BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12476

Length=1293
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365488.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    502   5e-169   Solanum tuberosum [potatoes]
ref|XP_004230844.1|  PREDICTED: long chain acyl-CoA synthetase 2        501   9e-169   Solanum lycopersicum
ref|XP_009618633.1|  PREDICTED: long chain acyl-CoA synthetase 2        497   4e-167   Nicotiana tomentosiformis
ref|XP_009803019.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    490   5e-164   Nicotiana sylvestris
gb|EYU37741.1|  hypothetical protein MIMGU_mgv1a002552mg                485   2e-162   Erythranthe guttata [common monkey flower]
ref|XP_011088325.1|  PREDICTED: long chain acyl-CoA synthetase 2        484   3e-162   Sesamum indicum [beniseed]
ref|XP_006592120.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    467   3e-157   Glycine max [soybeans]
ref|XP_002281151.1|  PREDICTED: long chain acyl-CoA synthetase 2        470   2e-156   Vitis vinifera
ref|XP_003540684.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    466   4e-155   Glycine max [soybeans]
ref|XP_010999563.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    466   5e-155   Populus euphratica
ref|XP_010999571.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    466   5e-155   Populus euphratica
ref|XP_003606857.1|  Annotation was added to scaffolds in Novembe...    457   8e-155   
emb|CDO97106.1|  unnamed protein product                                466   8e-155   Coffea canephora [robusta coffee]
ref|XP_012069337.1|  PREDICTED: long chain acyl-CoA synthetase 2        463   6e-154   Jatropha curcas
ref|XP_003530335.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    462   1e-153   Glycine max [soybeans]
ref|XP_003555665.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    462   2e-153   Glycine max [soybeans]
ref|XP_002313075.1|  LONG-CHAIN ACYL-COA SYNTHETASE 2 family protein    462   2e-153   Populus trichocarpa [western balsam poplar]
ref|XP_010096242.1|  Long chain acyl-CoA synthetase 2                   461   8e-153   Morus notabilis
gb|AGA17923.1|  CCL6                                                    460   1e-152   Humulus lupulus [common hop]
ref|XP_008459243.1|  PREDICTED: long chain acyl-CoA synthetase 2        460   1e-152   Cucumis melo [Oriental melon]
ref|XP_007041378.1|  Long-chain acyl-CoA synthetase 2 isoform 1         460   2e-152   Theobroma cacao [chocolate]
ref|XP_007131884.1|  hypothetical protein PHAVU_011G049400g             459   2e-152   Phaseolus vulgaris [French bean]
ref|XP_003539030.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    459   3e-152   Glycine max [soybeans]
ref|XP_011649216.1|  PREDICTED: long chain acyl-CoA synthetase 2        459   5e-152   Cucumis sativus [cucumbers]
gb|KEH30360.1|  long-chain fatty acyl CoA ligase                        458   6e-152   Medicago truncatula
ref|XP_002519120.1|  acyl CoA synthetase, putative                      458   6e-152   
gb|KJB16143.1|  hypothetical protein B456_002G214200                    455   7e-152   Gossypium raimondii
ref|XP_010690967.1|  PREDICTED: long chain acyl-CoA synthetase 2        457   1e-151   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004498184.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    456   3e-151   Cicer arietinum [garbanzo]
gb|KEH40770.1|  long-chain fatty acyl CoA ligase                        456   5e-151   Medicago truncatula
gb|KJB16142.1|  hypothetical protein B456_002G214200                    455   1e-150   Gossypium raimondii
ref|XP_010065425.1|  PREDICTED: long chain acyl-CoA synthetase 2        454   2e-150   Eucalyptus grandis [rose gum]
ref|XP_004309440.1|  PREDICTED: long chain acyl-CoA synthetase 2        454   3e-150   Fragaria vesca subsp. vesca
ref|XP_006423161.1|  hypothetical protein CICLE_v10027967mg             453   9e-150   Citrus clementina [clementine]
gb|EPS68372.1|  hypothetical protein M569_06390                         452   1e-149   Genlisea aurea
gb|KHG27706.1|  Long chain acyl-CoA synthetase 2 -like protein          452   1e-149   Gossypium arboreum [tree cotton]
ref|XP_010255021.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    450   1e-149   Nelumbo nucifera [Indian lotus]
ref|XP_008387336.1|  PREDICTED: long chain acyl-CoA synthetase 2        451   2e-149   Malus domestica [apple tree]
ref|XP_009375329.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    451   3e-149   
ref|XP_008776876.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    450   3e-149   
ref|XP_009375321.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    451   3e-149   Pyrus x bretschneideri [bai li]
ref|XP_009345813.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    451   6e-149   Pyrus x bretschneideri [bai li]
ref|XP_010255020.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    450   7e-149   Nelumbo nucifera [Indian lotus]
ref|XP_008776875.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    450   1e-148   Phoenix dactylifera
gb|ABG22526.1|  AMP-binding enzyme family protein, expressed            449   2e-148   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68356.1|  hypothetical protein OsI_36489                          449   3e-148   Oryza sativa Indica Group [Indian rice]
ref|XP_009345786.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    449   3e-148   Pyrus x bretschneideri [bai li]
ref|NP_001068097.1|  Os11g0558300                                       448   6e-148   
ref|XP_007153144.1|  hypothetical protein PHAVU_003G010600g             448   8e-148   Phaseolus vulgaris [French bean]
gb|KCW62899.1|  hypothetical protein EUGRSUZ_G00490                     447   8e-148   Eucalyptus grandis [rose gum]
gb|KHN25339.1|  Long chain acyl-CoA synthetase 2                        447   1e-147   Glycine soja [wild soybean]
ref|XP_010909564.1|  PREDICTED: long chain acyl-CoA synthetase 2        446   4e-147   Elaeis guineensis
gb|EEC68358.1|  hypothetical protein OsI_36493                          447   5e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_007041379.1|  Long-chain acyl-CoA synthetase 2 isoform 2         446   9e-147   
ref|XP_004498183.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    443   5e-146   
ref|XP_008236729.1|  PREDICTED: long chain acyl-CoA synthetase 2        441   2e-145   Prunus mume [ume]
ref|XP_003577452.1|  PREDICTED: long chain acyl-CoA synthetase 2        441   4e-145   Brachypodium distachyon [annual false brome]
ref|XP_009411351.1|  PREDICTED: long chain acyl-CoA synthetase 2        439   1e-144   
gb|KJB16145.1|  hypothetical protein B456_002G214200                    441   1e-144   Gossypium raimondii
ref|XP_007201738.1|  hypothetical protein PRUPE_ppa002568mg             439   2e-144   Prunus persica
ref|XP_004507386.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    438   4e-144   Cicer arietinum [garbanzo]
ref|XP_006663529.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    436   2e-143   Oryza brachyantha
ref|XP_010461777.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    436   2e-143   Camelina sativa [gold-of-pleasure]
dbj|BAJ88162.1|  predicted protein                                      436   3e-143   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010479377.1|  PREDICTED: long chain acyl-CoA synthetase 2        435   7e-143   Camelina sativa [gold-of-pleasure]
ref|XP_010525687.1|  PREDICTED: long chain acyl-CoA synthetase 2        434   2e-142   Tarenaya hassleriana [spider flower]
gb|EMS67297.1|  Long chain acyl-CoA synthetase 2                        431   1e-141   Triticum urartu
ref|XP_002891504.1|  long-chain acyl-CoA synthetase 2                   432   2e-141   
ref|XP_011627729.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    429   4e-141   
ref|XP_004979485.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    430   5e-141   Setaria italica
ref|XP_002449702.1|  hypothetical protein SORBIDRAFT_05g021840          430   5e-141   
ref|NP_175368.2|  long-chain acyl-CoA synthetase 2                      430   7e-141   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59237.1|  BnaC05g51350D                                          429   1e-140   Brassica napus [oilseed rape]
ref|XP_006856178.1|  PREDICTED: long chain acyl-CoA synthetase 2 ...    427   5e-140   Amborella trichopoda
emb|CAA96523.1|  acyl CoA synthetase                                    428   6e-140   Brassica napus [oilseed rape]
ref|XP_009144978.1|  PREDICTED: long chain acyl-CoA synthetase 2        427   1e-139   Brassica rapa
gb|KFK36012.1|  hypothetical protein AALP_AA4G066600                    427   1e-139   Arabis alpina [alpine rockcress]
ref|NP_001148177.1|  LOC100281785                                       423   4e-138   Zea mays [maize]
gb|ACL54548.1|  unknown                                                 422   5e-138   Zea mays [maize]
ref|XP_006393257.1|  hypothetical protein EUTSA_v10011292mg             422   6e-138   Eutrema salsugineum [saltwater cress]
ref|XP_004507385.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    422   2e-137   
ref|XP_010501911.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    419   1e-136   
ref|XP_009345814.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    412   2e-134   Pyrus x bretschneideri [bai li]
gb|EMT18517.1|  Fatty acyl-CoA synthetase B                             410   2e-133   
ref|XP_010910559.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    387   3e-127   Elaeis guineensis
gb|KJB19004.1|  hypothetical protein B456_003G080500                    389   8e-125   Gossypium raimondii
ref|XP_006644526.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    384   3e-124   
gb|ABA00144.1|  ACS-like protein                                        387   3e-124   Gossypium hirsutum [American cotton]
ref|XP_009404490.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    385   2e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003530131.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    370   2e-123   
ref|XP_003569480.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    384   4e-123   Brachypodium distachyon [annual false brome]
emb|CDP12153.1|  unnamed protein product                                384   5e-123   Coffea canephora [robusta coffee]
ref|XP_003610999.1|  Annotation was added to scaffolds in Novembe...    375   1e-122   
ref|NP_001043879.1|  Os01g0681200                                       382   2e-122   
dbj|BAD73757.1|  putative acyl-CoA synthetase                           382   2e-122   Oryza sativa Japonica Group [Japonica rice]
emb|CDM82121.1|  unnamed protein product                                382   3e-122   Triticum aestivum [Canadian hard winter wheat]
gb|KHN06160.1|  Long chain acyl-CoA synthetase 2                        367   3e-122   Glycine soja [wild soybean]
ref|XP_009780452.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    381   4e-122   Nicotiana sylvestris
gb|EMT28835.1|  Fatty acyl-CoA synthetase A                             382   5e-122   
ref|XP_010676297.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    381   7e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008791425.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    381   7e-122   Phoenix dactylifera
ref|XP_006644462.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    379   1e-121   Oryza brachyantha
ref|XP_008788745.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    380   2e-121   Phoenix dactylifera
gb|AES93957.2|  long-chain fatty acyl CoA ligase                        375   2e-121   Medicago truncatula
ref|XP_009626045.1|  PREDICTED: long chain acyl-CoA synthetase 4        379   3e-121   Nicotiana tomentosiformis
ref|XP_009108204.1|  PREDICTED: long chain acyl-CoA synthetase 5        379   3e-121   Brassica rapa
ref|XP_003579030.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    379   4e-121   Brachypodium distachyon [annual false brome]
ref|XP_003610997.1|  Annotation was added to scaffolds in Novembe...    379   4e-121   Medicago truncatula
ref|XP_010053129.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    379   4e-121   
emb|CDX86825.1|  BnaA09g22150D                                          379   4e-121   
ref|XP_004969552.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    379   5e-121   Setaria italica
ref|XP_009394139.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    379   5e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913603.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    379   6e-121   Elaeis guineensis
gb|ABC02880.1|  ACS1                                                    378   8e-121   Ricinus communis
ref|XP_010925724.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    378   8e-121   Elaeis guineensis
ref|XP_004245517.1|  PREDICTED: long chain acyl-CoA synthetase 4        378   9e-121   Solanum lycopersicum
ref|XP_006439354.1|  hypothetical protein CICLE_v10019200mg             378   1e-120   Citrus clementina [clementine]
ref|XP_006850521.1|  PREDICTED: long chain acyl-CoA synthetase 4        378   1e-120   Amborella trichopoda
ref|XP_008776844.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    377   1e-120   
gb|ACB30545.1|  long-chain acyl-CoA synthetase 4                        378   1e-120   Ricinus communis
dbj|BAD72330.1|  putative acyl-CoA synthetase                           375   2e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010266499.1|  PREDICTED: long chain acyl-CoA synthetase 4        377   3e-120   Nelumbo nucifera [Indian lotus]
ref|XP_006343862.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    377   3e-120   Solanum tuberosum [potatoes]
ref|XP_012086723.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    377   3e-120   Jatropha curcas
ref|XP_002456072.1|  hypothetical protein SORBIDRAFT_03g029880          376   4e-120   Sorghum bicolor [broomcorn]
emb|CDY40856.1|  BnaC09g26090D                                          379   4e-120   Brassica napus [oilseed rape]
gb|ACF17663.1|  putative long-chain acyl-CoA synthetase                 376   5e-120   Capsicum annuum
ref|XP_009128691.1|  PREDICTED: long chain acyl-CoA synthetase 5-...    376   5e-120   Brassica rapa
ref|XP_010915654.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    376   6e-120   Elaeis guineensis
gb|KJB19006.1|  hypothetical protein B456_003G080500                    376   6e-120   Gossypium raimondii
ref|XP_008652386.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    374   8e-120   Zea mays [maize]
ref|XP_010261577.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    375   9e-120   Nelumbo nucifera [Indian lotus]
gb|KEH21217.1|  long-chain fatty acyl CoA ligase                        375   9e-120   Medicago truncatula
ref|XP_011026897.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    375   1e-119   Populus euphratica
ref|XP_008341534.1|  PREDICTED: long chain acyl-CoA synthetase 4        375   1e-119   
gb|KFK33690.1|  hypothetical protein AALP_AA5G047100                    375   1e-119   Arabis alpina [alpine rockcress]
emb|CDX94232.1|  BnaC02g28920D                                          375   2e-119   
ref|XP_002297977.2|  acyl-coA synthetase family protein                 374   2e-119   
gb|EEC71207.1|  hypothetical protein OsI_03121                          374   2e-119   Oryza sativa Indica Group [Indian rice]
ref|NP_176622.1|  long-chain acyl-CoA synthetase                        375   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969353.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    374   2e-119   Setaria italica
ref|XP_003610998.1|  Annotation was added to scaffolds in Novembe...    374   3e-119   Medicago truncatula
ref|NP_001043753.1|  Os01g0655800                                       375   3e-119   
ref|XP_003517503.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    374   3e-119   Glycine max [soybeans]
ref|XP_002304555.1|  acyl-coA synthetase family protein                 374   5e-119   Populus trichocarpa [western balsam poplar]
ref|XP_007211290.1|  hypothetical protein PRUPE_ppa002540mg             374   5e-119   Prunus persica
ref|XP_002270385.1|  PREDICTED: long chain acyl-CoA synthetase 4        374   5e-119   Vitis vinifera
gb|EMT19325.1|  Fatty acyl-CoA synthetase A                             373   5e-119   
ref|XP_008675265.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    373   6e-119   
ref|XP_004964796.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    369   6e-119   
ref|XP_008239039.1|  PREDICTED: long chain acyl-CoA synthetase 4        373   7e-119   Prunus mume [ume]
ref|XP_001761279.1|  predicted protein                                  373   8e-119   
