BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12481

Length=1728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57272.1|  elongation factor 1-alpha                              902   0.0     Ipomoea nil [qian niu]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          893   0.0     Nicotiana tomentosiformis
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               891   0.0     Nicotiana tomentosiformis
ref|NP_001049145.1|  Os03g0177400                                       891   0.0     
gb|AAC15413.1|  translation elongation factor-1 alpha                   890   0.0     Oryza sativa Japonica Group [Japonica rice]
dbj|BAA34348.1|  elongation factor-1 alpha                              890   0.0     Nicotiana paniculata
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          890   0.0     Oryza brachyantha
dbj|BAA23658.1|  EF-1 alpha                                             889   0.0     Oryza sativa [red rice]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          889   0.0     Nicotiana sylvestris
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               889   0.0     Nicotiana tomentosiformis
gb|AGH32502.1|  translation elongation factor-1 alpha                   888   0.0     Stylosanthes guianensis [stylo]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               888   0.0     Nicotiana sylvestris
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               887   0.0     Tarenaya hassleriana [spider flower]
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          887   0.0     Nicotiana sylvestris
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          887   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          887   0.0     Tarenaya hassleriana [spider flower]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          886   0.0     Tarenaya hassleriana [spider flower]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    886   0.0     
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          886   0.0     Solanum lycopersicum
ref|NP_001234035.1|  elongation factor 1-alpha                          886   0.0     Solanum lycopersicum
gb|KJB09231.1|  hypothetical protein B456_001G130700                    885   0.0     Gossypium raimondii
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          885   0.0     Tarenaya hassleriana [spider flower]
gb|KHG20498.1|  Elongation factor 1-alpha                               885   0.0     Gossypium arboreum [tree cotton]
gb|AGY80449.1|  elongation factor 1-alpha                               885   0.0     Dendrocalamus latiflorus [sweet bamboo]
gb|ABU63160.1|  elongation factor                                       885   0.0     Saccharum officinarum [noble cane]
ref|NP_001152668.1|  LOC100286309                                       885   0.0     Zea mays [maize]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          885   0.0     Solanum tuberosum [potatoes]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    885   0.0     Theobroma cacao [chocolate]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    885   0.0     Nicotiana tabacum [American tobacco]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               884   0.0     Sesamum indicum [beniseed]
gb|ABA12218.1|  translation elongation factor 1A-2                      884   0.0     Gossypium hirsutum [American cotton]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    884   0.0     Theobroma cacao [chocolate]
ref|NP_001105587.1|  elongation factor 1-alpha                          884   0.0     Zea mays [maize]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             884   0.0     Citrus clementina [clementine]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               884   0.0     Elaeis guineensis
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    884   0.0     
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  884   0.0     Citrus sinensis [apfelsine]
ref|XP_012082305.1|  PREDICTED: elongation factor 1-alpha isoform X1    883   0.0     Jatropha curcas
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               883   0.0     Elaeis guineensis
gb|KHG26926.1|  Elongation factor 1-alpha                               883   0.0     Gossypium arboreum [tree cotton]
gb|AAN77897.1|  elongation factor 1 alpha                               883   0.0     Stevia rebaudiana
gb|ABA12220.1|  translation elongation factor 1A-4                      883   0.0     Gossypium hirsutum [American cotton]
dbj|BAC23049.1|  Elongation factor 1-alpha                              883   0.0     Solanum tuberosum [potatoes]
gb|AFC88830.1|  putative elongation factor 1-alpha                      883   0.0     Miscanthus sinensis
gb|ADI24333.1|  elongation factor 1-alpha                               883   0.0     Miscanthus sinensis
gb|ABA12221.1|  translation elongation factor 1A-5                      883   0.0     Gossypium hirsutum [American cotton]
gb|ABA12225.1|  translation elongation factor 1A-9                      883   0.0     Gossypium hirsutum [American cotton]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    882   0.0     Eucalyptus grandis [rose gum]
gb|AGT16893.1|  elongation factor 1-alpha                               882   0.0     Saccharum hybrid cultivar R570
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          882   0.0     Sesamum indicum [beniseed]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    882   0.0     Sesamum indicum [beniseed]
gb|KHG23927.1|  Elongation factor 1-alpha                               882   0.0     Gossypium arboreum [tree cotton]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    882   0.0     Eucalyptus grandis [rose gum]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          882   0.0     Solanum tuberosum [potatoes]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          882   0.0     Nelumbo nucifera [Indian lotus]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                882   0.0     
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          881   0.0     Elaeis guineensis
gb|ABA12217.1|  translation elongation factor 1A-1                      881   0.0     Gossypium hirsutum [American cotton]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          881   0.0     Setaria italica
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    881   0.0     Zea mays [maize]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               881   0.0     Tarenaya hassleriana [spider flower]
gb|KHG28979.1|  Elongation factor 1-alpha                               881   0.0     Gossypium arboreum [tree cotton]
ref|XP_012082304.1|  PREDICTED: elongation factor 1-alpha-like          881   0.0     Jatropha curcas
gb|ABB86283.1|  elongation factor-1 alpha-like                          881   0.0     Solanum tuberosum [potatoes]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    881   0.0     Setaria italica
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    881   0.0     Theobroma cacao [chocolate]
gb|ACR38047.1|  unknown                                                 881   0.0     Zea mays [maize]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          880   0.0     Eucalyptus grandis [rose gum]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               880   0.0     Phoenix dactylifera
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             880   0.0     Citrus clementina [clementine]
gb|ABV26710.1|  elongation factor 1 alpha                               880   0.0     Gerbera hybrid cultivar
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               880   0.0     Pyrus x bretschneideri [bai li]
emb|CDX95108.1|  BnaC05g05630D                                          880   0.0     
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          880   0.0     
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     880   0.0     Glycine max [soybeans]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             880   0.0     Brassica rapa
gb|KHN14872.1|  Elongation factor 1-alpha                               880   0.0     Glycine soja [wild soybean]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   880   0.0     Ornithogalum longebracteatum [sea-onion]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          880   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          880   0.0     Zea mays [maize]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    880   0.0     Zea mays [maize]
ref|NP_001290506.1|  elongation factor 1-alpha                          880   0.0     Elaeis guineensis
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               879   0.0     Eucalyptus grandis [rose gum]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                879   0.0     Ricinus communis
gb|ABA12219.1|  translation elongation factor 1A-3                      879   0.0     Gossypium hirsutum [American cotton]
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               879   0.0     Vitis vinifera
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     879   0.0     Saccharum hybrid cultivar CP65-357
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          879   0.0     Elaeis guineensis
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          879   0.0     Tarenaya hassleriana [spider flower]
gb|KHG01531.1|  Elongation factor 1-alpha                               879   0.0     Gossypium arboreum [tree cotton]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          879   0.0     Phoenix dactylifera
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               879   0.0     Malus domestica [apple tree]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          879   0.0     Pyrus x bretschneideri [bai li]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             879   0.0     Solanum tuberosum [potatoes]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    879   0.0     
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          878   0.0     Elaeis guineensis
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        878   0.0     Brassica rapa
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    878   0.0     
gb|ABA12223.1|  translation elongation factor 1A-7                      878   0.0     Gossypium hirsutum [American cotton]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             878   0.0     Citrus clementina [clementine]
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    878   0.0     Populus euphratica
gb|KHG27341.1|  Elongation factor 1-alpha                               878   0.0     Gossypium arboreum [tree cotton]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          878   0.0     Eucalyptus grandis [rose gum]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        878   0.0     Brassica rapa
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          878   0.0     Eucalyptus grandis [rose gum]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             878   0.0     Capsella rubella
gb|KJB76528.1|  hypothetical protein B456_012G093800                    877   0.0     Gossypium raimondii
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          877   0.0     Phoenix dactylifera
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               877   0.0     Cucumis melo [Oriental melon]
gb|AID52924.1|  elongation factor 1-alpha                               877   0.0     Carthamus tinctorius
ref|NP_200847.1|  elongation factor 1-alpha 4                           877   0.0     Arabidopsis thaliana [mouse-ear cress]
dbj|BAC66180.1|  elongation factor 1A                                   877   0.0     Avicennia marina
ref|XP_002892424.1|  T6D22.2                                            877   0.0     
