGSNTTRRVNWS  493

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T++SEA T+T +NFIAG SWL +T  PF+ GL
Sbjct  494  GYRVITNASEASTFTVANFIAGQSWLPATGVPFTAGL  530



>gb|EYU46749.1| hypothetical protein MIMGU_mgv1a0044631mg, partial [Erythranthe 
guttata]
Length=325

 Score =   280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 154/213 (72%), Gaps = 0/213 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFYQC  + YQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  106  FENYAGPSKHQAVALRSGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  165

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+ +++AR+P   QKN+ TAQGR DPNQNTGI I  C++AA  DL PV   F TF
Sbjct  166  AAVVFQNSNLYARKPDPNQKNIFTAQGREDPNQNTGISILNCKVAAAADLIPVLSQFRTF  225

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK YSRTV M S +  V+DP GW EW G FALNT  YREY+N G G+ T  RVTW 
Sbjct  226  LGRPWKLYSRTVFMFSNMEAVVDPKGWLEWDGDFALNTSYYREYKNRGPGSNTTARVTWT  285

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPF  315
            GY V+ SS+EA  +T +NFI G+ WL +T FPF
Sbjct  286  GYAVLNSSTEASQFTVANFIQGNQWLPATGFPF  318



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 156/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVALR G D SAFYQC  + YQDTLYVHSLRQFY  C V GTVDF FGN
Sbjct  341  FENFAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++AR+P   QKN+ TAQGR DPNQNTGI I  C++ A  DL PV  +F  +
Sbjct  401  AAVVFQNCNLYARKPNPNQKNIFTAQGREDPNQNTGISILNCKVEAASDLVPVLSSFKNY  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV + S I  +IDPAGW EW G FALNTL Y EY N G G+ T  RV W 
Sbjct  461  LGRPWKQYSRTVFLLSNIGSLIDPAGWLEWDGNFALNTLYYGEYLNKGPGSNTNARVKWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +   NF+ GS WL +T FPF LGL
Sbjct  521  GYRVINSSAEASQFNVGNFLQGSQWLPATGFPFFLGL  557



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 159/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG E HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  355  FQNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  414

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+AR+P +GQKN +TAQGRTDPNQNTGI I   R+ AT DLKPV+    T+
Sbjct  415  AAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTY  474

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV M++ I  ++DP GW EW G FALNTL Y EY N G G+   +RV WK
Sbjct  475  LGRPWKEYSRTVFMKTYIDSLVDPTGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWK  534

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+++S+EA  +T  NFIAG SWL +T  PF+ GL
Sbjct  535  GYHVISNSTEASEFTVQNFIAGQSWLPNTEVPFTPGL  571



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 163/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFY+C  +GYQDTLYVHSLRQFY +C + GTVDF FGN
Sbjct  344  FENSAGPNKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGTVDFIFGN  403

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++ARRP   QKN+ TAQGR DPNQNT I I   ++ A  DL PV+ +F T+
Sbjct  404  AAVVFQNCNLYARRPNDNQKNIFTAQGRQDPNQNTXISILDSKVTAASDLIPVKSSFKTY  463

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV ++S + D+IDPAGW EW+G FAL TL Y EY N G GA T  RV+W 
Sbjct  464  LGRPWKEYSRTVFLRSFLDDLIDPAGWLEWSGDFALTTLYYGEYMNRGPGANTSSRVSWP  523

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T ++FI G+ WLSST  P+  GL
Sbjct  524  GYRVINSSTEASQFTVASFIQGNEWLSSTGVPYFSGL  560



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG +KHQAVALRVG D+S   +C +  YQDTLY HS RQFY +  V GTVDF FGN
Sbjct  336  FQNTAGPQKHQAVALRVGADQSVINRCRIDAYQDTLYAHSNRQFYRDSTVTGTVDFIFGN  395

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C + AR+  SGQKNM+TAQGRTDPNQNTG  IQKC I+A+ DL+PV+ ++ ++
Sbjct  396  AAVVFQNCKLVARKGMSGQKNMVTAQGRTDPNQNTGTSIQKCEISASSDLEPVKASYKSY  455

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV+MQSTI D+IDPAGW EW   FAL TL Y EY N G GAGT KRV W 
Sbjct  456  LGRPWKEYSRTVVMQSTIGDLIDPAGWAEWDKDFALKTLYYGEYANQGPGAGTSKRVNWA  515