ref|NP_001169642.1|  putative AMP-dependent synthetase and ligase...    373   8e-119   Zea mays [maize]
ref|XP_006396970.1|  hypothetical protein EUTSA_v10029385mg             373   9e-119   Eutrema salsugineum [saltwater cress]
ref|XP_009112876.1|  PREDICTED: long chain acyl-CoA synthetase 3        373   1e-118   Brassica rapa
gb|ABK96686.1|  unknown                                                 373   1e-118   Populus trichocarpa x Populus deltoides
ref|XP_010541632.1|  PREDICTED: long chain acyl-CoA synthetase 4        373   1e-118   Tarenaya hassleriana [spider flower]
ref|XP_006300830.1|  hypothetical protein CARUB_v10019918mg             372   2e-118   Capsella rubella
ref|XP_010324642.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    368   2e-118   
ref|XP_006391620.1|  hypothetical protein EUTSA_v10023330mg             372   2e-118   Eutrema salsugineum [saltwater cress]
ref|XP_007040513.1|  AMP-dependent synthetase and ligase family p...    372   2e-118   
ref|XP_004511519.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    372   3e-118   Cicer arietinum [garbanzo]
ref|XP_009346443.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    372   3e-118   Pyrus x bretschneideri [bai li]
ref|XP_010533580.1|  PREDICTED: LOW QUALITY PROTEIN: long chain a...    371   6e-118   Tarenaya hassleriana [spider flower]
ref|XP_011022505.1|  PREDICTED: long chain acyl-CoA synthetase 4        370   7e-118   Populus euphratica
ref|XP_011101042.1|  PREDICTED: long chain acyl-CoA synthetase 4        370   7e-118   Sesamum indicum [beniseed]
ref|XP_002872543.1|  hypothetical protein ARALYDRAFT_352166             371   7e-118   Arabidopsis lyrata subsp. lyrata
ref|XP_010473705.1|  PREDICTED: long chain acyl-CoA synthetase 3-...    370   9e-118   Camelina sativa [gold-of-pleasure]
ref|XP_012086726.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    370   1e-117   Jatropha curcas
gb|AFD33346.1|  acyl-activating enzyme 2                                370   1e-117   Cannabis sativa
gb|KJB39707.1|  hypothetical protein B456_007G026300                    370   1e-117   Gossypium raimondii
ref|XP_010418506.1|  PREDICTED: long chain acyl-CoA synthetase 3        370   1e-117   Camelina sativa [gold-of-pleasure]
ref|XP_004964795.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    368   1e-117   
gb|KEH27413.1|  long-chain fatty acyl CoA ligase                        369   1e-117   Medicago truncatula
ref|XP_010430575.1|  PREDICTED: long chain acyl-CoA synthetase 3-...    370   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_007158575.1|  hypothetical protein PHAVU_002G164000g             369   2e-117   Phaseolus vulgaris [French bean]
ref|XP_009618994.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    369   2e-117   Nicotiana tomentosiformis
ref|XP_010087270.1|  Long chain acyl-CoA synthetase 4                   369   2e-117   
ref|XP_002886345.1|  hypothetical protein ARALYDRAFT_474909             369   3e-117   
ref|XP_004969551.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    369   3e-117   
ref|XP_004964794.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    368   4e-117   Setaria italica
ref|XP_006590492.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    365   5e-117   Glycine max [soybeans]
ref|XP_006590491.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    365   5e-117   Glycine max [soybeans]
dbj|BAJ88757.1|  predicted protein                                      368   7e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY25270.1|  BnaA02g21860D                                          368   7e-117   Brassica napus [oilseed rape]
gb|EMS57118.1|  Long chain acyl-CoA synthetase 4                        369   9e-117   Triticum urartu
gb|ABA00145.1|  ACS-like protein                                        367   1e-116   Gossypium hirsutum [American cotton]
ref|XP_004244632.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    367   1e-116   Solanum lycopersicum
ref|XP_010422032.1|  PREDICTED: long chain acyl-CoA synthetase 5-...    367   2e-116   Camelina sativa [gold-of-pleasure]
gb|KCW77379.1|  hypothetical protein EUGRSUZ_D01734                     366   2e-116   Eucalyptus grandis [rose gum]
gb|AFW85771.1|  putative AMP-dependent synthetase and ligase supe...    359   4e-116   
gb|KHM99901.1|  Long chain acyl-CoA synthetase 4                        365   4e-116   Glycine soja [wild soybean]
ref|XP_010435688.1|  PREDICTED: LOW QUALITY PROTEIN: long chain a...    366   4e-116   Camelina sativa [gold-of-pleasure]
gb|AAM28872.1|AF503755_1  long chain acyl-CoA synthetase 5              366   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009786376.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    365   6e-116   Nicotiana sylvestris
ref|XP_006290076.1|  hypothetical protein CARUB_v10003715mg             365   7e-116   Capsella rubella
emb|CDY46530.1|  BnaC09g11030D                                          369   7e-116   Brassica napus [oilseed rape]
ref|NP_192841.1|  long-chain acyl-CoA synthetase                        365   9e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006590488.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    365   1e-115   Glycine max [soybeans]
gb|KFK31882.1|  hypothetical protein AALP_AA6G171000                    365   1e-115   Arabis alpina [alpine rockcress]
ref|XP_011074379.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    364   2e-115   Sesamum indicum [beniseed]
ref|XP_004298900.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    365   2e-115   Fragaria vesca subsp. vesca
emb|CDY64879.1|  BnaAnng19690D                                          372   2e-115   Brassica napus [oilseed rape]
gb|KHG09916.1|  Long chain acyl-CoA synthetase 4 -like protein          363   2e-115   Gossypium arboreum [tree cotton]
ref|NP_001056862.1|  Os06g0158000                                       362   3e-115   
gb|KDO76524.1|  hypothetical protein CISIN_1g006047mg                   363   4e-115   Citrus sinensis [apfelsine]
ref|XP_009358599.1|  PREDICTED: long chain acyl-CoA synthetase 4        363   4e-115   Pyrus x bretschneideri [bai li]
gb|EEC80050.1|  hypothetical protein OsI_21752                          363   4e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_009358593.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    363   5e-115   Pyrus x bretschneideri [bai li]
ref|XP_006352250.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    363   6e-115   
ref|XP_008451943.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    363   8e-115   Cucumis melo [Oriental melon]
ref|XP_010668007.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    362   1e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006655812.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    362   1e-114   Oryza brachyantha
gb|EYU23349.1|  hypothetical protein MIMGU_mgv1a0021142mg               362   1e-114   Erythranthe guttata [common monkey flower]
ref|XP_004149746.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    362   1e-114   Cucumis sativus [cucumbers]
gb|KHN25648.1|  Long chain acyl-CoA synthetase 4                        362   2e-114   Glycine soja [wild soybean]
emb|CAN67631.1|  hypothetical protein VITISV_035299                     361   2e-114   Vitis vinifera
ref|XP_003524440.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    361   4e-114   Glycine max [soybeans]
ref|XP_007200449.1|  hypothetical protein PRUPE_ppa011261mg             344   2e-113   
ref|XP_002867687.1|  long-chain-fatty-acid--CoA ligase                  359   2e-113   
ref|NP_001147847.1|  ACS-like protein                                   358   2e-113   Zea mays [maize]
emb|CDP08689.1|  unnamed protein product                                358   3e-113   Coffea canephora [robusta coffee]
ref|XP_010439129.1|  PREDICTED: long chain acyl-CoA synthetase 4        359   3e-113   Camelina sativa [gold-of-pleasure]
ref|NP_194116.1|  long chain acyl-CoA synthetase 4                      358   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002436512.1|  hypothetical protein SORBIDRAFT_10g003970          358   4e-113   Sorghum bicolor [broomcorn]
ref|XP_001769302.1|  predicted protein                                  358   5e-113   
gb|ACC91252.1|  long-chain-fatty-acid-CoA ligase                        358   7e-113   Arabidopsis halleri
ref|XP_009783796.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    357   8e-113   Nicotiana sylvestris
ref|XP_009627714.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    357   9e-113   Nicotiana tomentosiformis
ref|XP_010448651.1|  PREDICTED: long chain acyl-CoA synthetase 4        357   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002448672.1|  hypothetical protein SORBIDRAFT_06g031250          356   2e-112   Sorghum bicolor [broomcorn]
ref|XP_002975814.1|  hypothetical protein SELMODRAFT_442966             356   3e-112   Selaginella moellendorffii
ref|XP_010326994.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    355   4e-112   Solanum lycopersicum
gb|AAC33962.1|  contains similarity to AMP-binding enzymes (Pfam:...    357   6e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433856.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    354   7e-112   Camelina sativa [gold-of-pleasure]
ref|XP_006285040.1|  hypothetical protein CARUB_v10006348mg             355   9e-112   
ref|XP_003564297.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    354   1e-111   Brachypodium distachyon [annual false brome]
ref|XP_010433854.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    353   3e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006339697.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    352   8e-111   Solanum tuberosum [potatoes]
ref|XP_007160159.1|  hypothetical protein PHAVU_002G297800g             352   9e-111   Phaseolus vulgaris [French bean]
gb|EPS71028.1|  hypothetical protein M569_03729                         350   2e-110   Genlisea aurea
ref|XP_006413507.1|  hypothetical protein EUTSA_v10024614mg             350   6e-110   Eutrema salsugineum [saltwater cress]
ref|XP_004143868.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    349   2e-109   Cucumis sativus [cucumbers]
ref|XP_008437390.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    348   2e-109   Cucumis melo [Oriental melon]
gb|EMT05055.1|  Fatty acyl-CoA synthetase A                             350   3e-109   
emb|CDY47618.1|  BnaA01g13470D                                          348   4e-109   Brassica napus [oilseed rape]
ref|XP_009137437.1|  PREDICTED: long chain acyl-CoA synthetase 4        348   5e-109   Brassica rapa
gb|EYU32231.1|  hypothetical protein MIMGU_mgv1a002558mg                345   3e-108   Erythranthe guttata [common monkey flower]
ref|XP_006303931.1|  hypothetical protein CARUB_v10008590mg             344   4e-108   
ref|XP_001768992.1|  predicted protein                                  346   5e-108   
emb|CAA64327.1|  acyl-CoA synthetase                                    345   5e-108   Brassica napus [oilseed rape]
gb|ABL11229.1|  putative acyl-CoA synthetase                            344   7e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002973766.1|  hypothetical protein SELMODRAFT_99821              346   8e-108   
gb|KGN50021.1|  hypothetical protein Csa_5G150390                       342   5e-107   Cucumis sativus [cucumbers]
gb|KHN35073.1|  Long chain acyl-CoA synthetase 4                        341   1e-106   Glycine soja [wild soybean]
ref|XP_001777237.1|  predicted protein                                  340   4e-106   
ref|XP_004503625.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    340   4e-106   Cicer arietinum [garbanzo]
ref|XP_011093712.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    338   2e-105   Sesamum indicum [beniseed]
gb|EEC71276.1|  hypothetical protein OsI_03279                          335   7e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_011093703.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    333   2e-103   Sesamum indicum [beniseed]
gb|ERN03158.1|  hypothetical protein AMTR_s00003p00114270               322   9e-103   Amborella trichopoda
ref|XP_011622226.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    329   3e-102   
ref|XP_007200514.1|  hypothetical protein PRUPE_ppa009382mg             317   7e-102   
ref|XP_011622225.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    329   7e-102   
ref|XP_011622227.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    327   2e-101   
ref|XP_006841485.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    327   7e-101   Amborella trichopoda
ref|XP_008783863.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    305   3e-98    
gb|KJB19005.1|  hypothetical protein B456_003G080500                    311   1e-95    Gossypium raimondii
ref|XP_005648967.1|  acetyl-CoA synthetase-like protein                 311   8e-95    Coccomyxa subellipsoidea C-169
ref|NP_001145763.1|  uncharacterized protein LOC100279270               310   2e-94    Zea mays [maize]
ref|XP_008781171.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    309   3e-94    
ref|XP_008781170.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    309   3e-94    
gb|AFI41775.1|  acyl-CoA synthetase 1                                   297   3e-94    Persea americana
ref|XP_009411609.1|  PREDICTED: long chain acyl-CoA synthetase 1        308   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004960397.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    307   2e-93    Setaria italica
gb|AES82215.2|  long-chain fatty acyl CoA ligase                        305   2e-92    Medicago truncatula
ref|XP_003625997.1|  Annotation was added to scaffolds in Novembe...    305   2e-92    
gb|KIZ01667.1|  hypothetical protein MNEG_6291                          295   5e-92    Monoraphidium neglectum
ref|XP_010921405.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    301   8e-92    Elaeis guineensis
gb|KHN31825.1|  Long chain acyl-CoA synthetase 2                        285   2e-91    
ref|XP_010921404.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    301   4e-91    
ref|XP_010921403.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    301   4e-91    
ref|XP_010518420.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    292   1e-90    
ref|XP_004960396.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    300   4e-90    
gb|KDO86925.1|  hypothetical protein CISIN_1g005867mg                   296   7e-90    
emb|CDX80092.1|  BnaA05g00640D                                          285   2e-89    
dbj|BAG97315.1|  unnamed protein product                                295   2e-89    
gb|KDO86918.1|  hypothetical protein CISIN_1g005867mg                   296   2e-89    
ref|XP_006590489.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    295   2e-89    
ref|XP_006492369.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    296   2e-89    
ref|XP_006444547.1|  hypothetical protein CICLE_v10019205mg             296   3e-89    
ref|XP_007051189.1|  AMP-dependent synthetase and ligase family p...    296   4e-89    
ref|XP_006654006.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    295   6e-89    
ref|NP_001054556.1|  Os05g0132100                                       295   8e-89    
gb|EEC78466.1|  hypothetical protein OsI_18335                          295   9e-89    
ref|XP_006590490.1|  PREDICTED: long chain acyl-CoA synthetase 4-...    293   9e-89    
gb|EMS58749.1|  Long chain acyl-CoA synthetase 1                        294   1e-88    
ref|XP_010270844.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    295   2e-88    
ref|XP_010270843.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    295   2e-88    
ref|XP_010270845.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    294   3e-88    
ref|XP_010507915.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    293   5e-88    
ref|XP_006577175.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    293   6e-88    
gb|EMT00965.1|  Fatty acyl-CoA synthetase B                             292   8e-88    
ref|XP_003554561.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    292   9e-88    
ref|XP_003569070.1|  PREDICTED: long chain acyl-CoA synthetase 1        292   1e-87    
gb|KHN14145.1|  Long chain acyl-CoA synthetase 1                        292   1e-87    
gb|KHN43438.1|  Long chain acyl-CoA synthetase 1                        292   1e-87    
ref|XP_010094400.1|  Long chain acyl-CoA synthetase 1                   290   2e-87    
ref|XP_010523913.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    290   3e-87    
ref|XP_010523910.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    289   1e-86    
ref|XP_007221547.1|  hypothetical protein PRUPE_ppa002531mg             289   2e-86    