gb|AHE76183.1|  elongation factor 1-alpha                               877   0.0     Chrysanthemum indicum
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    877   0.0     
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        877   0.0     Brassica rapa
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             877   0.0     Eutrema salsugineum [saltwater cress]
gb|ACS68200.1|  elongation factor 1 alpha                               877   0.0     Brassica napus [oilseed rape]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          877   0.0     Elaeis guineensis
ref|XP_012082303.1|  PREDICTED: elongation factor 1-alpha-like          877   0.0     Jatropha curcas
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     877   0.0     Glycine max [soybeans]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             877   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ACG31866.1|  elongation factor 1-alpha                               876   0.0     Zea mays [maize]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     876   0.0     Zea mays [maize]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               876   0.0     Fragaria vesca subsp. vesca
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha               876   0.0     Cucumis sativus [cucumbers]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    876   0.0     Populus euphratica
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          876   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          876   0.0     Phoenix dactylifera
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               876   0.0     Cucumis melo [Oriental melon]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   876   0.0     Lilium longiflorum [Easter lily]
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha               876   0.0     Cucumis sativus [cucumbers]
emb|CAA34456.1|  elongation factor 1-alpha                              876   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    876   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          875   0.0     Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH19898.1|  AT1G07930                                              875   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ABA12224.1|  translation elongation factor 1A-8                      875   0.0     Gossypium hirsutum [American cotton]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          875   0.0     Cicer arietinum [garbanzo]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             875   0.0     Prunus persica
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             875   0.0     Prunus persica
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               875   0.0     Brachypodium distachyon [annual false brome]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    875   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          875   0.0     Populus euphratica
gb|KHN42761.1|  Elongation factor 1-alpha                               875   0.0     Glycine soja [wild soybean]
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               875   0.0     Tarenaya hassleriana [spider flower]
gb|AAF79822.1|AC026875_2  T6D22.2                                       875   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   875   0.0     Lilium longiflorum [Easter lily]
gb|AEN79476.1|  elongation factor 1-alpha                               875   0.0     Ziziphus jujuba [Chinese jujube]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          875   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          875   0.0     Malus domestica [apple tree]
ref|NP_001288465.1|  elongation factor 1-alpha-like                     875   0.0     Zea mays [maize]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        875   0.0     Bruguiera sexangula
gb|AGJ50595.1|  EF1alpha                                                875   0.0     Pericallis cruenta
dbj|BAF02151.1|  elongation factor 1-alpha                              875   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAX54511.1|  elongation factor 1 alpha                               874   0.0     Actinidia deliciosa [Chinese gooseberry]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   874   0.0     Lilium longiflorum [Easter lily]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        874   0.0     Hevea brasiliensis [jebe]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    874   0.0     Populus euphratica
gb|ACG34498.1|  elongation factor 1-alpha                               874   0.0     Zea mays [maize]
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    874   0.0     
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               874   0.0     Fragaria vesca subsp. vesca
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               874   0.0     Vitis vinifera
gb|AAL57653.1|  At1g07930/T6D22_3                                       874   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAL32631.1|  putative elongation factor 1-a                          874   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          874   0.0     Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               874   0.0     Prunus mume [ume]
ref|NP_001105617.1|  elongation factor alpha3                           874   0.0     Zea mays [maize]
dbj|BAL14665.1|  elongation factor 1-alpha                              874   0.0     Chrysanthemum seticuspe f. boreale
ref|XP_003618775.1|  Elongation factor 1-alpha                          874   0.0     
gb|AAL79775.1|  elongation factor 1 alpha                               874   0.0     Saccharum hybrid cultivar CP72-2086
gb|KHN18669.1|  Elongation factor 1-alpha                               873   0.0     Glycine soja [wild soybean]
gb|ACI96243.1|  elongation factor 1-alpha                               873   0.0     Prunus persica
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    873   0.0     Manihot esculenta [manioc]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             873   0.0     Phaseolus vulgaris [French bean]
gb|AEQ75495.1|  elongation factor 1-alpha                               873   0.0     Rosa multiflora [Japanese rose]
ref|NP_001105933.1|  elongation factor alpha2                           872   0.0     
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  872   0.0     Solanum tuberosum [potatoes]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          872   0.0     Fragaria vesca subsp. vesca
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             872   0.0     Prunus persica
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    872   0.0     Glycine max [soybeans]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               872   0.0     Musa acuminata subsp. malaccensis [pisang utan]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         872   0.0     Medicago truncatula
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             872   0.0     Phaseolus vulgaris [French bean]
gb|AIX10769.1|  elongation factor 1 alpha                               872   0.0     Panax notoginseng [san-qi]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          872   0.0     Prunus mume [ume]
ref|XP_003604823.1|  Elongation factor 1-alpha                          872   0.0     
ref|NP_001280807.1|  elongation factor 1-alpha-like                     872   0.0     Malus domestica [apple tree]
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          871   0.0     Populus euphratica
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         871   0.0     Medicago truncatula
gb|AGI15328.1|  elongation factor 1                                     871   0.0     Aegiceras corniculatum
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    871   0.0     Populus euphratica
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          871   0.0     
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         871   0.0     Medicago truncatula
gb|ABA12222.1|  translation elongation factor 1A-6                      871   0.0     Gossypium hirsutum [American cotton]
ref|XP_006846237.1|  PREDICTED: elongation factor 1-alpha               871   0.0     Amborella trichopoda
gb|EPS66340.1|  elongation factor 1-alpha                               871   0.0     Genlisea aurea
gb|AFP44110.1|  elongation factor 1-alpha                               871   0.0     Lycoris longituba
ref|XP_002311107.1|  ADR12-2 family protein                             871   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          870   0.0     
ref|XP_002312029.1|  ADR12-2 family protein                             870   0.0     Populus trichocarpa [western balsam poplar]
gb|AAY56337.1|  elongation factor-1 alpha                               870   0.0     Musa acuminata [banana]
gb|AGC94754.1|  elongation factor 1 alpha                               870   0.0     Euphorbia lathyris
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        870   0.0     Brassica rapa
gb|EPS66069.1|  elongation factor 1-alpha                               870   0.0     Genlisea aurea
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          870   0.0     Sorghum bicolor [broomcorn]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          870   0.0     
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        870   0.0     Hevea brasiliensis [jebe]
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             870   0.0     Populus trichocarpa [western balsam poplar]
gb|AAK82537.1|  At1g07930/T6D22_3                                       870   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011655319.1|  PREDICTED: elongation factor 1-alpha-like is...    869   0.0     Cucumis sativus [cucumbers]
ref|NP_001105935.1|  elongation factor alpha8                           869   0.0     
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          869   0.0     Pyrus x bretschneideri [bai li]
ref|NP_001151074.1|  elongation factor 1-alpha                          869   0.0     
ref|XP_011655322.1|  PREDICTED: elongation factor 1-alpha-like          868   0.0     Cucumis sativus [cucumbers]
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          868   0.0     Malus domestica [apple tree]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         868   0.0     
ref|XP_006858667.1|  PREDICTED: elongation factor 1-alpha               868   0.0     Amborella trichopoda
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             868   0.0     
ref|XP_002311106.1|  ADR12-2 family protein                             868   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               868   0.0     Vitis vinifera
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          868   0.0     Cicer arietinum [garbanzo]
gb|EMS59091.1|  Elongation factor 1-alpha                               868   0.0     Triticum urartu
gb|AHB86963.1|  elongation factor 1-alpha                               868   0.0     Sedum alfredii
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             868   0.0     
ref|NP_001237425.1|  elongation factor-1A                               868   0.0     
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    867   0.0     Daucus carota [carrots]
ref|XP_006856244.1|  PREDICTED: elongation factor 1-alpha               867   0.0     Amborella trichopoda
gb|AGV54713.1|  elongation factor 1-alpha                               867   0.0     Phaseolus vulgaris [French bean]
dbj|BAM13877.1|  elongation factor 1 alpha                              867   0.0     Arum maculatum [cuckoo-pint]
dbj|BAM13874.1|  elongation factor 1 alpha                              867   0.0     Symplocarpus renifolius
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               867   0.0     Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             867   0.0     Prunus persica