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY V+TS SEAQ +T +  I G  WL ++   ++ GL
Sbjct  516  GYHVITSPSEAQKFTVAELIQGGYWLKNSGVAYTEGL  552



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FYQC   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  302  FRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  361

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNTGI I   R+ A  DL PV   F TF
Sbjct  362  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTF  421

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV MQ+ +  ++DPAGW EW+G FALNTL Y EY+N G  A T  RV W+
Sbjct  422  LGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWR  481

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T  +FI G+SWL +T  PF  GL
Sbjct  482  GYRVITSATEASKFTVGSFITGNSWLPATGVPFRSGL  518



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 158/213 (74%), Gaps = 0/213 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  KHQAVALR G D SAFY+C  + YQDTLYVHSLRQFY +C V GTVDF FGN
Sbjct  264  FENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  323

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   Q+N+ TAQGR DPNQNTGI I  C++AA  DL PV+  F  +
Sbjct  324  AATVLQNCNLYARKPNENQRNLFTAQGREDPNQNTGISILNCKVAAAADLIPVKSQFKNY  383

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV + S + D+IDP GW EW GTFAL+TL Y EY N G G+ T  RVTW 
Sbjct  384  LGRPWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFALDTLYYGEYNNRGPGSNTSARVTWP  443

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPF  315
            GY+V+ +++EA  +T  NFI G+ WLSST  PF
Sbjct  444  GYRVIKNATEANQFTVRNFIQGNEWLSSTDIPF  476



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 161/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  301  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  360

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTDPNQNT I I   R+ A+ DL+PV  +F T+
Sbjct  361  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTPISIHNSRVMASSDLRPVLSSFKTY  420

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV +Q+ +  ++DPAGW EW G FALNTL Y EY+N G GA T  RV W+
Sbjct  421  LGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNFGPGASTRGRVKWR  480

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TSS+EA  +T +NFIAG SWL +T  PF  GL
Sbjct  481  GYRVITSSTEASRFTVANFIAGRSWLPATGVPFYPGL  517



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G D S FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  304  FRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGTVDFIFGN  363

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I+ARRP   QKN++TAQGRTD NQNTGI I   R+ A+ DL+PV  +F TF
Sbjct  364  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDANQNTGISIHNSRVMASSDLRPVLSSFKTF  423

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV +Q+ +  ++D AGW EW G FALNTL Y EY+N+G GA T  RV W+
Sbjct  424  LGRPWKEYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWR  483

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS++EA  +T +NFIAG SWL +T  PFS GL
Sbjct  484  GYRVITSATEASRFTVANFIAGRSWLPATGVPFSSGL  520



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+  AG  KHQAVA R G D SAFY+C  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  360  FENAAGPSKHQAVAFRSGSDFSAFYKCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  419

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C+++AR+P   QKNM TAQGR DPNQNTGI I   ++AA  DL PV+  F T+
Sbjct  420  AAVVLQNCNLYARKPNENQKNMFTAQGREDPNQNTGISILNSKVAAASDLVPVKAMFKTY  479

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV M+S I D+++PAGW EW GTFAL+TL Y EY N G G+ T  RVTW 
Sbjct  480  LGRPWKEYSRTVYMKSYIDDLVEPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWP  539

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T   FI G+ WL++T  P+ +GL
Sbjct  540  GYRVINSSAEANQFTVGPFIQGNEWLNATNIPYFIGL  576



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 156/217 (72%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG  KHQAVALR   D S FYQC   GYQDTLY HSLRQFY  C + GTVDF FGN
Sbjct  256  FRNTAGPAKHQAVALRSSSDLSVFYQCSFQGYQDTLYAHSLRQFYRECKIYGTVDFIFGN  315

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+I+ RRP S QKN +TAQGRTDPNQNTGI IQ CR+ A  DL+PV+ +F TF
Sbjct  316  AAVVFQNCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQNCRVTAAKDLRPVRSSFQTF  375

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRP KEYSRTV M++ + D+I PAGW EW+G FAL TL Y E++NTG G+ T KRV W 
Sbjct  376  LGRPLKEYSRTVYMETYMDDLISPAGWLEWSGDFALETLFYGEFRNTGPGSNTSKRVKWG  435

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY ++T  S A  +T    IAG  WL S+  PF L L
Sbjct  436  GYHIITDPSTALEFTARILIAGEMWLPSSGLPFKLDL  472



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 160/216 (74%), Gaps = 0/216 (0%)
 Frame = -3