ref|XP_004494441.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    289   2e-86    
ref|XP_006397920.1|  hypothetical protein EUTSA_v10001739mg             289   2e-86    
gb|KHG27845.1|  Long chain acyl-CoA synthetase 4 -like protein          286   5e-86    
ref|XP_004288548.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    287   1e-85    
gb|KDO86911.1|  hypothetical protein CISIN_1g005867mg                   286   1e-85    
ref|XP_004495889.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    286   1e-85    
gb|AES61618.2|  long-chain fatty acyl CoA ligase                        286   2e-85    
ref|XP_008227831.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    286   2e-85    
ref|XP_008227832.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    286   2e-85    
ref|XP_008381440.1|  PREDICTED: long chain acyl-CoA synthetase 1        279   6e-85    
ref|XP_004289548.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    285   6e-85    
emb|CDY68722.1|  BnaCnng60230D                                          273   6e-85    
ref|XP_002880290.1|  long-chain-fatty-acid--CoA ligase family pro...    285   7e-85    
ref|XP_009774710.1|  PREDICTED: long chain acyl-CoA synthetase 1        285   7e-85    
ref|XP_003591367.1|  Annotation was added to scaffolds in Novembe...    285   9e-85    
ref|XP_009611104.1|  PREDICTED: long chain acyl-CoA synthetase 1        284   1e-84    
ref|XP_002278345.1|  PREDICTED: long chain acyl-CoA synthetase 1        284   1e-84    
ref|XP_009142549.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    284   1e-84    
ref|XP_009142550.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    283   1e-84    
ref|XP_009363117.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    280   2e-84    
ref|XP_010267912.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    283   3e-84    
ref|XP_006293795.1|  hypothetical protein CARUB_v10022777mg             282   7e-84    
ref|XP_003518711.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    281   9e-84    
ref|XP_002515244.1|  long-chain-fatty-acid CoA ligase, putative         281   1e-83    
gb|KHN08620.1|  Long chain acyl-CoA synthetase 1                        281   1e-83    
ref|XP_006386705.1|  hypothetical protein POPTR_0002s19330g             278   1e-83    
emb|CDY27501.1|  BnaC04g51420D                                          281   1e-83    
ref|XP_009118824.1|  PREDICTED: long chain acyl-CoA synthetase 1        281   1e-83    
ref|XP_006397919.1|  hypothetical protein EUTSA_v10001346mg             281   2e-83    
ref|XP_012082936.1|  PREDICTED: long chain acyl-CoA synthetase 1        280   2e-83    
ref|XP_006397917.1|  hypothetical protein EUTSA_v10001346mg             280   3e-83    
ref|XP_010069762.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    280   3e-83    
ref|XP_010069763.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    280   3e-83    
gb|EYU46835.1|  hypothetical protein MIMGU_mgv1a003211mg                278   4e-83    
ref|XP_009363113.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    280   5e-83    
ref|XP_009363114.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    279   6e-83    
emb|CDY69216.1|  BnaCnng62450D                                          272   7e-83    
ref|XP_002947675.1|  hypothetical protein VOLCADRAFT_73402              279   8e-83    
emb|CDY37793.1|  BnaC04g00320D                                          272   1e-82    
ref|XP_010518419.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    278   1e-82    
ref|XP_010518417.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    278   1e-82    
emb|CDO96881.1|  unnamed protein product                                279   1e-82    
ref|XP_003535896.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    278   2e-82    
ref|XP_002880289.1|  long-chain-fatty-acid--CoA ligase family pro...    278   2e-82    
ref|XP_010506759.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    276   4e-82    
ref|XP_002302784.2|  hypothetical protein POPTR_0002s19330g             277   4e-82    
ref|XP_006349170.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    277   4e-82    
ref|XP_010507916.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    277   4e-82    
ref|NP_182246.1|  long chain acyl-CoA synthetase 1                      277   6e-82    
emb|CDP17051.1|  unnamed protein product                                272   6e-82    
gb|KJB16144.1|  hypothetical protein B456_002G214200                    273   7e-82    
ref|XP_007145129.1|  hypothetical protein PHAVU_007G212500g             276   8e-82    
ref|XP_010506755.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    276   1e-81    
ref|XP_010506758.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    276   1e-81    
ref|XP_010069768.1|  PREDICTED: long chain acyl-CoA synthetase 1-...    276   1e-81    
gb|KIZ04719.1|  hypothetical protein MNEG_3238                          276   1e-81    
ref|XP_004229375.1|  PREDICTED: long chain acyl-CoA synthetase 1        276   1e-81    
gb|KCW58207.1|  hypothetical protein EUGRSUZ_H00914                     276   2e-81    
gb|KJB52284.1|  hypothetical protein B456_008G254100                    270   2e-81    
ref|XP_011079524.1|  PREDICTED: long chain acyl-CoA synthetase 1        275   3e-81    
ref|XP_011397487.1|  Long chain acyl-CoA synthetase 4                   275   5e-81    
ref|XP_010679428.1|  PREDICTED: long chain acyl-CoA synthetase 1        274   6e-81    
gb|KHN16209.1|  Long chain acyl-CoA synthetase 1                        274   8e-81    
ref|XP_011002736.1|  PREDICTED: long chain acyl-CoA synthetase 1        273   9e-81    
gb|ABY77761.1|  long chain acyl-CoA synthetase 1                        273   1e-80    
ref|XP_006386707.1|  long-chain-fatty-acid--CoA ligase family pro...    273   2e-80    
gb|KHM99019.1|  Long chain acyl-CoA synthetase 2                        271   3e-80    
ref|XP_007201357.1|  hypothetical protein PRUPE_ppa010213mg             259   1e-79    
ref|XP_008447468.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    269   6e-79    
ref|XP_008447469.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    269   7e-79    
ref|XP_008447467.1|  PREDICTED: long chain acyl-CoA synthetase 1 ...    269   8e-79    
ref|XP_006423160.1|  hypothetical protein CICLE_v10027967mg             266   8e-79    
gb|AFW65555.1|  putative AMP-dependent synthetase and ligase supe...    253   1e-78    
ref|XP_005644174.1|  acetyl-CoA synthetase-like protein                 267   3e-78    
ref|XP_002946900.1|  hypothetical protein VOLCADRAFT_79297              267   6e-78    
ref|XP_011651533.1|  PREDICTED: long chain acyl-CoA synthetase 1        264   3e-77    
emb|CDX95713.1|  BnaC03g25940D                                          264   8e-77    
ref|XP_005850942.1|  hypothetical protein CHLNCDRAFT_29855              258   1e-75    
ref|XP_010500484.1|  PREDICTED: long chain acyl-CoA synthetase 2-...    241   3e-74    
gb|KJB09482.1|  hypothetical protein B456_001G145200                    254   2e-73    
gb|KHF99500.1|  Long chain acyl-CoA synthetase 1 -like protein          253   3e-73    
gb|KJB09486.1|  hypothetical protein B456_001G145200                    254   3e-73    
gb|ACN31974.1|  unknown                                                 245   4e-73    
gb|ETM00168.1|  hypothetical protein L917_03079                         245   1e-72    
ref|XP_001702947.1|  predicted protein                                  252   1e-72    
gb|KJB09487.1|  hypothetical protein B456_001G145200                    248   2e-72    
ref|XP_003555336.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    252   2e-72    
dbj|BAK01280.1|  predicted protein                                      252   3e-72    
ref|XP_009366907.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    252   4e-72    
gb|KDP40150.1|  hypothetical protein JCGZ_02148                         246   6e-72    
ref|XP_009366917.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    251   8e-72    
gb|ABA96461.2|  AMP-binding enzyme family protein, expressed            249   2e-71    
gb|KJB09488.1|  hypothetical protein B456_001G145200                    248   3e-71    
ref|XP_002441705.1|  hypothetical protein SORBIDRAFT_08g001010          249   3e-71    
ref|XP_003535658.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    249   3e-71    
ref|XP_006344614.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    249   3e-71    
ref|XP_010238733.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    249   3e-71    
ref|XP_003578933.2|  PREDICTED: long chain acyl-CoA synthetase 6,...    249   4e-71    
ref|XP_009589417.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    246   4e-71    
ref|NP_001066139.1|  Os12g0143900                                       249   5e-71    
ref|XP_002874363.1|  long-chain acyl-CoA synthetase 7                   248   7e-71    
ref|XP_009151198.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    248   7e-71    
emb|CDX86151.1|  BnaA06g28680D                                          248   8e-71    
emb|CDX74115.1|  BnaA03g29320D                                          247   1e-70    
ref|NP_198112.2|  long-chain acyl-CoA synthetase 7                      248   1e-70    
ref|XP_011092034.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    247   1e-70    
ref|XP_007143229.1|  hypothetical protein PHAVU_007G054900g             247   1e-70    
dbj|BAD94568.1|  putative acyl-CoA synthetase                           234   1e-70    
ref|XP_006489357.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    244   2e-70    
ref|XP_004230201.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    247   2e-70    
emb|CBX24445.1|  hypothetical_protein                                   246   2e-70    
ref|XP_002517212.1|  Acyl-CoA synthetase                                246   2e-70    
gb|KFK38010.1|  hypothetical protein AALP_AA3G058700                    246   3e-70    
ref|XP_011462751.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    244   3e-70    
ref|XP_010486078.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    246   3e-70    
gb|ETI53806.1|  hypothetical protein F443_03298                         245   4e-70    
gb|AFW64787.1|  hypothetical protein ZEAMMB73_753506                    236   4e-70    
gb|ETO82488.1|  hypothetical protein F444_03373                         245   4e-70    
ref|XP_005852102.1|  hypothetical protein CHLNCDRAFT_29209              244   4e-70    
ref|XP_010434527.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    246   4e-70    
ref|XP_002948135.1|  hypothetical protein VOLCADRAFT_73622              246   5e-70    
emb|CDY49993.1|  BnaC03g34500D                                          246   5e-70    
ref|XP_010421596.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    246   6e-70    
ref|XP_009767906.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    245   8e-70    
ref|XP_012069918.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    245   8e-70    
ref|XP_008900496.1|  hypothetical protein PPTG_07870                    244   8e-70    
gb|AAM28874.1|AF503757_1  long chain acyl-CoA synthetase 7              245   9e-70    
ref|XP_010464161.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    245   1e-69    
gb|KCW67763.1|  hypothetical protein EUGRSUZ_F01499                     243   1e-69    
ref|XP_006408004.1|  hypothetical protein EUTSA_v10020181mg             245   1e-69    
emb|CDX80638.1|  BnaC07g28060D                                          245   1e-69    
gb|KDO56314.1|  hypothetical protein CISIN_1g005406mg                   244   1e-69    
dbj|BAB40450.1|  long-chain acyl-CoA synthetase                         244   2e-69    
ref|XP_008348364.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    245   2e-69    
ref|XP_010493998.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    244   2e-69    
ref|XP_004978651.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    244   2e-69    
ref|NP_566265.1|  long-chain acyl-CoA synthetase 6                      244   2e-69    
ref|XP_007030827.1|  Long-chain acyl-CoA synthetase 7 isoform 1         244   2e-69    
ref|XP_004296905.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    244   3e-69    
ref|XP_006419887.1|  hypothetical protein CICLE_v10004460mg             244   3e-69    
gb|AAM28873.1|AF503756_1  long chain acyl-CoA synthetase 6              244   3e-69    
ref|XP_002884548.1|  long-chain acyl-CoA synthetase                     244   3e-69    
gb|KDO74672.1|  hypothetical protein CISIN_1g005468mg                   243   3e-69    
ref|XP_011023625.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    243   3e-69    
gb|KHG06384.1|  Long chain acyl-CoA synthetase 7, peroxisomal -li...    243   4e-69    
ref|XP_002319009.1|  hypothetical protein POPTR_0013s02220g             243   4e-69    
ref|XP_002277936.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    243   4e-69    
ref|XP_004496750.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    243   4e-69    
ref|XP_008222945.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    243   4e-69    
ref|XP_010064551.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    243   4e-69    
ref|XP_010107999.1|  Long chain acyl-CoA synthetase 7                   243   5e-69    
gb|AJA77462.1|  hypothetical protein                                    228   5e-69    
ref|XP_001134470.1|  fatty acyl-CoA synthetase                          243   5e-69    
ref|XP_008348365.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    243   6e-69    
ref|XP_006433329.1|  hypothetical protein CICLE_v10000461mg             243   7e-69    
gb|EYU34858.1|  hypothetical protein MIMGU_mgv1a002253mg                243   8e-69    
ref|XP_007225174.1|  hypothetical protein PRUPE_ppa002256mg             242   9e-69    
gb|AJA77456.1|  hypothetical protein                                    227   1e-68    
gb|KJB46004.1|  hypothetical protein B456_007G342400                    242   1e-68    
gb|KHN15786.1|  Long chain acyl-CoA synthetase 7, peroxisomal           242   1e-68    
ref|XP_011021558.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    242   1e-68    
ref|XP_010524813.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    242   1e-68    
ref|XP_010092820.1|  Long chain acyl-CoA synthetase 7                   241   1e-68    
gb|KDO86919.1|  hypothetical protein CISIN_1g005867mg                   240   2e-68    
ref|NP_001147928.1|  AMP-binding protein                                241   2e-68    
ref|XP_010546703.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    240   2e-68    
ref|XP_006378400.1|  hypothetical protein POPTR_0010s10050g             241   2e-68    
gb|AJA77516.1|  hypothetical protein                                    226   2e-68    
ref|XP_002315784.2|  LONG-CHAIN ACYL-COA SYNTHETASE 6 family protein    241   2e-68    
ref|XP_009413949.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    241   2e-68    
ref|XP_003577890.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    241   2e-68    
ref|XP_004304992.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    241   2e-68    
gb|AJA77336.1|  hypothetical protein                                    226   2e-68    
gb|KFQ42457.1|  Long-chain-fatty-acid--CoA ligase 1                     234   3e-68    
ref|XP_009520128.1|  hypothetical protein PHYSODRAFT_539827             240   3e-68    
gb|AJA77546.1|  hypothetical protein                                    225   4e-68    
ref|XP_010546702.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    241   4e-68    
ref|XP_010455110.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    241   4e-68    
ref|XP_010012387.1|  PREDICTED: long-chain-fatty-acid--CoA ligase...    234   4e-68    
ref|XP_010546701.1|  PREDICTED: long chain acyl-CoA synthetase 7,...    240   5e-68    
ref|XP_003054973.1|  predicted protein                                  240   6e-68    
ref|XP_008438692.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    240   6e-68    
ref|XP_004337827.1|  acylCoA synthetase, putative                       240   6e-68    
ref|XP_006295488.1|  hypothetical protein CARUB_v10024592mg             239   6e-68    
ref|XP_006290161.1|  hypothetical protein CARUB_v10003829mg             240   6e-68    
emb|CAN74451.1|  hypothetical protein VITISV_027567                     232   6e-68    
ref|XP_006664333.1|  PREDICTED: long chain acyl-CoA synthetase 6,...    240   8e-68    
ref|XP_007034699.1|  Long-chain acyl-CoA synthetase 6                   239   8e-68    
ref|XP_005709340.1|  long-chain acyl-CoA synthetase                     239   9e-68    