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    867   0.0     Glycine max [soybeans]
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    866   0.0     Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105565.1|  elongation factor alpha5                           866   0.0     
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             866   0.0     Populus trichocarpa [western balsam poplar]
gb|KHG15275.1|  Elongation factor 1-alpha                               865   0.0     Gossypium arboreum [tree cotton]
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        865   0.0     Salsola komarovii
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          865   0.0     Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          865   0.0     Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               865   0.0     Prunus mume [ume]
gb|AAF99703.1|  elongation factor                                       865   0.0     Saccharum officinarum [noble cane]
gb|EMS52529.1|  Elongation factor 1-alpha                               864   0.0     Triticum urartu
gb|EMS65134.1|  Elongation factor 1-alpha                               864   0.0     Triticum urartu
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    863   0.0     Vicia faba [broad bean]
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                863   0.0     Erythranthe guttata [common monkey flower]
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             863   0.0     Phaseolus vulgaris [French bean]
gb|EMT09703.1|  Elongation factor 1-alpha                               863   0.0     
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        862   0.0     Suaeda japonica
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    862   0.0     Daucus carota [carrots]
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                861   0.0     Erythranthe guttata [common monkey flower]
gb|AHA84124.1|  elongation factor 1-alpha                               861   0.0     Phaseolus vulgaris [French bean]
gb|AIM48895.1|  elongation factor 1-alpha                               860   0.0     Cinnamomum camphora
ref|XP_003604587.1|  Elongation factor 1-alpha                          860   0.0     Medicago truncatula
gb|ABD66517.1|  EF-1 alpha                                              860   0.0     Gymnadenia conopsea
gb|AAL69396.1|  elongation factor 1-alpha                               860   0.0     Elaeis oleifera
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             859   0.0     Selaginella moellendorffii
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             859   0.0     Selaginella moellendorffii
gb|AGI78242.1|  elongation factor 1 alpha                               859   0.0     Caragana korshinskii
gb|AER42621.1|  elongation factor 1 alpha                               859   0.0     Hordeum brevisubulatum
gb|AGD99674.1|  eukaryotic elongation factor 1A                         858   0.0     Salicornia bigelovii
gb|AIZ74328.1|  translation elongation factor 1-alpha                   858   0.0     Pinus massoniana [Chinese red pine]
gb|ACN41180.1|  unknown                                                 858   0.0     Picea sitchensis
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             858   0.0     Selaginella moellendorffii
gb|ABK25072.1|  unknown                                                 858   0.0     Picea sitchensis
ref|NP_001275481.1|  elongation factor 1-alpha-like                     858   0.0     Solanum tuberosum [potatoes]
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             858   0.0     Selaginella moellendorffii
gb|ACN40740.1|  unknown                                                 857   0.0     Picea sitchensis
gb|EMS49772.1|  Elongation factor 1-alpha                               857   0.0     Triticum urartu
gb|AFJ04514.1|  elongation factor 1-alpha                               857   0.0     Vernicia fordii [tung oil tree]
gb|ABK24265.1|  unknown                                                 857   0.0     Picea sitchensis
gb|EMT12343.1|  Elongation factor 1-alpha                               855   0.0     
gb|ABK24843.1|  unknown                                                 855   0.0     Picea sitchensis
gb|ABR17675.1|  unknown                                                 854   0.0     Picea sitchensis
gb|ACN40081.1|  unknown                                                 853   0.0     Picea sitchensis
ref|NP_001105934.1|  elongation factor alpha7                           853   0.0     
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 853   0.0     Larix kaempferi [karamatsu]
emb|CAC27139.1|  translation elongation factor-1 alpha                  851   0.0     Picea abies
gb|AHU86550.1|  elongation factor 1 alpha                               850   0.0     Marchantia polymorpha
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    850   0.0     
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 850   0.0     
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    847   0.0     
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         847   0.0     
gb|ABF00115.1|  elongation factor 1-alpha                               847   0.0     
ref|XP_003588821.1|  Elongation factor 1-alpha                          845   0.0     
ref|XP_001766482.1|  predicted protein                                  845   0.0     
gb|AEE98364.1|  elongation factor 1-alpha                               844   0.0     
ref|XP_001753181.1|  predicted protein                                  844   0.0     
ref|XP_001763201.1|  predicted protein                                  844   0.0     
ref|NP_001104939.1|  elongation factor alpha6                           843   0.0     
ref|XP_001753167.1|  predicted protein                                  843   0.0     
ref|XP_001753059.1|  predicted protein                                  843   0.0     
ref|XP_001763194.1|  predicted protein                                  843   0.0     
gb|AHZ58493.1|  translation elongation factor alpha                     842   0.0     
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    842   0.0     
emb|CAD60652.1|  elongation factor                                      837   0.0     
ref|NP_001104938.1|  elongation factor 1 alpha                          836   0.0     
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     834   0.0     
gb|EEE58429.1|  hypothetical protein OsJ_09630                          834   0.0     
dbj|BAK08744.1|  elongation factor 1-alpha                              828   0.0     
emb|CDY61938.1|  BnaCnng38780D                                          825   0.0     
gb|KJB48747.1|  hypothetical protein B456_008G084000                    825   0.0     
dbj|BAK08819.1|  elongation factor 1-alpha                              825   0.0     
emb|CDX93604.1|  BnaA06g04440D                                          825   0.0     
dbj|BAK08818.1|  elongation factor 1-alpha                              825   0.0     
emb|CDY22710.1|  BnaC08g43440D                                          818   0.0     
emb|CDY58828.1|  BnaAnng15460D                                          823   0.0     
gb|AAR82894.1|  elongation factor 1-alpha                               816   0.0     
ref|XP_012082306.1|  PREDICTED: elongation factor 1-alpha isoform X2    816   0.0     
dbj|BAG80668.1|  elongation factor 1 alpha                              801   0.0     
gb|ADD71925.1|  translation elongation factor 1 alpha                   800   0.0     
ref|XP_003591959.1|  Elongation factor 1-alpha                          805   0.0     
gb|AGV54654.1|  elongation factor 1-alpha                               796   0.0     
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         790   0.0     
gb|AGT16628.1|  elongation factor 1 alpha                               789   0.0     
gb|ABQ81936.1|  elongation factor 1-alpha                               790   0.0     
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             788   0.0     
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  787   0.0     
gb|KJB48746.1|  hypothetical protein B456_008G084000                    786   0.0     
gb|AFB18314.1|  translation elongation factor-1 alpha                   785   0.0     
gb|KHG24249.1|  Elongation factor 1-alpha                               782   0.0     
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              783   0.0     
ref|XP_005650451.1|  translation elongation factor                      778   0.0     
ref|NP_001183947.1|  uncharacterized protein LOC100502553               775   0.0     
gb|AEI29162.1|  EF1a-like protein                                       772   0.0     
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               769   0.0     
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       767   0.0     
gb|ACA24136.1|  eukaryotic elongation factor 1-alpha                    764   0.0     
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    764   0.0     
ref|NP_001032107.1|  elongation factor 1-alpha 4                        764   0.0     
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2    761   0.0     
emb|CDX88757.1|  BnaA03g08920D                                          758   0.0     
gb|KJB76560.1|  hypothetical protein B456_012G094600                    754   0.0     
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    747   0.0     
gb|ACL97367.1|  elongation factor-1 alpha                               748   0.0     
gb|ABQ81935.1|  elongation factor 1-alpha                               743   0.0     
gb|ACT36602.1|  elongation factor 1 alpha                               740   0.0     
gb|AAD28440.1|  elongation factor 1-alpha                               741   0.0     
gb|ABW20463.1|  elongation factor 1-alpha                               736   0.0     
gb|ACO50110.1|  elongation factor 1 alpha                               737   0.0     
gb|ACL97363.1|  elongation factor-1 alpha                               736   0.0     
gb|AAD03711.1|  elongation translation factor 1 alpha                   736   0.0     
gb|AIM46989.1|  translation elongation factor 1-alpha                   732   0.0     
gb|KEH43146.1|  elongation factor Tu (EF-Tu) GTP-binding family p...    730   0.0     
gb|ACL97366.1|  elongation factor-1 alpha                               728   0.0     
gb|AAO61852.1|  translation elongation factor-1 alpha                   726   0.0     
gb|ACO50115.1|  elongation factor 1 alpha                               724   0.0     
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             724   0.0     
ref|XP_002904717.1|  translation elongation factor 1-alpha, putative    722   0.0     
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             722   0.0     
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        722   0.0     
gb|EMF17352.1|  translation elongation factor 1-alpha                   721   0.0     
ref|XP_001563777.1|  elongation factor 1-alpha                          720   0.0     
gb|KHN88882.1|  Elongation factor 1-alpha                               721   0.0     
ref|XP_001893409.1|  elongation factor 1-alpha                          720   0.0     
ref|XP_007061563.1|  PREDICTED: elongation factor 1-alpha 1             719   0.0     
gb|AIM46986.1|  translation elongation factor 1-alpha                   719   0.0     
ref|XP_008404506.1|  PREDICTED: elongation factor 1-alpha 1             719   0.0     
ref|XP_010697699.1|  elongation factor 1-alpha                          719   0.0     
gb|EWM21485.1|  translation elongation factor 1                         718   0.0     
ref|NP_956303.1|  eukaryotic translation elongation factor 1 alph...    719   0.0     