Query  950  KXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGNA  771
            + +AG  KHQAVALR G D SAFY+C  +GYQDTLYVHSLRQFY  C V GTVDF FGNA
Sbjct  331  ENSAGPSKHQAVALRSGSDLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGNA  390

Query  770  AAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTFL  591
            A VFQ C+++AR+P + QKN++TAQGR DPNQNTGI I  C++AA  DL P Q  F T+L
Sbjct  391  AVVFQICNLYARKPNANQKNIITAQGREDPNQNTGISILNCKVAAASDLIPYQTEFKTYL  450

Query  590  GRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWKG  411
            GRPWKEYSRTV M S + D+I PAGW EW GTFAL+TL Y EY+N G G+ T  RVTW G
Sbjct  451  GRPWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPG  510

Query  410  YKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            Y+V+ +S+ A  +T   F+ GS WL+ST  PF L L
Sbjct  511  YRVINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNL  546



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 158/217 (73%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ TAG + HQAVALR G DRS FY+C   GYQDTLYVHS RQFY  C + GTVDF FGN
Sbjct  308  FRNTAGPQNHQAVALRSGSDRSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  367

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA V Q+C I ARRP   QK  +TAQGRTDPNQNTGI I   R+ A  DL+PV   F TF
Sbjct  368  AAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVLSTFKTF  427

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWK+YSRTV M++ +  ++DPAGW EW G FALNTL Y EY+N+G GA T +RV W+
Sbjct  428  LGRPWKQYSRTVFMKTYLHSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTSRRVRWR  487

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+T+S+EA  ++  NFI G SWL +T  PF  GL
Sbjct  488  GYRVITNSNEAAKFSVENFIGGRSWLPATNVPFRAGL  524



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score =   286 bits (731),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 162/217 (75%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
            F+ +AG  K+QAVALR G D SAFY+C  + YQDTLYVHSLRQFY  C + GTVD  FGN
Sbjct  341  FENSAGPSKNQAVALRSGSDLSAFYKCSFVAYQDTLYVHSLRQFYRECDIYGTVDCIFGN  400

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AAAVFQ C ++AR+P   Q+N+ TAQGR DPNQNTGI I  C+I A  DL PV  +F T+
Sbjct  401  AAAVFQACSLYARKPNPDQENVFTAQGRADPNQNTGISILNCKIRADSDLIPVISSFKTY  460

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTVIM+S I D++DPAGW EW G FALNTL Y E+ N G G+ T +RVTW 
Sbjct  461  LGRPWKEYSRTVIMRSYIDDLVDPAGWLEWNGNFALNTLYYGEFLNRGPGSDTSRRVTWP  520

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+TS ++A  +T   FI G+ WL+ST  PF+LGL
Sbjct  521  GYRVITSFADANQFTVGAFIQGNQWLNSTDIPFNLGL  557



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   286 bits (733),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 160/217 (74%), Gaps = 0/217 (0%)
 Frame = -3

Query  953  FKXTAGHEKHQAVALRVGXDRSAFYQCDMLGYQDTLYVHSLRQFYINCLVAGTVDFXFGN  774
             +  AG  KHQAVALR G D SAFY+C  +GYQDTLYVHSLRQFY  C + GTVDF FGN
Sbjct  366  IENAAGPSKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  425

Query  773  AAAVFQDCDIHARRPGSGQKNMLTAQGRTDPNQNTGIVIQKCRIAATFDLKPVQKNFPTF  594
            AA VFQ+C+++ARRP + QKN+ TAQGR DPNQNTGI I  C++    DL PV+ +F T+
Sbjct  426  AAVVFQNCNLYARRPNANQKNIFTAQGREDPNQNTGISILNCKVTLAADLSPVKSSFHTY  485

Query  593  LGRPWKEYSRTVIMQSTISDVIDPAGWHEWTGTFALNTLTYREYQNTGAGAGTFKRVTWK  414
            LGRPWKEYSRTV + S + D+I+PAGW EW+G F L+TL Y EY N G G+ T  RV W 
Sbjct  486  LGRPWKEYSRTVFIGSYLDDLINPAGWLEWSGNFGLSTLYYGEYMNKGPGSDTTNRVKWP  545

Query  413  GYKVMTSSSEAQTYTPSNFIAGSSWLSSTTFPFSLGL  303
            GY+V+ SS+EA  +T ++FI G  WLSST  P+S GL
Sbjct  546  GYRVINSSTEATQFTVASFIQGGGWLSSTGIPYSAGL  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2336926777002