>ref|XP_006365488.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365489.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006365490.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X3 [Solanum 
tuberosum]
Length=659

 Score =   502 bits (1293),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 253/307 (82%), Positives = 270/307 (88%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGL+ DE     DRL FDKIKLAFGGRVRLMLSGAAPLP H EEFLRVT     SQ
Sbjct  353   RNMEKGLRQDEAAPRFDRLVFDKIKLAFGGRVRLMLSGAAPLPKHIEEFLRVTCCCSLSQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGC   IANV  MTGT GVPMTTIEARLESVPEMGYDAL +VPRGEICLRGK
Sbjct  413   GYGLTESCGGCLTSIANVHSMTGTVGVPMTTIEARLESVPEMGYDALASVPRGEICLRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKREDLT+ V+VDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVE++E
Sbjct  473   TLFSGYHKREDLTKSVLVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVENIE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
               YSRCPLV ++W+YGNSFESFLVAVV+PERKALEDWA +N+ETGDF SLC N KARKYI
Sbjct  533   GVYSRCPLVTSIWIYGNSFESFLVAVVVPERKALEDWASSNQETGDFSSLCNNTKARKYI  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELN+T +KHQLRGFEMLRAVHLEP PFDIER+LVTPTFKLKRPQLLNYYKD +DQLYK
Sbjct  593   LDELNSTARKHQLRGFEMLRAVHLEPNPFDIERELVTPTFKLKRPQLLNYYKDIVDQLYK  652

Query  248   EAKNVSA  228
             EAK  +A
Sbjct  653   EAKAKTA  659



>ref|XP_004230844.1| PREDICTED: long chain acyl-CoA synthetase 2 [Solanum lycopersicum]
Length=659

 Score =   501 bits (1291),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 252/307 (82%), Positives = 270/307 (88%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGL+ DE     DRL FDKIKLAFGGRVRLMLSGAAPLP H EEFLRVT     SQ
Sbjct  353   RNMEKGLRQDEAAPRFDRLVFDKIKLAFGGRVRLMLSGAAPLPKHVEEFLRVTCCCSLSQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGC   IANV  MTGT GVPMTTIEARLESVPEMGYDAL +VPRGEICLRGK
Sbjct  413   GYGLTESCGGCLTSIANVHSMTGTVGVPMTTIEARLESVPEMGYDALASVPRGEICLRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKREDLT+ V+VDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVE++E
Sbjct  473   TLFSGYHKREDLTKSVLVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVENIE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
               YSRCPLV ++W+YGNSFESFLVAVV+PERKA+E+WA NN+ETGDF SLC N KARKYI
Sbjct  533   GVYSRCPLVTSIWIYGNSFESFLVAVVVPERKAIEEWASNNQETGDFSSLCNNTKARKYI  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELN+T +KHQLRGFEMLRAVHLEP PFDIER+LVTPTFKLKRPQLLNYYKD +DQLYK
Sbjct  593   LDELNSTARKHQLRGFEMLRAVHLEPNPFDIERELVTPTFKLKRPQLLNYYKDIVDQLYK  652

Query  248   EAKNVSA  228
             EAK  +A
Sbjct  653   EAKAKTA  659



>ref|XP_009618633.1| PREDICTED: long chain acyl-CoA synthetase 2 [Nicotiana tomentosiformis]
Length=659

 Score =   497 bits (1280),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/307 (82%), Positives = 268/307 (87%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGL+ DE     DRL FDKIKLAFGGRVRLMLSGAAPLP H EEFLRVT     +Q
Sbjct  353   RNMEKGLRQDEAAPRFDRLVFDKIKLAFGGRVRLMLSGAAPLPKHVEEFLRVTCCCSLAQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGCF  IANV PM GT GVPMTTIEARLESVPEMGYDAL +VP GEICLRGK
Sbjct  413   GYGLTESCGGCFTSIANVHPMIGTVGVPMTTIEARLESVPEMGYDALASVPCGEICLRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKREDLT+ V+VDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVES+E
Sbjct  473   TLFSGYHKREDLTKAVLVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESIE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
               YSRCPL+ ++WVYGNSFESFLVAVV+PERKALEDWA +N+ETGDF +LC N K+RKYI
Sbjct  533   GLYSRCPLITSIWVYGNSFESFLVAVVVPERKALEDWASSNQETGDFSALCNNSKSRKYI  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELN+T KKHQLRGFEMLRAVHLEP PFDIERDLVTPTFKLKRPQLLNYYKD IDQLYK
Sbjct  593   LDELNSTAKKHQLRGFEMLRAVHLEPKPFDIERDLVTPTFKLKRPQLLNYYKDIIDQLYK  652

Query  248   EAKNVSA  228
             E    +A
Sbjct  653   EGNAKTA  659



>ref|XP_009803019.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Nicotiana 
sylvestris]
Length=686

 Score =   490 bits (1262),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 248/307 (81%), Positives = 266/307 (87%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGL+ DE     DRL FDKIKLAFGGRVRLMLSGAAPLP H EEFLRVT     +Q
Sbjct  380   RNMEKGLRQDEAAPRFDRLVFDKIKLAFGGRVRLMLSGAAPLPKHVEEFLRVTCCCSLAQ  439

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGCF  IANV PM GT GVPMTTIEARLESVPEMGYDAL +VPRGEICLRGK
Sbjct  440   GYGLTESCGGCFTSIANVQPMIGTVGVPMTTIEARLESVPEMGYDALASVPRGEICLRGK  499

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKREDLT+ V+VDGWFHTGDIGE QPDGAMKIIDRKKNIFKLSQGEYVAVES+E
Sbjct  500   TLFSGYHKREDLTKAVLVDGWFHTGDIGELQPDGAMKIIDRKKNIFKLSQGEYVAVESIE  559

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
               YS CPL+ ++W+YGNSFESFLVAVV+PERKALEDWA +N+ETGDF +LC N  ARKYI
Sbjct  560   GVYSSCPLITSIWIYGNSFESFLVAVVVPERKALEDWASSNQETGDFSALCNNSTARKYI  619

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELN+T KKHQLRGFEMLRAVHLEP PFDIERDLVTPTFKLKRPQLLN+YKD +DQLYK
Sbjct  620   LDELNSTAKKHQLRGFEMLRAVHLEPNPFDIERDLVTPTFKLKRPQLLNHYKDIVDQLYK  679

Query  248   EAKNVSA  228
             E    +A
Sbjct  680   EGNAKTA  686



>gb|EYU37741.1| hypothetical protein MIMGU_mgv1a002552mg [Erythranthe guttata]
Length=660

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 240/303 (79%), Positives = 262/303 (86%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGLK DE    +D+L FDKIK AFGGRVRLMLSGAAPLP H EEFLRVT   V SQ
Sbjct  354   RNLEKGLKQDEASPLMDKLVFDKIKQAFGGRVRLMLSGAAPLPKHIEEFLRVTCCCVLSQ  413

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  +ANV+PM G+ G+PMT IEARLESVPEMGYDA+  VPRGEICLRG 
Sbjct  414   GYGLTESCAGCFTSVANVYPMIGSVGIPMTAIEARLESVPEMGYDAVSAVPRGEICLRGN  473

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKR+DLT +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE LE
Sbjct  474   TLFSGYHKRKDLTEEVIVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVECLE  533

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             STYSRCPL+AA+WVYGNSFESFLVAV +PE+KALEDWA NN+E GDF SLC N KARKYI
Sbjct  534   STYSRCPLIAAIWVYGNSFESFLVAVAVPEKKALEDWAANNQEKGDFQSLCSNSKARKYI  593

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELN T K H LRGFEMLRAVHLEP PFDI+RDL+TPTFKLKRPQLL +YKD +D++Y 
Sbjct  594   LDELNTTAKTHNLRGFEMLRAVHLEPIPFDIDRDLITPTFKLKRPQLLKHYKDRVDEMYT  653

Query  248   EAK  240
             EAK
Sbjct  654   EAK  656



>ref|XP_011088325.1| PREDICTED: long chain acyl-CoA synthetase 2 [Sesamum indicum]
Length=659

 Score =   484 bits (1247),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 243/307 (79%), Positives = 262/307 (85%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGL+ +E   F D+L FDKIK  FGGRVRLMLSGAAPLP H EEFLRVT   V SQ
Sbjct  353   RNLEKGLRQEEASPFFDKLVFDKIKQGFGGRVRLMLSGAAPLPKHIEEFLRVTCCCVLSQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  IANV+PM GT GVPMTTIEARLESVPEMGYDAL +VPRGEICLRG 
Sbjct  413   GYGLTESCSGCFTSIANVYPMMGTVGVPMTTIEARLESVPEMGYDALSSVPRGEICLRGS  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKR DLT +VVVDGWFHTGD+GEWQP GA+KIIDRKKNIFKLSQGEYVAVES+E
Sbjct  473   TLFSGYHKRPDLTAEVVVDGWFHTGDVGEWQPSGALKIIDRKKNIFKLSQGEYVAVESIE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             S YSRCPL+ ++WVYGNSFESFLVAVV+PE+KALE+WA NN+E GDF SLC N KARKY+
Sbjct  533   SVYSRCPLITSIWVYGNSFESFLVAVVVPEKKALEEWAANNQEKGDFQSLCSNIKARKYM  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELN+T K H LRGFEMLR VHLEP PF I+RDLVTPTFKLKRPQLL YYKDCIDQLY 
Sbjct  593   LDELNSTAKTHNLRGFEMLRGVHLEPAPFGIDRDLVTPTFKLKRPQLLKYYKDCIDQLYS  652

Query  248   EAKNVSA  228
             EAK   A
Sbjct  653   EAKETKA  659



>ref|XP_006592120.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Glycine 
max]
Length=526

 Score =   467 bits (1202),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 232/300 (77%), Positives = 258/300 (86%), Gaps = 0/300 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKGL  D+     D+L FDKIK A GGRVRL+LSGAAPLP H EEFLRVT G   SQGY 
Sbjct  226   EKGLPQDKAAPLFDKLVFDKIKQALGGRVRLLLSGAAPLPRHVEEFLRVTFGATMSQGYG  285

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I+NVF M GT GVPMTTIE+RLESVPEMGYDAL +  RGEICLRG TLF
Sbjct  286   LTESCGGCFTAISNVFSMMGTIGVPMTTIESRLESVPEMGYDALSSEARGEICLRGNTLF  345

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHK +DLT +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y
Sbjct  346   SGYHKHQDLTEEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENIENKY  405

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+ ++WVYGNSFESFLVAVV+PERKALEDWA  +  T DF SLC+N KARKYILDE
Sbjct  406   LQCPLITSIWVYGNSFESFLVAVVVPERKALEDWAVKHNSTDDFKSLCENPKARKYILDE  465

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LNNTG+KHQLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL  YK+CIDQLYKEAK
Sbjct  466   LNNTGQKHQLRGFELLKAVHLEPIPFDMERDLITPTFKLKRPQLLKQYKECIDQLYKEAK  525



>ref|XP_002281151.1| PREDICTED: long chain acyl-CoA synthetase 2 [Vitis vinifera]
 emb|CBI32531.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   470 bits (1209),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/307 (77%), Positives = 258/307 (84%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGL+ DE    LDRL FDKIK  FGGRVRL+ SGAAPL  H EEFLRVT   V SQ
Sbjct  353   RNLEKGLRQDEAAPRLDRLIFDKIKQGFGGRVRLLFSGAAPLSRHVEEFLRVTSCSVLSQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGC   I N F M GT GVP  TIEARLESVPEMGYDAL  VPRGEICLRGK
Sbjct  413   GYGLTESCGGCLTSIVNEFSMMGTVGVPYPTIEARLESVPEMGYDALSNVPRGEICLRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY KR+DLT   +VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  473   TLFSGYFKRQDLTESALVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENLE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             +TYSRCPL+ ++WVYGNSFESFLVAVV+P++KALEDWA+N+  TGDF SLC+N +ARKYI
Sbjct  533   NTYSRCPLITSIWVYGNSFESFLVAVVVPDKKALEDWAENHNVTGDFKSLCENLEARKYI  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELNNTG+ HQL+GFE L+AVHL+P PFDIERDLVTPTFKLKRPQLL YYKD ID+LY 
Sbjct  593   LDELNNTGQNHQLKGFERLKAVHLDPNPFDIERDLVTPTFKLKRPQLLKYYKDIIDRLYS  652

Query  248   EAKNVSA  228
             EAK   +
Sbjct  653   EAKGTKS  659



>ref|XP_003540684.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Glycine 
max]
Length=656

 Score =   466 bits (1200),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 232/300 (77%), Positives = 258/300 (86%), Gaps = 0/300 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKGL  D+     D+L FDKIK A GGRVRL+LSGAAPLP H EEFLRVT G   SQGY 
Sbjct  356   EKGLPQDKAAPLFDKLVFDKIKQALGGRVRLLLSGAAPLPRHVEEFLRVTFGATMSQGYG  415

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I+NVF M GT GVPMTTIE+RLESVPEMGYDAL +  RGEICLRG TLF
Sbjct  416   LTESCGGCFTAISNVFSMMGTIGVPMTTIESRLESVPEMGYDALSSEARGEICLRGNTLF  475