sp|P14963.1|EF1A_EUGGR  RecName: Full=Elongation factor 1-alpha; ...    718   0.0     
ref|XP_009520546.1|  hypothetical protein PHYSODRAFT_354062             717   0.0     
ref|XP_010786582.1|  PREDICTED: elongation factor 1-alpha 1             718   0.0     
ref|XP_008905681.1|  elongation factor 1-alpha                          717   0.0     
ref|XP_008277210.1|  PREDICTED: elongation factor 1-alpha 1             718   0.0     
ref|XP_005470211.1|  PREDICTED: elongation factor 1-alpha 1-like        718   0.0     
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 718   0.0     
ref|NP_001017795.1|  eukaryotic translation elongation factor 1 a...    718   0.0     
sp|P27592.1|EF1A_ONCVO  RecName: Full=Elongation factor 1-alpha; ...    718   0.0     
ref|XP_001464664.1|  elongation factor 1-alpha                          717   0.0     
gb|KHJ41847.1|  translation elongation factor EF-1, subunit alpha       718   0.0     
emb|CDI83049.1|  elongation factor 1-alpha, putative                    717   0.0     
ref|XP_007252284.1|  PREDICTED: elongation factor 1-alpha 1             717   0.0     
ref|NP_001016692.1|  eukaryotic translation elongation factor 1 a...    717   0.0     
tpg|DAA05869.1|  TPA: eukaryotic translation elongation factor 1A       717   0.0     
ref|XP_003873865.1|  elongation factor 1-alpha                          717   0.0     
ref|XP_005506801.1|  PREDICTED: elongation factor 1-alpha 1             717   0.0     
ref|XP_005073762.1|  PREDICTED: elongation factor 1-alpha 1             717   0.0     
ref|NP_001079602.1|  elongation factor 1-alpha, oocyte form             717   0.0     
ref|XP_007431170.1|  PREDICTED: elongation factor 1-alpha 1             717   0.0     
ref|XP_003963863.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    717   0.0     
ref|XP_003769255.1|  PREDICTED: elongation factor 1-alpha 1             717   0.0     
gb|AAH71727.1|  Eukaryotic translation elongation factor 1 alpha 1      717   0.0     
ref|NP_989301.1|  eukaryotic translation elongation factor 1 alph...    717   0.0     
ref|XP_006638682.1|  PREDICTED: elongation factor 1-alpha 1-like        717   0.0     
ref|XP_005347640.1|  PREDICTED: elongation factor 1-alpha 1             717   0.0     
ref|XP_011795662.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    717   0.0     
ref|NP_001273851.1|  eukaryotic translation elongation factor 1 a...    717   0.0     
ref|XP_001682258.1|  elongation factor 1-alpha                          716   0.0     
ref|XP_003144331.1|  eukaryotic translation elongation factor 1A        717   0.0     
ref|XP_005044189.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
ref|NP_787032.1|  elongation factor 1-alpha 1                           716   0.0     
ref|XP_009563049.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
dbj|BAD96702.1|  eukaryotic translation elongation factor 1 alpha...    716   0.0     
ref|XP_006168380.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
gb|AAH04005.1|  Eukaryotic translation elongation factor 1 alpha 1      716   0.0     
ref|NP_001167438.1|  Elongation factor 1-alpha 1                        716   0.0     
ref|XP_001365660.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    716   0.0     
gb|AAI54753.1|  Zgc:110335                                              716   0.0     
ref|XP_003204452.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     716   0.0     
ref|XP_001896880.1|  elongation factor 1-alpha (EF-1-alpha)             718   0.0     
gb|AAX36933.1|  eukaryotic translation elongation factor 1 alpha 1      716   0.0     
ref|XP_007515831.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    716   0.0     
ref|XP_006089394.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
emb|CCC51155.1|  putative elongation factor 1-alpha                     716   0.0     
emb|CDP93912.1|  Protein Bm5195, isoform g                              716   0.0     
gb|AAA91895.1|  elongation factor-1 alpha                               716   0.0     
gb|ADK90073.1|  elongation factor 1 alpha                               716   0.0     
ref|XP_004914568.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    716   0.0     
ref|NP_001393.1|  elongation factor 1-alpha 1                           716   0.0     
ref|XP_005746073.1|  PREDICTED: elongation factor 1-alpha 1-like        716   0.0     
dbj|BAD96271.1|  eukaryotic translation elongation factor 1 alpha...    716   0.0     
ref|XP_004077036.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
ref|XP_002190806.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
ref|XP_005431997.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
ref|XP_003226101.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
gb|AAA50406.1|  elongation factor Tu                                    716   0.0     
ref|XP_004004140.1|  PREDICTED: elongation factor 1-alpha 1             716   0.0     
ref|XP_005811264.1|  PREDICTED: elongation factor 1-alpha 1-like ...    716   0.0     
ref|XP_004599948.1|  PREDICTED: elongation factor 1-alpha 1-like        716   0.0     
ref|XP_006020539.1|  PREDICTED: elongation factor 1-alpha 1             715   0.0     
ref|XP_009035936.1|  hypothetical protein AURANDRAFT_36932              715   0.0     
emb|CDJ59653.1|  elongation factor 1-alpha, putative                    715   0.0     
emb|CCC51157.1|  putative EF-1-alpha                                    715   0.0     
ref|XP_008059350.1|  PREDICTED: elongation factor 1-alpha 1             715   0.0     
ref|XP_010347515.1|  PREDICTED: elongation factor 1-alpha 1             715   0.0     
gb|AAI05316.1|  EEF1A1 protein                                          715   0.0     
ref|XP_004553494.1|  PREDICTED: elongation factor 1-alpha 1-like        715   0.0     
emb|CDW53142.1|  eukaryotic translation elongation factor 1A            715   0.0     
gb|AAX40412.1|  elongation factor 1-alpha                               714   0.0     
dbj|BAE30434.1|  unnamed protein product                                715   0.0     
ref|XP_005518198.1|  PREDICTED: elongation factor 1-alpha 1             715   0.0     
ref|XP_001138897.2|  PREDICTED: putative elongation factor 1-alph...    715   0.0     
ref|XP_008427063.1|  PREDICTED: elongation factor 1-alpha 1-like        715   0.0     
ref|XP_005733783.1|  PREDICTED: elongation factor 1-alpha 1-like ...    715   0.0     
ref|XP_008300933.1|  PREDICTED: elongation factor 1-alpha 1-like        715   0.0     
emb|CAA34756.1|  unnamed protein product                                715   0.0     
ref|XP_003380597.1|  elongation factor 1-alpha                          717   0.0     
dbj|BAH56641.1|  elongation factor 1a                                   710   0.0     
gb|AHI45318.1|  elongation factor 1 alpha                               714   0.0     
ref|XP_004270159.1|  PREDICTED: elongation factor 1-alpha 1             715   0.0     
dbj|BAD96750.1|  eukaryotic translation elongation factor 1 alpha...    714   0.0     
dbj|BAD96766.1|  eukaryotic translation elongation factor 1 alpha...    714   0.0     
ref|NP_001266576.1|  elongation factor 1a                               714   0.0     
dbj|BAK63962.1|  elongation factor 1-alpha 1                            714   0.0     
emb|CAI29710.1|  hypothetical protein                                   714   0.0     
ref|XP_003392396.1|  elongation factor 1-alpha                          716   0.0     
emb|CDS13811.1|  Putative Elongation factor 1-alpha (Fragment)          714   0.0     
gb|ESL05580.1|  elongation factor 1-alpha (EF-1-alpha)                  714   0.0     
ref|XP_004586009.1|  PREDICTED: elongation factor 1-alpha 2             714   0.0     
ref|XP_010990993.1|  PREDICTED: elongation factor 1-alpha 1             714   0.0     
ref|XP_008535541.1|  PREDICTED: elongation factor 1-alpha 1             714   0.0     
ref|NP_001126911.1|  elongation factor 1-alpha 1                        714   0.0     
ref|NP_989488.2|  elongation factor 1-alpha 1                           714   0.0     
gb|AAH71841.1|  Eukaryotic translation elongation factor 1 alpha 1      714   0.0     
ref|XP_007551163.1|  PREDICTED: elongation factor 1-alpha 1-like        714   0.0     
ref|XP_008319518.1|  PREDICTED: elongation factor 1-alpha, somati...    714   0.0     
ref|XP_012040393.1|  PREDICTED: elongation factor 1-alpha 1-like        716   0.0     
ref|NP_001081521.1|  elongation factor 1-alpha, oocyte form             714   0.0     
ref|XP_004785941.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    714   0.0     
gb|AAX43357.1|  eukaryotic translation elongation factor 1 alpha 2      714   0.0     
ref|XP_008941891.1|  PREDICTED: elongation factor 1-alpha 1             714   0.0     
emb|CDH48285.1|  elongation factor 1-alpha                              714   0.0     
dbj|BAK62491.1|  elongation factor 1-alpha 1                            714   0.0     
gb|KIW01140.1|  elongation factor 1-alpha                               714   0.0     
ref|NP_001080911.1|  elongation factor 1-alpha, somatic form            714   0.0     
ref|NP_001949.1|  elongation factor 1-alpha 2                           714   0.0     
ref|XP_005802895.1|  PREDICTED: elongation factor 1-alpha-like          714   0.0     
gb|KFO53270.1|  Elongation factor 1-alpha 2                             714   0.0     
ref|XP_003879714.1|  elongation factor 1-alpha, related                 713   0.0     
ref|XP_001551786.1|  elongation factor 1-alpha                          714   0.0     
ref|XP_008606624.1|  elongation factor 1-alpha 1                        713   0.0     
ref|NP_001027570.1|  eukaryotic translation elongation factor 1 a...    714   0.0     
dbj|BAE21802.1|  unnamed protein product                                714   0.0     
ref|XP_004716095.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    714   0.0     
ref|NP_001098132.1|  elongation factor 1-alpha                          714   0.0     
ref|XP_006021708.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    714   0.0     
gb|ELR44723.1|  Elongation factor 1-alpha 2                             714   0.0     
gb|AEZ67032.1|  eukaryotic translation elongation factor a alpha        714   0.0     
ref|XP_004381436.1|  PREDICTED: elongation factor 1-alpha 1             714   0.0     
ref|XP_004410177.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    714   0.0     
gb|EWC48307.1|  elongation factor 1-alpha                               714   0.0     
sp|P17508.2|EF1A3_XENLA  RecName: Full=Elongation factor 1-alpha,...    714   0.0     
dbj|BAC28085.1|  unnamed protein product                                714   0.0     
ref|XP_822465.1|  elongation factor 1-alpha                             713   0.0     
ref|XP_004620338.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    714   0.0     
ref|XP_008577117.1|  PREDICTED: elongation factor 1-alpha 1             713   0.0     
gb|KEH40223.1|  GTP-binding elongation factor Tu family protein         713   0.0     
gb|ESL10875.1|  elongation factor 1-alpha (EF-1-alpha)                  714   0.0     
ref|XP_007059884.1|  PREDICTED: elongation factor 1-alpha 2             713   0.0     
ref|XP_010403626.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    713   0.0     
dbj|BAD96243.1|  eukaryotic translation elongation factor 1 alpha...    713   0.0     
ref|XP_001682260.1|  elongation factor 1-alpha                          713   0.0     
ref|XP_003438367.1|  PREDICTED: elongation factor 1-alpha 1-like ...    713   0.0     
ref|XP_005739861.1|  PREDICTED: elongation factor 1-alpha-like          713   0.0     
ref|XP_006896948.1|  PREDICTED: elongation factor 1-alpha 2             713   0.0     
ref|XP_004370231.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    713   0.0     
ref|XP_001507891.1|  PREDICTED: elongation factor 1-alpha 2             713   0.0     