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHK +DLT +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y
Sbjct  476   SGYHKHQDLTEEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENIENKY  535

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+ ++WVYGNSFESFLVAVV+PERKALEDWA  +  T DF SLC+N KARKYILDE
Sbjct  536   LQCPLITSIWVYGNSFESFLVAVVVPERKALEDWAVKHNSTDDFKSLCENPKARKYILDE  595

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LNNTG+KHQLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL  YK+CIDQLYKEAK
Sbjct  596   LNNTGQKHQLRGFELLKAVHLEPIPFDMERDLITPTFKLKRPQLLKQYKECIDQLYKEAK  655



>ref|XP_010999563.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Populus 
euphratica]
Length=661

 Score =   466 bits (1200),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 234/304 (77%), Positives = 259/304 (85%), Gaps = 0/304 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKG   ++    LDRL FDK K A GGRVR++LSGAAPLP H EEFLRVT     SQGY 
Sbjct  358   EKGFPQEKAAPLLDRLVFDKTKQALGGRVRILLSGAAPLPKHVEEFLRVTSCSTLSQGYG  417

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I NV+PM GT GVPMTTIE+RLESVPEMGYDAL +VPRGEICLRG TLF
Sbjct  418   LTESCGGCFTSIGNVYPMVGTVGVPMTTIESRLESVPEMGYDALSSVPRGEICLRGSTLF  477

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKREDLT +VVVDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE+LE+ Y
Sbjct  478   SGYHKREDLTNEVVVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENLENVY  537

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              RCPL+ ++WVYGNSFESFLVAVV+P+R+ALEDWA N+ ET DF SLCKN KARKYILDE
Sbjct  538   LRCPLITSIWVYGNSFESFLVAVVVPDRQALEDWAANHNETDDFKSLCKNLKARKYILDE  597

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LN+ GK + LRGFEML+AVHLEP PFD+ERDL+TPTFKLKRPQLL  YKDCIDQLY +AK
Sbjct  598   LNSIGKTNNLRGFEMLKAVHLEPHPFDMERDLITPTFKLKRPQLLKCYKDCIDQLYSDAK  657

Query  239   NVSA  228
              + A
Sbjct  658   GLKA  661



>ref|XP_010999571.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Populus 
euphratica]
Length=660

 Score =   466 bits (1199),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 234/304 (77%), Positives = 259/304 (85%), Gaps = 0/304 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKG   ++    LDRL FDK K A GGRVR++LSGAAPLP H EEFLRVT     SQGY 
Sbjct  357   EKGFPQEKAAPLLDRLVFDKTKQALGGRVRILLSGAAPLPKHVEEFLRVTSCSTLSQGYG  416

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I NV+PM GT GVPMTTIE+RLESVPEMGYDAL +VPRGEICLRG TLF
Sbjct  417   LTESCGGCFTSIGNVYPMVGTVGVPMTTIESRLESVPEMGYDALSSVPRGEICLRGSTLF  476

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKREDLT +VVVDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE+LE+ Y
Sbjct  477   SGYHKREDLTNEVVVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENLENVY  536

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              RCPL+ ++WVYGNSFESFLVAVV+P+R+ALEDWA N+ ET DF SLCKN KARKYILDE
Sbjct  537   LRCPLITSIWVYGNSFESFLVAVVVPDRQALEDWAANHNETDDFKSLCKNLKARKYILDE  596

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LN+ GK + LRGFEML+AVHLEP PFD+ERDL+TPTFKLKRPQLL  YKDCIDQLY +AK
Sbjct  597   LNSIGKTNNLRGFEMLKAVHLEPHPFDMERDLITPTFKLKRPQLLKCYKDCIDQLYSDAK  656

Query  239   NVSA  228
              + A
Sbjct  657   GLKA  660



>ref|XP_003606857.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid-CoA 
ligase [Medicago truncatula]
Length=425

 Score =   457 bits (1176),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 227/298 (76%), Positives = 254/298 (85%), Gaps = 0/298 (0%)
 Frame = -2

Query  1133  GLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLT  954
             GL  D+   F DRL FDKIK   GGRVR++LSGAAPL  H EEFLRVT G   +QGY LT
Sbjct  124   GLPQDKAAPFFDRLVFDKIKQTLGGRVRMLLSGAAPLSRHVEEFLRVTFGSPLAQGYGLT  183

Query  953   ES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSG  774
             ES  GCF  I+NVF M GT GVPMT IEARLESVPEMGYDAL + PRGEICLRG TLFSG
Sbjct  184   ESCSGCFSAISNVFSMMGTVGVPMTAIEARLESVPEMGYDALSSQPRGEICLRGNTLFSG  243

Query  773   YHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSR  594
             YHKR+DLT +V+VDGWFHTGDIGEW P+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y +
Sbjct  244   YHKRQDLTEEVMVDGWFHTGDIGEWLPNGAMKIIDRKKNIFKLSQGEYVAVENIENKYLQ  303

Query  593   CPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELN  414
             CPL+A++WVYGNSFESFLVAVVIPER+ALEDWA  +  + DF SLC N KARKYILDELN
Sbjct  304   CPLIASIWVYGNSFESFLVAVVIPERQALEDWAAKHELSDDFKSLCGNPKARKYILDELN  363

Query  413   NTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
              TG+KHQLRGFE+++AVHLEP PFD+ERDL+TPTFKLKRPQLL +YKDCIDQLYKEAK
Sbjct  364   ITGQKHQLRGFELVKAVHLEPVPFDVERDLITPTFKLKRPQLLKHYKDCIDQLYKEAK  421



>emb|CDO97106.1| unnamed protein product [Coffea canephora]
Length=659

 Score =   466 bits (1198),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 235/303 (78%), Positives = 256/303 (84%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             +N +KGL+ DE    LD+L FDKIK  FGG+VR+M SGAAPLP H EEFLRVT   V SQ
Sbjct  353   KNLQKGLRQDEAAPLLDKLVFDKIKQGFGGKVRIMFSGAAPLPKHVEEFLRVTCCCVLSQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  I NV  M GT GVP+TTIEARLESVPE+GYDAL  VPRGEICLRGK
Sbjct  413   GYGLTESCSGCFTSITNVMSMMGTVGVPITTIEARLESVPELGYDALADVPRGEICLRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKR+DLT DV+VDGWFHTGDIGE Q +G MKIIDRKKNIFKLSQGEYVAVESLE
Sbjct  473   TLFSGYHKRQDLTSDVLVDGWFHTGDIGELQHNGTMKIIDRKKNIFKLSQGEYVAVESLE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             STYSRCPLV ++WVYGNSFESFLVAVV+PERKALEDWA  + + GDF SLC + KARKY+
Sbjct  533   STYSRCPLVTSIWVYGNSFESFLVAVVVPERKALEDWAVQHLQDGDFKSLCNSIKARKYV  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELNNT KKHQLRGFEML+AVHLEP PFD ERDL+TPTFKLKRPQLL +YKD IDQLY 
Sbjct  593   LDELNNTAKKHQLRGFEMLKAVHLEPVPFDFERDLITPTFKLKRPQLLKHYKDRIDQLYS  652

Query  248   EAK  240
             E K
Sbjct  653   EGK  655



>ref|XP_012069337.1| PREDICTED: long chain acyl-CoA synthetase 2 [Jatropha curcas]
 gb|KDP46197.1| hypothetical protein JCGZ_10037 [Jatropha curcas]
Length=660

 Score =   463 bits (1192),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 234/306 (76%), Positives = 258/306 (84%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL   +    LDRL F+K K   GGRVR+MLSGAAPLP H EEFLRVT     SQG
Sbjct  355   NLEKGLPQAQAAPLLDRLVFEKTKQTLGGRVRIMLSGAAPLPKHVEEFLRVTACSTLSQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGCF  I +V+PM GT GVPMTTIEARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  415   YGLTESCGGCFTSIGDVYPMIGTVGVPMTTIEARLESVPEMGYDALSSVPRGEICLRGNT  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDL+ +V+VDGWFHTGDIGE QP+GAMKIIDRKKNIFKLSQGEYVAVESLE+
Sbjct  475   LFSGYHKREDLSNEVLVDGWFHTGDIGELQPNGAMKIIDRKKNIFKLSQGEYVAVESLEN  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
             TY RCPL+A++WVYGNSFESFLVAVV+PER+ LE+WA NN    DF SLCKN KAR+YIL
Sbjct  535   TYMRCPLIASIWVYGNSFESFLVAVVVPERQPLENWAANNNFKDDFKSLCKNPKARRYIL  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+ G+KH+L+GFEMLRAVHLEP PFDIERDL+TPTFKLKRPQLL +YK CIDQLY E
Sbjct  595   DELNSIGQKHKLKGFEMLRAVHLEPHPFDIERDLITPTFKLKRPQLLKHYKGCIDQLYSE  654

Query  245   AKNVSA  228
             AK   A
Sbjct  655   AKGSKA  660



>ref|XP_003530335.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Glycine max]
 gb|KHN42564.1| Long chain acyl-CoA synthetase 2 [Glycine soja]
Length=660

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 236/336 (70%), Positives = 270/336 (80%), Gaps = 2/336 (1%)
 Frame = -2

Query  1235  YAHAQRIIYWRGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGR  1056
             YA  +  +   GG   ++TL         ++ EKGL   +     DRL FDK KLA GGR
Sbjct  327   YAGIKSKVSSAGGL--QSTLFQCAYNYKLKSLEKGLPQHKAAPLFDRLVFDKTKLALGGR  384

Query  1055  VRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtT  876
             VR++LSGAAPLP H EEF+RVT G   SQGY LTES  GCF  I +V+ MTGT GVPMTT
Sbjct  385   VRILLSGAAPLPRHVEEFMRVTSGSTLSQGYGLTESCAGCFTAIGDVYSMTGTVGVPMTT  444

Query  875   IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
             IEARLESVPEMGYDAL  VPRGEICLRG TLFSGYHKREDLT++V+VDGWFHTGDIGEWQ
Sbjct  445   IEARLESVPEMGYDALSNVPRGEICLRGNTLFSGYHKREDLTKEVMVDGWFHTGDIGEWQ  504

Query  695   PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
              +GAMKIIDRKKNIFKLSQGEY+AVE++E+ Y +CPL+A++WVYGNSFESFLVAVVIPER
Sbjct  505   SNGAMKIIDRKKNIFKLSQGEYIAVENIENKYLQCPLIASIWVYGNSFESFLVAVVIPER  564

Query  515   KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
               +EDWA+ +  T DF SLC N KARKYILDELN+TG+KHQLRGFE+L+A+HLEP PFD+
Sbjct  565   TVIEDWAKEHNVTDDFKSLCDNLKARKYILDELNSTGQKHQLRGFELLKAIHLEPIPFDM  624

Query  335   ERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAKNVSA  228
             ERDL+TPTFKLKRPQLL YYKD IDQLYKEAK   A
Sbjct  625   ERDLITPTFKLKRPQLLKYYKDRIDQLYKEAKGAMA  660



>ref|XP_003555665.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Glycine max]
Length=660

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/316 (73%), Positives = 264/316 (84%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL         +  EKGL   +     DRL FDK KLA GGRVR++LSGAAPLP H E
Sbjct  341   QSTLFQCAYNYKLKYLEKGLPQHKAAPLFDRLVFDKTKLALGGRVRILLSGAAPLPRHVE  400

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             EF+RVT G   SQGY LTES  GCF  I +V+ MTGT GVPMTTIEARLESVPEMGYDAL
Sbjct  401   EFMRVTSGSTLSQGYGLTESCAGCFTAIGDVYSMTGTVGVPMTTIEARLESVPEMGYDAL  460

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
               VPRGEICLRG TLFSGYHKREDLT++V+VDGWFHTGDIGEWQ +GAMKIIDRKKNIFK
Sbjct  461   SNVPRGEICLRGNTLFSGYHKREDLTKEVMVDGWFHTGDIGEWQSNGAMKIIDRKKNIFK  520

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEY+AVE++E+ Y +CPL+A++WVYGNSFESFLVAVV+PERKA+EDWA+ +  T DF
Sbjct  521   LSQGEYIAVENIENKYLQCPLIASIWVYGNSFESFLVAVVVPERKAIEDWAKEHNLTDDF  580

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              SLC N KARK+ILDELN+TG+KHQLRGFE+L+A+HLEP PFDIERDL+TPTFKLKRPQL
Sbjct  581   KSLCDNLKARKHILDELNSTGQKHQLRGFELLKAIHLEPNPFDIERDLITPTFKLKRPQL  640

Query  287   LNYYKDCIDQLYKEAK  240
             L YYKD IDQLYKEAK
Sbjct  641   LKYYKDHIDQLYKEAK  656



>ref|XP_002313075.1| LONG-CHAIN ACYL-COA SYNTHETASE 2 family protein [Populus trichocarpa]
 gb|EEE87030.1| LONG-CHAIN ACYL-COA SYNTHETASE 2 family protein [Populus trichocarpa]
Length=658

 Score =   462 bits (1188),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 232/304 (76%), Positives = 258/304 (85%), Gaps = 0/304 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKG   ++    LDRL FDK K A GGRVR++LSGAAPLP H EEFLRVT     SQGY 
Sbjct  355   EKGFPQEKAAPLLDRLVFDKTKQALGGRVRILLSGAAPLPKHVEEFLRVTSCSTLSQGYG  414

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I NV+PM GT GVPMTTIE+RLESVPEMGYDAL +VPRGEICLRG TLF
Sbjct  415   LTESCGGCFTSIGNVYPMVGTVGVPMTTIESRLESVPEMGYDALSSVPRGEICLRGSTLF  474

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKREDLT +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE+LE+ Y
Sbjct  475   SGYHKREDLTNEVLVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENLENVY  534

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              RCP + ++WVYGNSFESFLVAVV+P+R+ALEDWA N+ ET DF SLCKN KARKYILDE
Sbjct  535   LRCPHITSIWVYGNSFESFLVAVVVPDRQALEDWAANHNETDDFKSLCKNLKARKYILDE  594

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LN+ GK + LRGFEML+AVHLEP PFD+ERDL+TPTFKLKRPQLL  YKDCIDQLY +AK
Sbjct  595   LNSIGKTNNLRGFEMLKAVHLEPHPFDMERDLITPTFKLKRPQLLKCYKDCIDQLYSDAK  654

Query  239   NVSA  228
              + A
Sbjct  655   GLKA  658



>ref|XP_010096242.1| Long chain acyl-CoA synthetase 2 [Morus notabilis]
 gb|EXB63637.1| Long chain acyl-CoA synthetase 2 [Morus notabilis]
Length=660