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/436 (100%), Positives = 436/436 (100%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/436 (98%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEP RP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPNRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/436 (98%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/438 (98%), Positives = 434/438 (99%), Gaps = 2/438 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKL--GGIDKRVIERFEKEAAEMNKRSFKYAW  1467
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKL  GGIDKRVIERFEKEAAEMNKRSFKYAW
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLKLGGIDKRVIERFEKEAAEMNKRSFKYAW  60

Query  1466  VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDS  1287
             VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDS
Sbjct  61    VLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDS  120

Query  1286  TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYL  1107
             TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYL
Sbjct  121   TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYL  180

Query  1106  KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPL  927
             KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPL
Sbjct  181   KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPL  240

Query  926   QDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGF  747
             QDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGF
Sbjct  241   QDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGF  300

Query  746   NVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV  567
             NVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV
Sbjct  301   NVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV  360

Query  566   KFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMR  387
             KFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMR
Sbjct  361   KFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMR  420

Query  386   QTVAVGVIKNVDKKDPTG  333
             QTVAVGVIKNV+KKDPTG
Sbjct  421   QTVAVGVIKNVEKKDPTG  438



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +NEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQLNEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDP+G
Sbjct  421   VAVGVIKNVDKKDPSG  436



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGV+KNVDKKDPTG
Sbjct  421   VAVGVVKNVDKKDPTG  436



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/436 (98%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +NEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQLNEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDP+G
Sbjct  421   VAVGVIKSVDKKDPSG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD IN+ KRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKKDPTG
Sbjct  421   VAVGVIKNVDKKDPTG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEA+QEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEAMQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDSGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+LQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDP+G
Sbjct  421   VAVGVIKSVDKKDPSG  436



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDM+ EPKRP DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEPKRPLDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKD +G
Sbjct  421   VAVGVIKSVDKKDASG  436



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+LQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDP+G
Sbjct  421   VAVGVIKSVDKKDPSG  436



>ref|XP_012082305.1| PREDICTED: elongation factor 1-alpha isoform X1 [Jatropha curcas]
Length=447

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGV+KNVDKKDPTG
Sbjct  421   VAVGVVKNVDKKDPTG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPM+VETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMLVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGLIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGM+VTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMLVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNVDKK+P+G
Sbjct  421   VAVGVIKNVDKKEPSG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEA+QEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEAMQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGV+KNVDKKDPTG
Sbjct  421   VAVGVVKNVDKKDPTG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMINEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LK GMVVTFGP+GLTTEVKSVEMHHE LQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKSGMVVTFGPTGLTTEVKSVEMHHETLQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSK+DPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKEDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDP+G
Sbjct  421   VAVGVIKSVDKKDPSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMI+RSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIDRSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDW+KGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWHKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGM+VTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMLVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVAS SKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEV+SYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVASYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGM+VTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMLVTFAPSGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKV  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_012082304.1| PREDICTED: elongation factor 1-alpha-like [Jatropha curcas]
 gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHIHIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGV+KNVDKKDPTG
Sbjct  421   VAVGVVKNVDKKDPTG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AASF SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAASFASQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   SELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPL D
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLLD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+PTG
Sbjct  421   VAVGVIKSVEKKEPTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  22    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  81

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  82    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  141

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  142   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  201

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  202   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  261

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  262   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNV  321

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  322   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  381

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  382   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  441

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  442   VAVGVIKSVDKKDPTG  457



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMLVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKAR+DEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMINEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKD+KRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDIKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLILEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAATFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE+KSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEIKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDFTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGI KDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGIFKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKAR DEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARSDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF PSGL TEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLPTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALSEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGLIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+PTG
Sbjct  421   VAVGVIKSVEKKEPTG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNL+WYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLEWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+PTG
Sbjct  421   VAVGVIKSVEKKEPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/437 (97%), Positives = 434/437 (99%), Gaps = 1/437 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEM-HHEALQEALPGDNVGFN  744
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEM HHEALQEALPGDNVGFN
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHHEALQEALPGDNVGFN  300

Query  743   VKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK  564
             VKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct  301   VKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVK  360

Query  563   FAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQ  384
             FAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQ
Sbjct  361   FAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQ  420

Query  383   TVAVGVIKNVDKKDPTG  333
             TVAVGV+KNVDKKDPTG
Sbjct  421   TVAVGVVKNVDKKDPTG  437



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMILEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK A SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAGSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVI+RFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIDRFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQ IIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQGIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   SELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_011031813.1| PREDICTED: LOW QUALITY PROTEIN: HBS1-like protein [Populus euphratica]
Length=1057

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1643  IMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  1464
             IMGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV
Sbjct  608   IMGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  667

Query  1463  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  1284
             LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST
Sbjct  668   LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  727

Query  1283  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK  1104
             TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK
Sbjct  728   TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK  787

Query  1103  KVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQ  924
             KVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQ
Sbjct  788   KVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQ  847

Query  923   DVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFN  744
             DVYKIGGIGTVPVGRVETGV+KPG VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFN
Sbjct  848   DVYKIGGIGTVPVGRVETGVIKPGTVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFN  907

Query  743   VKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK  564
             VKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct  908   VKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK  967

Query  563   FAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQ  384
             FAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQ
Sbjct  968   FAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQ  1027

Query  383   TVAVGVIKNVDKKDPT  336
             TVAVGVIK+V+KKD +
Sbjct  1028  TVAVGVIKSVEKKDAS  1043


 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/436 (91%), Positives = 415/436 (95%), Gaps = 0/436 (0%)
 Frame = -2

Query  1643  IMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  1464
             IMGKEK+HINIVVIGH D GKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV
Sbjct  133   IMGKEKSHINIVVIGHDDPGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWV  192

Query  1463  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  1284
             LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST
Sbjct  193   LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST  252

Query  1283  TGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK  1104
             TGGFEAGISKDGQTREHA LAFT GV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYL+
Sbjct  253   TGGFEAGISKDGQTREHAFLAFTXGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLQ  312

Query  1103  KVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQ  924
             KVGY PDKIPFVPISGFE D MIERSTNLDWYKGPTLLEALD I EPKRP+DKP  LPLQ
Sbjct  313   KVGYKPDKIPFVPISGFEDDKMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPRCLPLQ  372

Query  923   DVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFN  744
             DVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFN
Sbjct  373   DVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFN  432

Query  743   VKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK  564
             V NV VKDLK G+VASNSKDDPAK AA+FT+Q+IIMNHPGQI NGY PVLDCHT HIA+K
Sbjct  433   VNNVVVKDLKCGFVASNSKDDPAKEAANFTAQLIIMNHPGQIRNGYVPVLDCHTCHIAIK  492

Query  563   FAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQ  384
             FAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF EYPPLGRFAVRDM Q
Sbjct  493   FAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFLEYPPLGRFAVRDMCQ  552

Query  383   TVAVGVIKNVDKKDPT  336
             TVAVGVIK+V+KKD +
Sbjct  553   TVAVGVIKSVEKKDAS  568



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERST LDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTTLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+R+DEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQILEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+P+KPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPSKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGLIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK H+NIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHLNIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSSYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   QELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 434/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYIKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDM+ EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGM+VTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMLVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+P+G
Sbjct  421   VAVGVIKSVEKKEPSG  436



>ref|XP_002892424.1| T6D22.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68683.1| T6D22.2 [Arabidopsis lyrata subsp. lyrata]
Length=951

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  503   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  562

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  563   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  622

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  623   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  682

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  683   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  742

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  743   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  802

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  803   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  862

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  863   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  922

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  923   VAVGVIKSVDKKDPTG  938


 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTP+YSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPRYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE++QEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESMQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKK PTG
Sbjct  421   VAVGVIKSVDKKHPTG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   877 bits (2266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASN KDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNPKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGK K HINIV+IGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKAKVHINIVIIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+L+PGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILRPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELL+KIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEY PLGRFAVRDMRQT
Sbjct  361   SELLSKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYSPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_012082303.1| PREDICTED: elongation factor 1-alpha-like [Jatropha curcas]
 gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEV SYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVCSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+ NEPKRPT+KPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLSNEPKRPTEKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKR+IERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRLIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKD+KRGYVASNS DDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDIKRGYVASNSXDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSV+MHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVKMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KI FVPISGFEGDNMI+RSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIAFVPISGFEGDNMIDRSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha [Cucumis sativus]
Length=449

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHE+L EA+PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHESLPEAVPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSK+DP K AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKEDPTKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEAL EA+PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALPEAVPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKY+KARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYAKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha [Cucumis sativus]
Length=447

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSAKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSTYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAER+RGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERDRGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHA LAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHAFLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSTYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMV M PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVMMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEV SYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVYSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPG++VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGVIVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMIVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF+ YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGIVKMIPTKPMVVETFAMYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  421   VAVGVIKGVEKKDPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KN AVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNFAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERST+LDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTSLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF E PPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFWESPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|AAF79822.1|AC026875_2 T6D22.2 [Arabidopsis thaliana]
Length=967

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436


 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/436 (97%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  519   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  578

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  579   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  638

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  639   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  698

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  699   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  758

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  759   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  818

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  819   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  878

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  879   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  938

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  939   VAVGVIKSVDKKDPTG  954



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERS NLDWYKGPTLLEALDMINEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSINLDWYKGPTLLEALDMINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKP MVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPAMVVTFGPTGLTTEVKSVEMHHEALVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   NEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KK+PTG
Sbjct  421   VAVGVIKNVEKKEPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITI IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIGIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYL+K
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLEK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INE KRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINELKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELE+EPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEREPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPG+VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGIVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF++YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATT KYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTSKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNV+VKDLKRGYVASNSKDDPAK A+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVSVKDLKRGYVASNSKDDPAKEASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+P+G
Sbjct  421   VAVGVIKSVEKKEPSG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDAINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALSEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKD+KRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDIKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMMPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHV SGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVGSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEASPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERS NLDWYKGPTLLEALD+INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSNNLDWYKGPTLLEALDLINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKEIEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG +KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGFIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKA YDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKACYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_007027265.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY07767.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=566

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSGYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKD +G
Sbjct  421   VAVGVIKSVDKKDASG  436



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDAT+PKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             +GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRP+DKPLRLPLQD
Sbjct  181   IGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDP+G
Sbjct  421   VAVGVIKAVEKKDPSG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDM+ EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+F SQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE++TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCN +DATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNNIDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             V V VIK+VDKKDPTG
Sbjct  421   VTVSVIKSVDKKDPTG  436



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPLDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF+EY PLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRL LQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLALQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RY+ I+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEVIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_003618775.1| Elongation factor 1-alpha [Medicago truncatula]
Length=987

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/453 (93%), Positives = 439/453 (97%), Gaps = 3/453 (1%)
 Frame = -2

Query  1691  QVSRVNSLCIRKLS*SIMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFE  1512
             ++   N+L  R    +IMGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFE
Sbjct  527   RIRTSNNLTFRF---NIMGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFE  583

Query  1511  KEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMI  1332
             KEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMI
Sbjct  584   KEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMI  643

Query  1331  TGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYS  1152
             TGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYS
Sbjct  644   TGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYS  703

Query  1151  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  972
             KARYDEI+KEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  704   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  763

Query  971   NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  792
             NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  764   NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMH  823

Query  791   HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  612
             HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  824   HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  883

Query  611   GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  432
             GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETF
Sbjct  884   GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMVPTKPMVVETF  943

Query  431   SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  333
             +EYPPLGRFAVRDMRQTVAVGVIK V+KKDPTG
Sbjct  944   AEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTG  976


 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMVPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  421   VAVGVIKAVEKKDPTG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/430 (98%), Positives = 428/430 (99%), Gaps = 0/430 (0%)
 Frame = -2

Query  1622  HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE  1443
             HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE
Sbjct  1     HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAE  60

Query  1442  RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG  1263
             RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG
Sbjct  61    RERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAG  120

Query  1262  ISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPD  1083
             ISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKKVGYNPD
Sbjct  121   ISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPD  180

Query  1082  KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQDVYKIGG  903
             KI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQDVYKIGG
Sbjct  181   KIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQDVYKIGG  240

Query  902   IGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVK  723
             IGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVK
Sbjct  241   IGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKNVAVK  300

Query  722   DLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTK  543
             DLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TK
Sbjct  301   DLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTK  360

Query  542   IDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVI  363
             IDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVI
Sbjct  361   IDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVI  420

Query  362   KNVDKKDPTG  333
             K+V+KKDPTG
Sbjct  421   KSVEKKDPTG  430



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGIVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMLVTFAPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRL LQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLALQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GL TEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLPTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGNGYAPVLDC  SHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCTLSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKE KFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEAKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGV+KNVDKKDPTG
Sbjct  421   VAVGVVKNVDKKDPTG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKE+EKEPKFLKNGD+GMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDP+G
Sbjct  421   VAVGVIKNVEKKDPSG  436