 Score =   461 bits (1185),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 228/302 (75%), Positives = 259/302 (86%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  D+    +D+L F+KIKLA GGRVR + SGAAPLP H E+FLR+T     SQG
Sbjct  355   NLEKGLPQDKAAPLMDKLVFEKIKLALGGRVRFLASGAAPLPRHVEKFLRITSCATLSQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGC   I+NVFPM GT GVP+TTIEARLESVPEMGYDAL  +PRGEICLRG  
Sbjct  415   YGLTESCGGCLTSISNVFPMIGTVGVPITTIEARLESVPEMGYDALSDMPRGEICLRGTN  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE++ES
Sbjct  475   LFSGYHKREDLTKEVLVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENIES  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+PERKALEDWA N+  T DF SLC+N KARKYI+
Sbjct  535   KYLQCPLITSIWVYGNSFESFLVAVVVPERKALEDWAANHNLTDDFKSLCENPKARKYIM  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+KHQLRGFEML+AV+LEP PFD++RDL TPTFKLKRPQLL YYKD ID+LY E
Sbjct  595   DELNSTGQKHQLRGFEMLKAVYLEPNPFDMDRDLTTPTFKLKRPQLLKYYKDHIDKLYNE  654

Query  245   AK  240
             AK
Sbjct  655   AK  656



>gb|AGA17923.1| CCL6 [Humulus lupulus]
Length=658

 Score =   460 bits (1184),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 230/302 (76%), Positives = 255/302 (84%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL H +    +D+L FDKIK  FGGR+RLM SGAAPLP H EE+LRVT     SQG
Sbjct  353   NMEKGLPHGQAAPLMDKLFFDKIKQGFGGRIRLMFSGAAPLPHHVEEYLRVTSCAALSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGC   IAN+FPM GT GVPMTTIEARLESVPEMGYDAL   PRGEICLRG T
Sbjct  413   YGLTESCGGCLTSIANIFPMIGTVGVPMTTIEARLESVPEMGYDALSDKPRGEICLRGTT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT+DV+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYV VE++E 
Sbjct  473   LFSGYHKREDLTKDVLVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVPVENIEG  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+A++WVYGNSFESFLVAVV+PER ALE+WA N   T DF SLC+N KA KYIL
Sbjct  533   IYLQCPLIASIWVYGNSFESFLVAVVVPERLALENWAANRNLTDDFKSLCENPKASKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+T KKHQLRGFEML+AV+LEP PFD+ERDL+TPTFKLKRPQLL YYKD +D+LY E
Sbjct  593   DELNSTAKKHQLRGFEMLKAVYLEPNPFDMERDLITPTFKLKRPQLLKYYKDHVDKLYSE  652

Query  245   AK  240
             AK
Sbjct  653   AK  654



>ref|XP_008459243.1| PREDICTED: long chain acyl-CoA synthetase 2 [Cucumis melo]
Length=661

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/302 (75%), Positives = 260/302 (86%), Gaps = 0/302 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KGL  ++    LD+L FDKIK AFGGRVRL LSGAAPLP   EEFLRVT     SQGY 
Sbjct  358   KKGLLQEKAAPLLDKLVFDKIKEAFGGRVRLFLSGAAPLPRLVEEFLRVTSCATLSQGYG  417

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  IANVF M GT GVP+TTIEARLESVP+MGYDAL T PRGEIC+RG TLF
Sbjct  418   LTESCGGCFTSIANVFTMVGTVGVPVTTIEARLESVPDMGYDALATTPRGEICIRGSTLF  477

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKR+DLT DV++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE++E+ +
Sbjct  478   SGYHKRQDLTDDVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENIENIF  537

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+ ++WVYGNSFESFLV V +P++KALEDWAQN+  TGDF SLC+N KARKYILDE
Sbjct  538   LQCPLITSIWVYGNSFESFLVGVAVPDQKALEDWAQNHNVTGDFKSLCENLKARKYILDE  597

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LN+ G+KH+LRGFE+L+A+HLEP PFD+ERDL+TPTFKLKRPQLL YYK+ IDQLY+EAK
Sbjct  598   LNSNGQKHRLRGFELLKAIHLEPYPFDMERDLITPTFKLKRPQLLKYYKEQIDQLYEEAK  657

Query  239   NV  234
             N 
Sbjct  658   NA  659



>ref|XP_007041378.1| Long-chain acyl-CoA synthetase 2 isoform 1 [Theobroma cacao]
 gb|EOX97209.1| Long-chain acyl-CoA synthetase 2 isoform 1 [Theobroma cacao]
Length=661

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/302 (76%), Positives = 260/302 (86%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N E G   D+    LD+L FDK++ A GG+VR+MLSGAAPLP H EEFLRV+     SQG
Sbjct  356   NMEIGFPQDKASPLLDKLVFDKVRQALGGKVRIMLSGAAPLPRHVEEFLRVSCCSNLSQG  415

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGCF  +ANV  M GT GVPMTTIEARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  416   YGLTESCGGCFTSLANVMSMIGTVGVPMTTIEARLESVPEMGYDALSSVPRGEICLRGNT  475

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR+DLT +V+VDGWFHTGDIGE QPDG+MKIIDRKKNIFKLSQGEYVAVE++E+
Sbjct  476   LFSGYYKRQDLTDEVLVDGWFHTGDIGELQPDGSMKIIDRKKNIFKLSQGEYVAVENVEN  535

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
             TYSRCP + ++WVYGNSFESFLVAVV+PERKALEDWA  + E  DF SLC+N+KARKYIL
Sbjct  536   TYSRCPHITSIWVYGNSFESFLVAVVVPERKALEDWATEHDEAVDFKSLCENRKARKYIL  595

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+KHQLRGFEML+AV+LEPTPFD+ERDL+TPTFKLKRPQLL YYKD IDQLY E
Sbjct  596   DELNSTGQKHQLRGFEMLKAVYLEPTPFDMERDLITPTFKLKRPQLLKYYKDRIDQLYSE  655

Query  245   AK  240
             AK
Sbjct  656   AK  657



>ref|XP_007131884.1| hypothetical protein PHAVU_011G049400g [Phaseolus vulgaris]
 gb|ESW03878.1| hypothetical protein PHAVU_011G049400g [Phaseolus vulgaris]
Length=656

 Score =   459 bits (1181),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/300 (77%), Positives = 253/300 (84%), Gaps = 0/300 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKGL  D      D+  FDKIKLA GGRVRL+LSGAAPL  H EEFLRVT G    QGY 
Sbjct  356   EKGLPQDIAAPLFDKFVFDKIKLALGGRVRLLLSGAAPLARHVEEFLRVTFGATMLQGYG  415

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I+NVF M GT GVP TTIEARLESVPEMGYDAL T  RGEICLRG TLF
Sbjct  416   LTESCGGCFTAISNVFSMMGTIGVPTTTIEARLESVPEMGYDALSTEARGEICLRGNTLF  475

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKR+DLT  V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y
Sbjct  476   SGYHKRQDLTEQVLVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENIENKY  535

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+ ++WVYGNSFESFLVAVV+PERKALEDWA  +  T DF SL +N K RKYILDE
Sbjct  536   LQCPLITSIWVYGNSFESFLVAVVVPERKALEDWAVKHNSTDDFKSLFENPKTRKYILDE  595

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LN+TG+KHQLRGFEML+AVHLEP PFD+ERDL+TPTFKLKRPQLL +YKDCIDQLYKEAK
Sbjct  596   LNSTGRKHQLRGFEMLKAVHLEPNPFDMERDLITPTFKLKRPQLLKHYKDCIDQLYKEAK  655



>ref|XP_003539030.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Glycine max]
Length=656

 Score =   459 bits (1180),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 230/300 (77%), Positives = 256/300 (85%), Gaps = 0/300 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKGL  D+     D+L FDKIK A GGRVRL+LSGAAPLP H EEFLRVT G   SQGY 
Sbjct  356   EKGLPQDKAAPLFDKLVFDKIKQALGGRVRLLLSGAAPLPRHVEEFLRVTFGATMSQGYG  415

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I+NVF M GT GVPMTTIEARLESVPEMGYDAL +  RGEICLRG TLF
Sbjct  416   LTESCGGCFTGISNVFSMMGTIGVPMTTIEARLESVPEMGYDALSSEARGEICLRGNTLF  475

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHK +DLT +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y
Sbjct  476   SGYHKHQDLTEEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENIENKY  535

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+ ++WV+GNSFESFLVAVV+PERK LE WA  +  T DF SLC+N KARKYILDE
Sbjct  536   LQCPLITSIWVHGNSFESFLVAVVVPERKGLEYWAVKHNSTDDFKSLCENPKARKYILDE  595

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LNNTG+KHQLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL  YK+CIDQLYKEAK
Sbjct  596   LNNTGQKHQLRGFELLKAVHLEPIPFDMERDLITPTFKLKRPQLLKQYKECIDQLYKEAK  655



>ref|XP_011649216.1| PREDICTED: long chain acyl-CoA synthetase 2 [Cucumis sativus]
 gb|KGN61759.1| hypothetical protein Csa_2G238260 [Cucumis sativus]
Length=661

 Score =   459 bits (1180),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 225/302 (75%), Positives = 259/302 (86%), Gaps = 0/302 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KGL  ++    LD+L FDKIK AFGGRVRL LSGAAPLP H EEFLRVT     SQGY 
Sbjct  358   KKGLLQEKAAPLLDKLVFDKIKEAFGGRVRLFLSGAAPLPRHVEEFLRVTSCATLSQGYG  417

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  IANVF M GT GVP+TTIEARLESVP+MGYDAL T PRGEICLRG TLF
Sbjct  418   LTESCGGCFTSIANVFTMMGTVGVPVTTIEARLESVPDMGYDALATTPRGEICLRGSTLF  477

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKR+DLT +V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE++E+ +
Sbjct  478   SGYHKRQDLTGEVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENIENIF  537

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +C L+ ++WVYGNSFESFLV V +P++KALEDWAQN+  TGDF SLC+N KARKYILDE
Sbjct  538   LQCSLITSIWVYGNSFESFLVGVAVPDQKALEDWAQNHNMTGDFKSLCENLKARKYILDE  597

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LN+ G+KH LRGFE+L+A+HLEP PFD+ERDL+TPTFKLKRPQLL YYK+ ID+LY+EAK
Sbjct  598   LNSNGQKHHLRGFELLKAIHLEPYPFDMERDLITPTFKLKRPQLLKYYKEQIDELYEEAK  657

Query  239   NV  234
             N 
Sbjct  658   NA  659



>gb|KEH30360.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=659

 Score =   458 bits (1179),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 227/298 (76%), Positives = 254/298 (85%), Gaps = 0/298 (0%)
 Frame = -2

Query  1133  GLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLT  954
             GL  D+   F DRL FDKIK   GGRVR++LSGAAPL  H EEFLRVT G   +QGY LT
Sbjct  358   GLPQDKAAPFFDRLVFDKIKQTLGGRVRMLLSGAAPLSRHVEEFLRVTFGSPLAQGYGLT  417

Query  953   ES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSG  774
             ES  GCF  I+NVF M GT GVPMT IEARLESVPEMGYDAL + PRGEICLRG TLFSG
Sbjct  418   ESCSGCFSAISNVFSMMGTVGVPMTAIEARLESVPEMGYDALSSQPRGEICLRGNTLFSG  477

Query  773   YHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSR  594
             YHKR+DLT +V+VDGWFHTGDIGEW P+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y +
Sbjct  478   YHKRQDLTEEVMVDGWFHTGDIGEWLPNGAMKIIDRKKNIFKLSQGEYVAVENIENKYLQ  537

Query  593   CPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELN  414
             CPL+A++WVYGNSFESFLVAVVIPER+ALEDWA  +  + DF SLC N KARKYILDELN
Sbjct  538   CPLIASIWVYGNSFESFLVAVVIPERQALEDWAAKHELSDDFKSLCGNPKARKYILDELN  597

Query  413   NTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
              TG+KHQLRGFE+++AVHLEP PFD+ERDL+TPTFKLKRPQLL +YKDCIDQLYKEAK
Sbjct  598   ITGQKHQLRGFELVKAVHLEPVPFDVERDLITPTFKLKRPQLLKHYKDCIDQLYKEAK  655



>ref|XP_002519120.1| acyl CoA synthetase, putative [Ricinus communis]
 gb|EEF43331.1| acyl CoA synthetase, putative [Ricinus communis]
Length=660

 Score =   458 bits (1179),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 230/306 (75%), Positives = 258/306 (84%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KGL   +    LDRL F+K K   GGRVR+MLSGAAPLP H EEFLRVT     SQG
Sbjct  355   NLQKGLPQAQAAPLLDRLVFEKTKQTLGGRVRIMLSGAAPLPKHVEEFLRVTSCSTLSQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGC   I +VFPM GT GVPMTTIE RLESVPEMGYDAL +VPRGEICLRG T
Sbjct  415   YGLTESCGGCLTSIGDVFPMVGTVGVPMTTIEVRLESVPEMGYDALSSVPRGEICLRGNT  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V++DGWFHTGDIGE QP+GAMKIIDRKKNIFKLSQGEYVAVESLE+
Sbjct  475   LFSGYHKREDLTKEVLIDGWFHTGDIGELQPNGAMKIIDRKKNIFKLSQGEYVAVESLEN  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
             TYSRC L+A++W+YGNSFES LVAVV+PER+ALEDWA N+    DF +LCKN KARKYIL
Sbjct  535   TYSRCSLIASIWIYGNSFESCLVAVVVPERQALEDWAANHNVADDFKTLCKNLKARKYIL  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG KH+LRGFEML+A+HLEP  FD++RDL+TPTFKLKRPQLL YYKDCIDQLY E
Sbjct  595   DELNSTGLKHKLRGFEMLKAIHLEPHLFDMDRDLITPTFKLKRPQLLKYYKDCIDQLYSE  654

Query  245   AKNVSA  228
             AK + A
Sbjct  655   AKGLKA  660



>gb|KJB16143.1| hypothetical protein B456_002G214200 [Gossypium raimondii]
Length=567

 Score =   455 bits (1170),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 227/303 (75%), Positives = 257/303 (85%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN E G   D+    LD+L FDK++ A GG+VRLMLSGAAPLP H EEFLRV+     SQ
Sbjct  261   RNMENGFPQDKASPLLDKLVFDKVRQALGGKVRLMLSGAAPLPRHVEEFLRVSCCSNLSQ  320