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERS+NLDWYKGPTLLEALD+INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDLINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   NEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE L EA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHETLTEAHPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTE+KSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEIKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSK+DPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKEDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMVPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  421   VAVGVIKAVEKKDPTG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFAPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFGPTGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK VDKKDPTG
Sbjct  421   VAVGVIKAVDKKDPTG  436



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSK+DPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKEDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   NEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RYDEI+KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYMKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDP+G
Sbjct  421   VAVGVIKGVEKKDPSG  436



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYS+ARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEA+QEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+F +QVIIMNHPGQIG GYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKAR+DEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDP+G
Sbjct  421   VAVGVIKAVEKKDPSG  436



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEV+SYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVASYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVTEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK A+SFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGMVKMNPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+PTG
Sbjct  421   VAVGVIKSVEKKEPTG  436



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/435 (96%), Positives = 429/435 (99%), Gaps = 0/435 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFE D MIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEDDKMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPT  336
             VAVGVIK+V+KKD +
Sbjct  421   VAVGVIKSVEKKDAS  435



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEA+ EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEAMLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMV+TF P+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVITFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDP+G
Sbjct  421   VAVGVIKAVEKKDPSG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKAR+DEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEAFPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006846237.1| PREDICTED: elongation factor 1-alpha [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EI KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEITKEVSSYIKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDP+G
Sbjct  421   VAVGVIKAVEKKDPSG  436



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGALKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKD +G
Sbjct  421   VAVGVIKSVEKKDASG  436



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERS NLDWYKGP LLEALD+I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSNNLDWYKGPNLLEALDLISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+P+KPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMVPSKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_002311107.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93463.1| unknown [Populus trichocarpa]
 gb|EEE88474.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/435 (96%), Positives = 429/435 (99%), Gaps = 0/435 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPG VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGTVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPT  336
             VAVGVIKNV+KKD +
Sbjct  421   VAVGVIKNVEKKDAS  435



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVV+FGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVSFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+P+KPMVVETF+ YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFAAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_002312029.1| ADR12-2 family protein [Populus trichocarpa]
 gb|EEE89396.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/435 (96%), Positives = 429/435 (99%), Gaps = 0/435 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPG VVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGTVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPT  336
             VAVGVIKNV+KKD +
Sbjct  421   VAVGVIKNVEKKDAS  435



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTA  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP DKPLRLPLQ+
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPLDKPLRLPLQN  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF+EY PLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/436 (95%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_009131916.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVII+NHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIILNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKID RSGKE+EKEPK+LKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDGRSGKEMEKEPKYLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKK PTG
Sbjct  421   VAVGVIKSVDKKCPTG  436



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGALKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGY PVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYTPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKD +G
Sbjct  421   VAVGVIKSVEKKDASG  436



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEV SYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVGSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHE++QEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGLIKPGMVVTFGPTGLTTEVKSVEMHHESMQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELE  PKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELESAPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEAFPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSK+DPAK AA+FTSQVIIMNHPGQI NGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKEDPAKEAANFTSQVIIMNHPGQISNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+P+KPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEV+ YLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVALYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLILEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSTYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+R+DEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 428/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERF+KEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFQKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWK ETTKYYCT IDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKIETTKYYCTGIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPLDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+VDKKDPTG
Sbjct  421   VAVGVIKSVDKKDPTG  436



>ref|XP_011655319.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Cucumis 
sativus]
 ref|XP_011655320.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Cucumis 
sativus]
 ref|XP_011655321.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Cucumis 
sativus]
Length=449

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 428/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDI LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKD +G
Sbjct  421   VAVGVIKAVEKKDASG  436



>ref|NP_001105935.1| elongation factor alpha8 [Zea mays]
 gb|AAF42982.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAA+MNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAADMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEG NMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGANMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLK+GDAGMVKM+PTKPMVVETFS +PPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKDGDAGMVKMIPTKPMVVETFSAFPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/436 (95%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIHEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEA+QEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMHHEAMQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG GYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELE+EPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEREPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|NP_001151074.1| elongation factor 1-alpha [Zea mays]
 gb|ACG41520.1| elongation factor 1-alpha [Zea mays]
 tpg|DAA63136.1| TPA: putative translation elongation factor Tu family protein 
[Zea mays]
Length=447

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 427/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEV SYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVGSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF P+GLTTEVKSVEMHHE +QEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGLLKPGMVVTFAPTGLTTEVKSVEMHHETMQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELE  PKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELESAPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_011655322.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_011655323.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/436 (95%), Positives = 428/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETAKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+RYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD ++EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVHEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIM HPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMKHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQI NGYAPVLDCHTSHIAV+F
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQISNGYAPVLDCHTSHIAVRF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
              E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   GEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_006858667.1| PREDICTED: elongation factor 1-alpha [Amborella trichopoda]
 ref|XP_011628673.1| PREDICTED: elongation factor 1-alpha [Amborella trichopoda]
 ref|XP_011628674.1| PREDICTED: elongation factor 1-alpha [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EI+KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYIKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIVEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTF P+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGLLKPGMVVTFAPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_002315287.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 ref|XP_002315285.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 ref|XP_002316351.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|ABK95341.1| unknown [Populus trichocarpa]
 gb|ABK95876.1| unknown [Populus trichocarpa]
 gb|EEF01458.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|EEF01456.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 gb|EEF02522.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
Length=449

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GL+TEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLSTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSAYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_002311106.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93897.1| unknown [Populus trichocarpa]
 gb|EEE88473.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/435 (95%), Positives = 429/435 (99%), Gaps = 0/435 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPG +VTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGTIVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPT  336
             VAVGVIKNV+KKD +
Sbjct  421   VAVGVIKNVEKKDAS  435



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+RYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIHEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMHHE+L E LPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMHHESLVEGLPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPG VVTF P+GL TEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGFVVTFAPTGLATEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAG+VKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKEIEKEPKFLKNGDAGLVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+P+G
Sbjct  421   VAVGVIKSVEKKEPSG  436



>gb|EMS59091.1| Elongation factor 1-alpha [Triticum urartu]
Length=496

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/455 (92%), Positives = 437/455 (96%), Gaps = 3/455 (1%)
 Frame = -2

Query  1688  VSRVNSLCI---RKLS*SIMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIER  1518
             V  V  LC+     +S S MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIER
Sbjct  31    VRFVFYLCLVLGSAVSLSAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIER  90

Query  1517  FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKN  1338
             FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKN
Sbjct  91    FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKN  150

Query  1337  MITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPK  1158
             MITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPK
Sbjct  151   MITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPK  210

Query  1157  YSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD  978
             YSKARY+EI+KEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD
Sbjct  211   YSKARYEEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD  270

Query  977   MINEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVE  798
              INEPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVE
Sbjct  271   QINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVE  330

Query  797   MHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQI  618
             MHHE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQI
Sbjct  331   MHHESLLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQI  390

Query  617   GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  438
             GNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E  PKFLKNGDAG+VKM+PTKPMVVE
Sbjct  391   GNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEAAPKFLKNGDAGIVKMIPTKPMVVE  450

Query  437   TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  333
             TF+ YPPLGRFAVRDMRQTVAVGVIK V+KKDPTG
Sbjct  451   TFATYPPLGRFAVRDMRQTVAVGVIKGVEKKDPTG  485



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/436 (95%), Positives = 433/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNK+DATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMI+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMLVTFGPTGLTTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006378755.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
 gb|ERP56552.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
Length=449

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/436 (94%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GL+TEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLSTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE+FSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVESFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRP+D+PLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDEPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/436 (96%), Positives = 427/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG +KPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTIKPGMVVTFGPSGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVR MRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRVMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  421   VAVGVIKAVEKKDPTG  436



>ref|XP_006856244.1| PREDICTED: elongation factor 1-alpha [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/436 (96%), Positives = 427/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIMKEVSSYIKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIE+STNLDWYKGPTLLEALDMI EPKRP DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIEKSTNLDWYKGPTLLEALDMILEPKRPFDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQI NGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIANGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDP+G
Sbjct  421   VAVGVIKAVEKKDPSG  436



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 428/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTF PSGLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFAPSGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF EYPP GRFAVRDMRQT
Sbjct  361   AELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFFEYPPFGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLILEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHEALPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+P+KPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMI+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMIHEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG +KPGM+VTFGP+GLTTEVKSVEMHHE LQEA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGFIKPGMIVTFGPTGLTTEVKSVEMHHETLQEAFPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP+G
Sbjct  421   VAVGVIKSVEKKDPSG  436



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/436 (95%), Positives = 432/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VAS+SK+DPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASDSKNDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/436 (95%), Positives = 430/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGM+VTF P+GLTTEVKSVEMHHE+LQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMLVTFAPTGLTTEVKSVEMHHESLQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG GYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEMLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMHHE+L EA PGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMHHESLTEAHPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVII+NHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELE  PKFLKNGDAG+VKM+PTKPMVVETF+ YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  421   VAVGVIKGVEKKDPTG  436



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/436 (95%), Positives = 427/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRL LQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLALQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTV VGRVETGV+KP MVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVQVGRVETGVIKPDMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDL RG+VASNSKDDPAK AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLNRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAV DMRQT
Sbjct  361   AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVLDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_006387491.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 ref|XP_006387492.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ABK94386.1| unknown [Populus trichocarpa]
 gb|ERP46405.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ERP46406.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
Length=449

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/436 (94%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG++KPGMVVTFGP+GL+TEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLSTEVKSVEMHHEALLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHT HIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTCHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVE+FSEYPPLGRFAVRDMRQT
Sbjct  361   AEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVESFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KK+P+G
Sbjct  421   VAVGVIKSVEKKEPSG  436



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/429 (97%), Positives = 425/429 (99%), Gaps = 0/429 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNV  354
             VAVGVIK+V
Sbjct  421   VAVGVIKSV  429



>dbj|BAC22127.1| eukaryotic elongation factor 1A [Salsola komarovii]
Length=447

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/436 (94%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+R+DEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKD+KRG+VAS+SK+DPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDIKRGFVASDSKNDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_010669660.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669661.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/436 (94%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VAS+SK+DPAK AA+F +QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASDSKNDPAKEAANFIAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIKNV+KKDPTG
Sbjct  421   VAVGVIKNVEKKDPTG  436



>ref|XP_010669658.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/436 (94%), Positives = 431/436 (99%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGR+ETGVLKPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRIETGVLKPGMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VAS+SK+DPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASDSKNDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             +ELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF+EY PLGRFAVRDMRQT
Sbjct  361   SELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFAEYSPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETG LKPGMVVTF P+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGTLKPGMVVTFAPTGLTTEVKSVEMHHESLVEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG GYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AEMLTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/438 (96%), Positives = 430/438 (98%), Gaps = 3/438 (1%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCC--NKMDATTPKYSKARYDEIIKEVSSYL  1107
             GGFEAGISKDGQTREHALLAFTLGVKQMICCC  NKMDATTPKYSKARYDEI+KEVSSYL
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCCCNKMDATTPKYSKARYDEIVKEVSSYL  180

Query  1106  KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPL  927
             KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EPKRP+DKPLRLPL
Sbjct  181   KKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPL  240

Query  926   QDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGF  747
             QDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHEALQEALPGDNVGF
Sbjct  241   QDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGF  300

Query  746   NVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAV  567
             NVKNVAVKDLKRGYVASNSKDDPAK AASFTSQV IMNHPGQIGNGYAPVLDCHTSHIAV
Sbjct  301   NVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQV-IMNHPGQIGNGYAPVLDCHTSHIAV  359

Query  566   KFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMR  387
             KFAEL+TKIDRRSGKELEKE KFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMR
Sbjct  360   KFAELITKIDRRSGKELEKEAKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMR  419

Query  386   QTVAVGVIKNVDKKDPTG  333
             QTVAVG+IK+V+KKDPTG
Sbjct  420   QTVAVGIIKSVEKKDPTG  437



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+E  PKFLKNGDAG+VKM+PTKPMVVETF+ YPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEAAPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  421   VAVGVIKGVEKKDPTG  436



>gb|EMS65134.1| Elongation factor 1-alpha [Triticum urartu]
Length=639

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  193   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  252

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  253   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  312

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  313   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  372

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  373   VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  432

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  433   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  492

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  493   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  552

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+E  PKFLKNGDAG+VKM+PTKPMVVETF+ YPPLGRFAVRDMRQT
Sbjct  553   AELVTKIDRRSGKEIEAAPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQT  612

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  613   VAVGVIKGVEKKDPTG  628



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIG VPVGRVETGV+KPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGIVPVGRVETGVVKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQT
Sbjct  361   AELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/436 (95%), Positives = 429/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDMI+EPKRPTDKPLRLPLQD
Sbjct  181   VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMISEPKRPTDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMHHE++ EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMHHESMPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPA+ AA FTSQVIIMNHPGQIG+GYAPVLDCHT HIAV+F
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAREAAHFTSQVIIMNHPGQIGSGYAPVLDCHTCHIAVRF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKE+E+EPKFLKNGDAG VKM PTKPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKEIEREPKFLKNGDAGFVKMFPTKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/436 (94%), Positives = 427/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTP YSKARYDEI+KEVSSY+KK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPNYSKARYDEIVKEVSSYMKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  181   VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGVLKPGM+VTF P+GLTTEVKSVEMHHEAL EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVLKPGMLVTFAPTGLTTEVKSVEMHHEALTEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIG GYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGKGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+P+KPMVVETFSEYPPLGRFAVRDMRQT
Sbjct  361   AELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETFSEYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDP G
Sbjct  421   VAVGVIKSVEKKDPAG  436



>gb|EMT09703.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=740

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/436 (95%), Positives = 428/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  294   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  353

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  354   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  413

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EI+KEVSSYLKK
Sbjct  414   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  473

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDK+PFVPISGFEGDNMIERSTNLDWYK PTLLEALD INEPKRP+DKPLRLPLQD
Sbjct  474   VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKAPTLLEALDQINEPKRPSDKPLRLPLQD  533

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  534   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESLLEALPGDNVGFNV  593

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  594   KNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  653

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AEL+TKIDRRSGKELE  PKFLKNGDAG+VKM+PTKPMVVETF+ YPPLGRFAVRDMRQT
Sbjct  654   AELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQT  713

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK V+KKDPTG
Sbjct  714   VAVGVIKGVEKKDPTG  729



>dbj|BAC22126.1| eukaryotic elongation factor 1A [Suaeda japonica]
Length=447

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/435 (94%), Positives = 430/435 (99%), Gaps = 0/435 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLSFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRP+DKPLRLP+QD
Sbjct  181   VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPSDKPLRLPIQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGR+ETGVLKP MVVTFGP+GLTTEVKSVEMHHE+L EALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRIETGVLKPNMVVTFGPTGLTTEVKSVEMHHESLPEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNV++KDLKRGYVAS+SK+DPAKGA+SFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVSIKDLKRGYVASDSKNDPAKGASSFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF+EY PLGRFAVRDMRQT
Sbjct  361   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYSPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPT  336
             VAVGVIK+VDKK+PT
Sbjct  421   VAVGVIKSVDKKEPT  435



>sp|P34823.1|EF1A2_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 dbj|BAA02205.1| elongation factor 1-alpha [Daucus carota]
Length=447

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/436 (94%), Positives = 428/436 (98%), Gaps = 0/436 (0%)
 Frame = -2

Query  1640  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  1461
             MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1     MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  1460  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  1281
             DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61    DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  1280  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  1101
             GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+R++EI+KEVSSYLKK
Sbjct  121   GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFEEIVKEVSSYLKK  180

Query  1100  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEPKRPTDKPLRLPLQD  921
             VGYNPDKI F+PISGFEGDNMI+RSTNLDWYKGPTLLEALD I+EPKRP+DKPLRLPLQD
Sbjct  181   VGYNPDKIAFIPISGFEGDNMIDRSTNLDWYKGPTLLEALDQISEPKRPSDKPLRLPLQD  240

Query  920   VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  741
             VYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
Sbjct  241   VYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV  300

Query  740   KNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  561
             KNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
Sbjct  301   KNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  360

Query  560   AELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQT  381
             AE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF  YPPLGRFAVRDMRQT
Sbjct  361   AEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQT  420

Query  380   VAVGVIKNVDKKDPTG  333
             VAVGVIK+V+KKDPTG
Sbjct  421   VAVGVIKSVEKKDPTG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5547836475300