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGCF  +ANV  M GT GVP+TTIEARLESVPEMGYDAL +VPRGEICLRG 
Sbjct  321   GYGLTESCGGCFTSLANVMSMIGTVGVPITTIEARLESVPEMGYDALSSVPRGEICLRGN  380

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KR+DLT +VV+DGWFHTGDIGE Q DG+MKIIDRKKNIFKLSQGEYVAVE++E
Sbjct  381   TLFSGYYKRQDLTDEVVIDGWFHTGDIGELQSDGSMKIIDRKKNIFKLSQGEYVAVENIE  440

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             +TYSRCPL+A++WVYGNSFESFLVAVV+PERKALEDW   N E  DF SLC+N KARKYI
Sbjct  441   NTYSRCPLIASIWVYGNSFESFLVAVVVPERKALEDWGIENGEATDFKSLCENPKARKYI  500

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L+ELN+TG+KH LRGFE+L+AV+LEP PFD+ERDLVTPTFKLKRPQLL YYKD ID+LY 
Sbjct  501   LNELNSTGQKHHLRGFELLKAVYLEPNPFDMERDLVTPTFKLKRPQLLKYYKDRIDELYS  560

Query  248   EAK  240
             E K
Sbjct  561   EGK  563



>ref|XP_010690967.1| PREDICTED: long chain acyl-CoA synthetase 2 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score =   457 bits (1176),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 256/307 (83%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKGL+ DE    LD+  F+KIK +FGGRVRLM SG APL MH EEF RVT   V  Q
Sbjct  352   RNLEKGLRSDEAAPLLDKFVFNKIKQSFGGRVRLMFSGGAPLAMHVEEFFRVTCSSVVVQ  411

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  IANV  M GT G+P T+IEARLESVPEMGYDAL + PRGEICLRG 
Sbjct  412   GYGLTESCAGCFTSIANVHSMMGTVGIPTTSIEARLESVPEMGYDALSSTPRGEICLRGN  471

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKR DL+++V++DGWFHTGDIGEWQPDG+MK+IDRKKNIFKLSQGEYVAVE+LE
Sbjct  472   TLFSGYHKRPDLSQEVLIDGWFHTGDIGEWQPDGSMKVIDRKKNIFKLSQGEYVAVENLE  531

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + YS+C L+ ++WVYGNSFESFLVAVV+PERKALEDWA NN E+GDF +LCK+ KARKY 
Sbjct  532   NIYSQCNLITSIWVYGNSFESFLVAVVVPERKALEDWAANNHESGDFKTLCKSAKARKYF  591

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L+ELNNT +KH+LRGFE LRAV LEP PFDIERDL+TPTFKLKRPQLL  Y++ I+++Y 
Sbjct  592   LEELNNTAQKHELRGFEKLRAVFLEPIPFDIERDLMTPTFKLKRPQLLKCYEEVINEMYS  651

Query  248   EAKNVSA  228
             EAK V A
Sbjct  652   EAKGVKA  658



>ref|XP_004498184.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Cicer 
arietinum]
Length=662

 Score =   456 bits (1174),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 226/304 (74%), Positives = 258/304 (85%), Gaps = 0/304 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKG+   +   F DRL FDK K A GGRVR++LSGAAPLP+H EE+LRVT G   SQGY 
Sbjct  359   EKGIPQHKAAPFFDRLVFDKTKQALGGRVRILLSGAAPLPIHVEEYLRVTSGSTLSQGYG  418

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES  GCF  I +VF M GT GVPMTTIEARLES+PEMGYDAL + PRGEICLRG +LF
Sbjct  419   LTESCAGCFTAIGDVFSMMGTVGVPMTTIEARLESIPEMGYDALSSNPRGEICLRGNSLF  478

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKR+DLT++V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEY+AVE++ES Y
Sbjct  479   SGYHKRKDLTQEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYIAVENIESKY  538

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+  +WVYGNSFESFLVAVV+P++KA+EDWA  N  TGDF SLC+N KARKYILDE
Sbjct  539   LQCPLITTIWVYGNSFESFLVAVVVPDKKAIEDWAVENNLTGDFKSLCENLKARKYILDE  598

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             L +TG+K +LRGFEML+A++LEP PFDIERDLVTPTFKLKRPQLL YYKD IDQLYKEAK
Sbjct  599   LKSTGQKLKLRGFEMLKAIYLEPIPFDIERDLVTPTFKLKRPQLLKYYKDQIDQLYKEAK  658

Query  239   NVSA  228
                A
Sbjct  659   GKKA  662



>gb|KEH40770.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=661

 Score =   456 bits (1173),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 227/307 (74%), Positives = 260/307 (85%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             R  EKGL   +   F DRL FDK K A GGRVR++LSGAAPLP+H EE LRVT G   SQ
Sbjct  355   RYLEKGLPQHKAAPFFDRLVFDKTKQALGGRVRILLSGAAPLPIHVEECLRVTIGSTLSQ  414

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  I +VF M GT G+PMTTIEARLESVPEMGYDAL + PRGEICLRG 
Sbjct  415   GYGLTESCAGCFTAIGDVFSMMGTVGIPMTTIEARLESVPEMGYDALSSEPRGEICLRGN  474

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             +LFSGYHKR+DLT++V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEY+AVE++E
Sbjct  475   SLFSGYHKRQDLTQEVIVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYIAVENIE  534

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             S Y +CPL++++WVYGNSFESFLVAVV+PERKALEDWA  +  TGDF S+C+N KAR+YI
Sbjct  535   SKYLQCPLISSIWVYGNSFESFLVAVVVPERKALEDWAVEHNFTGDFQSVCENLKARQYI  594

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDEL +TG+K QLRGFE L+A++LEP+PFDIERDLVTPTFKLKRPQLL YYKD ID+LYK
Sbjct  595   LDELKSTGQKLQLRGFEQLKAIYLEPSPFDIERDLVTPTFKLKRPQLLKYYKDQIDELYK  654

Query  248   EAKNVSA  228
             EAK   A
Sbjct  655   EAKGTMA  661



>gb|KJB16142.1| hypothetical protein B456_002G214200 [Gossypium raimondii]
Length=661

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/303 (75%), Positives = 257/303 (85%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN E G   D+    LD+L FDK++ A GG+VRLMLSGAAPLP H EEFLRV+     SQ
Sbjct  355   RNMENGFPQDKASPLLDKLVFDKVRQALGGKVRLMLSGAAPLPRHVEEFLRVSCCSNLSQ  414

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGCF  +ANV  M GT GVP+TTIEARLESVPEMGYDAL +VPRGEICLRG 
Sbjct  415   GYGLTESCGGCFTSLANVMSMIGTVGVPITTIEARLESVPEMGYDALSSVPRGEICLRGN  474

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KR+DLT +VV+DGWFHTGDIGE Q DG+MKIIDRKKNIFKLSQGEYVAVE++E
Sbjct  475   TLFSGYYKRQDLTDEVVIDGWFHTGDIGELQSDGSMKIIDRKKNIFKLSQGEYVAVENIE  534

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             +TYSRCPL+A++WVYGNSFESFLVAVV+PERKALEDW   N E  DF SLC+N KARKYI
Sbjct  535   NTYSRCPLIASIWVYGNSFESFLVAVVVPERKALEDWGIENGEATDFKSLCENPKARKYI  594

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L+ELN+TG+KH LRGFE+L+AV+LEP PFD+ERDLVTPTFKLKRPQLL YYKD ID+LY 
Sbjct  595   LNELNSTGQKHHLRGFELLKAVYLEPNPFDMERDLVTPTFKLKRPQLLKYYKDRIDELYS  654

Query  248   EAK  240
             E K
Sbjct  655   EGK  657



>ref|XP_010065425.1| PREDICTED: long chain acyl-CoA synthetase 2 [Eucalyptus grandis]
 gb|KCW62898.1| hypothetical protein EUGRSUZ_G00490 [Eucalyptus grandis]
Length=661

 Score =   454 bits (1169),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 252/302 (83%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKG   D+    +DRL F+K KLA GGR+R + SGAAPLP H EEFLRVT     SQG
Sbjct  356   NLEKGFPQDKAAPLMDRLVFEKTKLALGGRIRALSSGAAPLPKHVEEFLRVTSCSTLSQG  415

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGCF  + NVF M GT G+PM +IEARLESVP+MGY+AL + PRGEICLRG T
Sbjct  416   YGLTESCGGCFSSVGNVFSMMGTVGIPMPSIEARLESVPDMGYNALSSTPRGEICLRGTT  475

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKR+DLT DV+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVA+E++ES
Sbjct  476   LFSGYHKRQDLTNDVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAIENVES  535

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y RCPLV ++WVYGNSFESFLVAVV+P+RKALEDWA N   TGDF SLC+N KA+KY+ 
Sbjct  536   VYQRCPLVTSIWVYGNSFESFLVAVVVPDRKALEDWAANQGVTGDFQSLCQNLKAKKYVQ  595

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+ G+ H+LRGFEML+AVHLEP  FDIERDL+TPTFKLKRPQLL YYKD IDQLY +
Sbjct  596   DELNSIGQTHKLRGFEMLKAVHLEPNLFDIERDLITPTFKLKRPQLLKYYKDHIDQLYSQ  655

Query  245   AK  240
             AK
Sbjct  656   AK  657



>ref|XP_004309440.1| PREDICTED: long chain acyl-CoA synthetase 2 [Fragaria vesca subsp. 
vesca]
Length=659

 Score =   454 bits (1168),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 226/302 (75%), Positives = 260/302 (86%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  ++    LD+L F KIK A GGRVR+MLSGAAPLP H EEFLRVT     SQG
Sbjct  354   NLEKGLPQEKAAPLLDKLVFHKIKQALGGRVRIMLSGAAPLPRHVEEFLRVTSCSTLSQG  413

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGCF  I N++PM GT GVP+TTIEARLESVPE+GYDAL +VPRGEICLRGKT
Sbjct  414   YGLTESCGGCFTSIGNIYPMIGTVGVPLTTIEARLESVPELGYDALSSVPRGEICLRGKT  473

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKR+DLT +V++D WFHTGDIGEWQP+GAMK+IDRKKNIFKLSQGEYVAVES+ES
Sbjct  474   LFSGYHKRQDLTDEVLIDEWFHTGDIGEWQPNGAMKVIDRKKNIFKLSQGEYVAVESIES  533

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+A++WVYGNSFESFLVAVV+P+RKALEDWA  +  T D+ SLC+N KARKYIL
Sbjct  534   KYLQCPLIASIWVYGNSFESFLVAVVVPDRKALEDWAAEHNLTDDYKSLCQNLKARKYIL  593

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+K QLRGFE+L+AVHLEP PFDIERDL+TPTFKLKRPQLL YYK+ +++LY E
Sbjct  594   DELNSTGQKQQLRGFELLKAVHLEPNPFDIERDLMTPTFKLKRPQLLKYYKERVEKLYSE  653

Query  245   AK  240
             AK
Sbjct  654   AK  655



>ref|XP_006423161.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
 ref|XP_006479352.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Citrus sinensis]
 gb|ESR36401.1| hypothetical protein CICLE_v10027967mg [Citrus clementina]
Length=661

 Score =   453 bits (1165),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 226/303 (75%), Positives = 258/303 (85%), Gaps = 1/303 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG+  ++    LD L F KI+ AFGGR++ MLSGAAPLP+H EEFLRVT G   +QG
Sbjct  355   NMKKGMPQNKAAPLLDSLVFSKIREAFGGRLQAMLSGAAPLPIHVEEFLRVTSGAPLTQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  +A+VF M GT GVPMTT+EARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  415   YGLTESCSGCFTSLADVFNMIGTVGVPMTTVEARLESVPEMGYDALSSVPRGEICLRGNT  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVES+E+
Sbjct  475   LFSGYYKRPDLTEEVIVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVESIEN  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNN-RETGDFVSLCKNQKARKYI  429
              Y +CPL   +WVYGNSFESFLVAVV+P+RKALEDWA N+  E  DF SLC+N KARKY+
Sbjct  535   IYLQCPLTTLIWVYGNSFESFLVAVVVPDRKALEDWAVNHLHEAVDFKSLCENPKARKYV  594

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELN+T +KH+LRGFEML+AVHLEPTPFDIE+DL+TPTFKLKRPQLL YYKD IDQLY 
Sbjct  595   LDELNSTAQKHKLRGFEMLKAVHLEPTPFDIEKDLITPTFKLKRPQLLKYYKDKIDQLYS  654

Query  248   EAK  240
             EAK
Sbjct  655   EAK  657



>gb|EPS68372.1| hypothetical protein M569_06390, partial [Genlisea aurea]
Length=658

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/305 (76%), Positives = 255/305 (84%), Gaps = 2/305 (1%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN EKG+K +E    +D+L F KIK AFGGRVRLMLSGAAPLP H EEFLRVT   V SQ
Sbjct  350   RNLEKGVKQEEASPAMDKLVFSKIKQAFGGRVRLMLSGAAPLPKHIEEFLRVTCCCVLSQ  409

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGCF  I + F M G+ GVPMTTIEARLESVPEMGYDAL +VPRGEICLRG 
Sbjct  410   GYGLTESCGGCFTSITDEFSMMGSVGVPMTTIEARLESVPEMGYDALASVPRGEICLRGN  469

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKR DLT  V+VDGWFHTGDIGEWQP+GAMKI+DRKKNIFKLSQGEYVAVESLE
Sbjct  470   TLFSGYHKRPDLTAQVIVDGWFHTGDIGEWQPNGAMKIVDRKKNIFKLSQGEYVAVESLE  529

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQN-NRETG-DFVSLCKNQKARK  435
             STYSRCPLV ++WVYGNSFESFLVAV +P++KALEDWA    RETG DF SLC +  AR+
Sbjct  530   STYSRCPLVTSIWVYGNSFESFLVAVAVPDKKALEDWAAAVGRETGDDFRSLCGDPNARR  589

Query  434   YILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
             Y+LDELN  GKKH LRGFEML+ VHLE  PFD+ER+L+TPTFKLKRP LL YYK+ ID+L
Sbjct  590   YVLDELNAVGKKHGLRGFEMLKGVHLEAVPFDVERELITPTFKLKRPVLLEYYKERIDEL  649

Query  254   YKEAK  240
             Y EAK
Sbjct  650   YSEAK  654



>gb|KHG27706.1| Long chain acyl-CoA synthetase 2 -like protein [Gossypium arboreum]
Length=661

 Score =   452 bits (1164),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/303 (74%), Positives = 257/303 (85%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN E G   D+    LD+L FDK++ A GG+VRLMLSGAAPLP H EEFLRV+     SQ
Sbjct  355   RNMENGFPQDKASPLLDKLVFDKVRQALGGKVRLMLSGAAPLPRHVEEFLRVSCCSNLSQ  414

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES GGCF  +ANV  M GT GVP+TTIEARLESVPEMGYDAL +VPRGEICLRG 
Sbjct  415   GYGLTESCGGCFTSLANVMSMIGTVGVPITTIEARLESVPEMGYDALSSVPRGEICLRGN  474

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KR+DLT +VV+DGWFHTGDIGE Q DG+MKIIDRKKNIFKLSQGEYVAVE++E
Sbjct  475   TLFSGYYKRQDLTDEVVIDGWFHTGDIGELQSDGSMKIIDRKKNIFKLSQGEYVAVENIE  534

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             +TYSRCPL+A++WVYGNSFESFLVAVV+PERKALEDW + N E  DF SLC+N KARKYI
Sbjct  535   NTYSRCPLIASIWVYGNSFESFLVAVVVPERKALEDWGKENGEATDFKSLCENPKARKYI  594

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L++LN+TG+ H LRGFE+L+AV+LEP PFD+ERDLVTPTFKLKRPQLL YYKD ID+LY 
Sbjct  595   LNKLNSTGQTHHLRGFELLKAVYLEPNPFDMERDLVTPTFKLKRPQLLKYYKDRIDELYS  654

Query  248   EAK  240
             E K
Sbjct  655   EGK  657



>ref|XP_010255021.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255022.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010255023.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Nelumbo 
nucifera]
Length=600

 Score =   450 bits (1158),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 256/314 (82%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +      +N + GLK D      D L FDK K A GGRVR+++SGAAPLP H EEF
Sbjct  283   TLFQLAYNYKLKNLKSGLKQDSAAPLFDTLIFDKSKQALGGRVRIIISGAAPLPSHVEEF  342

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRVT   V  QGY LTES  GCF  IAN F M GT GVP+TTIEARLESVPEMGYDAL +
Sbjct  343   LRVTSCSVLVQGYGLTESCAGCFTSIANEFSMMGTVGVPLTTIEARLESVPEMGYDALSS  402

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             VPRGEICLRG TLFSGYHKR+DLT DV+VDGWFHTGDIGEWQP+G MKIIDRKKNIFKLS
Sbjct  403   VPRGEICLRGITLFSGYHKRQDLTDDVIVDGWFHTGDIGEWQPNGTMKIIDRKKNIFKLS  462

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEY++ E++ES Y RCPL+ ++WVYGNSFESFLVAV +P RKALEDWA  +++TGDF +
Sbjct  463   QGEYISAENIESIYGRCPLITSIWVYGNSFESFLVAVAVPNRKALEDWATLHQQTGDFKA  522

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LCK+  ARKYILDELN+TG+K+QLRGFEML+A+HL+P PF+IERDL+TPTFKLKRPQLL 
Sbjct  523   LCKSPMARKYILDELNSTGQKYQLRGFEMLKAIHLDPNPFNIERDLITPTFKLKRPQLLK  582

Query  281   YYKDCIDQLYKEAK  240
             YYK+ I QLY EAK
Sbjct  583   YYKEYIGQLYNEAK  596



>ref|XP_008387336.1| PREDICTED: long chain acyl-CoA synthetase 2 [Malus domestica]
Length=658

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/302 (76%), Positives = 254/302 (84%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  ++    LD+L FDKIK A GGRVR++LSGAAPLP H EEFLRVT     SQG
Sbjct  353   NLEKGLPQEKAAPLLDKLVFDKIKQALGGRVRILLSGAAPLPRHVEEFLRVTSCSTLSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GG F  I NVFPM GT GVP+TTIEARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  413   YGLTESCGGSFTSIGNVFPMIGTVGVPITTIEARLESVPEMGYDALSSVPRGEICLRGTT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT +V+VDGWFHTGDIGEWQ DGAMKIIDRKKNIFKLSQGEYVAVE++ES
Sbjct  473   LFSGYHKREDLTEEVLVDGWFHTGDIGEWQADGAMKIIDRKKNIFKLSQGEYVAVENIES  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+P+ KALEDWA  +  T DF SLC+N KA KYIL
Sbjct  533   KYLQCPLITSIWVYGNSFESFLVAVVVPDPKALEDWAAEHHLTDDFKSLCQNPKASKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+K QLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL YYKD ID LY E
Sbjct  593   DELNSTGQKQQLRGFELLKAVHLEPKPFDMERDLITPTFKLKRPQLLKYYKDRIDTLYSE  652

Query  245   AK  240
              K
Sbjct  653   GK  654



>ref|XP_009375329.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Pyrus x bretschneideri]
Length=659

 Score =   451 bits (1161),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 228/302 (75%), Positives = 254/302 (84%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  ++    LD+L FDKIK A GGRVR++LSGAAPLP H EEFLRVT     SQG
Sbjct  354   NLEKGLPQEKAAPLLDKLVFDKIKQALGGRVRILLSGAAPLPRHVEEFLRVTSCSTLSQG  413

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GG F  I NVFPM GT GVP+TTIEARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  414   YGLTESCGGSFTSIGNVFPMIGTVGVPITTIEARLESVPEMGYDALSSVPRGEICLRGTT  473

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT +V+VDGWFHTGDIGEWQ DGAMKIIDRKKNIFKLSQGEYVAVE++ES
Sbjct  474   LFSGYHKREDLTEEVLVDGWFHTGDIGEWQADGAMKIIDRKKNIFKLSQGEYVAVENIES  533

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+P+ KALEDWA  +  T DF SLC+N KA KYIL
Sbjct  534   KYLQCPLITSIWVYGNSFESFLVAVVVPDPKALEDWAAEHHLTDDFKSLCQNPKASKYIL  593

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+K QLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL YYKD +D LY E
Sbjct  594   DELNSTGQKQQLRGFELLKAVHLEPKPFDMERDLITPTFKLKRPQLLKYYKDRVDTLYSE  653

Query  245   AK  240
              K
Sbjct  654   GK  655



>ref|XP_008776876.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Phoenix 
dactylifera]
Length=622

 Score =   450 bits (1157),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 225/307 (73%), Positives = 256/307 (83%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             +N  +G+K +E   F DRL FDKIK   GGRVR+M+SGAAPLP H EEFLRV    V  Q
Sbjct  316   KNLRRGMKQNEASPFFDRLVFDKIKQGLGGRVRIMISGAAPLPRHIEEFLRVVCCSVFIQ  375

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  IANV PM GT GVP+TTIEARLESVPEMGYDAL  VPRGEICLRGK
Sbjct  376   GYGLTESCSGCFTSIANVLPMMGTVGVPVTTIEARLESVPEMGYDALSHVPRGEICLRGK  435

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFS Y+K ++LT + +VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEY+AVE+LE
Sbjct  436   TLFSSYYKHQELTSEAIVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYIAVENLE  495

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             STY +CPLVA+VWVYGNSFESFLV VV+PE+K +E+WA  N   G F  LCK+ KARKYI
Sbjct  496   STYMQCPLVASVWVYGNSFESFLVGVVVPEKKLVEEWAAVNDVIGAFEELCKHPKARKYI  555

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELNNTG++H+L+GFE+L+AVHLEPTPFD+ERDL+TPTFKLKRPQLL YYKD ID LY+
Sbjct  556   LDELNNTGRRHELKGFELLKAVHLEPTPFDMERDLITPTFKLKRPQLLKYYKDFIDGLYQ  615

Query  248   EAKNVSA  228
             EAK   A
Sbjct  616   EAKETKA  622



>ref|XP_009375321.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Pyrus x bretschneideri]
Length=658

 Score =   451 bits (1160),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 228/302 (75%), Positives = 254/302 (84%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  ++    LD+L FDKIK A GGRVR++LSGAAPLP H EEFLRVT     SQG
Sbjct  353   NLEKGLPQEKAAPLLDKLVFDKIKQALGGRVRILLSGAAPLPRHVEEFLRVTSCSTLSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GG F  I NVFPM GT GVP+TTIEARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  413   YGLTESCGGSFTSIGNVFPMIGTVGVPITTIEARLESVPEMGYDALSSVPRGEICLRGTT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT +V+VDGWFHTGDIGEWQ DGAMKIIDRKKNIFKLSQGEYVAVE++ES
Sbjct  473   LFSGYHKREDLTEEVLVDGWFHTGDIGEWQADGAMKIIDRKKNIFKLSQGEYVAVENIES  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+P+ KALEDWA  +  T DF SLC+N KA KYIL
Sbjct  533   KYLQCPLITSIWVYGNSFESFLVAVVVPDPKALEDWAAEHHLTDDFKSLCQNPKASKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+K QLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL YYKD +D LY E
Sbjct  593   DELNSTGQKQQLRGFELLKAVHLEPKPFDMERDLITPTFKLKRPQLLKYYKDRVDTLYSE  652

Query  245   AK  240
              K
Sbjct  653   GK  654



>ref|XP_009345813.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=658

 Score =   451 bits (1159),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/302 (74%), Positives = 253/302 (84%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  ++    LD+L FDKIK   GGRVRL+LSGAAPLP H EEFLRVT     SQG
Sbjct  353   NLEKGLPQEKAAPLLDKLVFDKIKQVLGGRVRLLLSGAAPLPRHVEEFLRVTSCSTLSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGCF  I+NVFPM GT GVP+TTIEARLESVP MGYDAL + PRGEICLRG T
Sbjct  413   YGLTESCGGCFTSISNVFPMIGTVGVPVTTIEARLESVPAMGYDALSSAPRGEICLRGTT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT +V++DGWFHTGDIGEWQ DG+MKIIDRKKNI+KLSQGEYVAVE++E 
Sbjct  473   LFSGYHKREDLTEEVLIDGWFHTGDIGEWQADGSMKIIDRKKNIYKLSQGEYVAVENIEG  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+P+ KA+E WA  +  TGDF SLC+N KARKYIL
Sbjct  533   KYLQCPLITSIWVYGNSFESFLVAVVVPDSKAMEHWAAEHHLTGDFKSLCQNPKARKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+K  LRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQL  YYKDCID+LY E
Sbjct  593   DELNSTGQKQHLRGFELLKAVHLEPNPFDMERDLITPTFKLKRPQLHKYYKDCIDKLYSE  652

Query  245   AK  240
              K
Sbjct  653   GK  654



>ref|XP_010255020.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Nelumbo 
nucifera]
Length=661

 Score =   450 bits (1158),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 256/314 (82%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +      +N + GLK D      D L FDK K A GGRVR+++SGAAPLP H EEF
Sbjct  344   TLFQLAYNYKLKNLKSGLKQDSAAPLFDTLIFDKSKQALGGRVRIIISGAAPLPSHVEEF  403

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRVT   V  QGY LTES  GCF  IAN F M GT GVP+TTIEARLESVPEMGYDAL +
Sbjct  404   LRVTSCSVLVQGYGLTESCAGCFTSIANEFSMMGTVGVPLTTIEARLESVPEMGYDALSS  463

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             VPRGEICLRG TLFSGYHKR+DLT DV+VDGWFHTGDIGEWQP+G MKIIDRKKNIFKLS
Sbjct  464   VPRGEICLRGITLFSGYHKRQDLTDDVIVDGWFHTGDIGEWQPNGTMKIIDRKKNIFKLS  523

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEY++ E++ES Y RCPL+ ++WVYGNSFESFLVAV +P RKALEDWA  +++TGDF +
Sbjct  524   QGEYISAENIESIYGRCPLITSIWVYGNSFESFLVAVAVPNRKALEDWATLHQQTGDFKA  583

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LCK+  ARKYILDELN+TG+K+QLRGFEML+A+HL+P PF+IERDL+TPTFKLKRPQLL 
Sbjct  584   LCKSPMARKYILDELNSTGQKYQLRGFEMLKAIHLDPNPFNIERDLITPTFKLKRPQLLK  643

Query  281   YYKDCIDQLYKEAK  240
             YYK+ I QLY EAK
Sbjct  644   YYKEYIGQLYNEAK  657



>ref|XP_008776875.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Phoenix 
dactylifera]
Length=659

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/307 (73%), Positives = 256/307 (83%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             +N  +G+K +E   F DRL FDKIK   GGRVR+M+SGAAPLP H EEFLRV    V  Q
Sbjct  353   KNLRRGMKQNEASPFFDRLVFDKIKQGLGGRVRIMISGAAPLPRHIEEFLRVVCCSVFIQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  IANV PM GT GVP+TTIEARLESVPEMGYDAL  VPRGEICLRGK
Sbjct  413   GYGLTESCSGCFTSIANVLPMMGTVGVPVTTIEARLESVPEMGYDALSHVPRGEICLRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFS Y+K ++LT + +VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEY+AVE+LE
Sbjct  473   TLFSSYYKHQELTSEAIVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYIAVENLE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             STY +CPLVA+VWVYGNSFESFLV VV+PE+K +E+WA  N   G F  LCK+ KARKYI
Sbjct  533   STYMQCPLVASVWVYGNSFESFLVGVVVPEKKLVEEWAAVNDVIGAFEELCKHPKARKYI  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELNNTG++H+L+GFE+L+AVHLEPTPFD+ERDL+TPTFKLKRPQLL YYKD ID LY+
Sbjct  593   LDELNNTGRRHELKGFELLKAVHLEPTPFDMERDLITPTFKLKRPQLLKYYKDFIDGLYQ  652

Query  248   EAKNVSA  228
             EAK   A
Sbjct  653   EAKETKA  659



>gb|ABG22526.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score =   449 bits (1154),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 246/302 (81%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGLK DE   F D++ F KIK   GGR+RL+LSGAAPLP H EEF+RVT   V  QG
Sbjct  341   NLRKGLKQDEASPFFDKIVFSKIKEGLGGRIRLLLSGAAPLPRHVEEFMRVTSCSVLVQG  400

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANVF M G+ G P+TTIEARLES+PEMGYDAL  VPRGEICLRG T
Sbjct  401   YGLTESCSGCFTSIANVFSMIGSVGPPVTTIEARLESIPEMGYDALSNVPRGEICLRGHT  460

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  461   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  520

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLV +VWVYGNSFESFLVAVV+PE++A+EDWA  N +TG+F  LC + KAR YI 
Sbjct  521   AYVQSPLVTSVWVYGNSFESFLVAVVVPEKQAIEDWAAQNNKTGNFAELCNDPKARMYIQ  580

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGK+  LRGFEML+A+HLE TPF IE+DLVTPTFKLKRPQLL YYKDCIDQLYK+
Sbjct  581   DELNKTGKRLGLRGFEMLKAIHLETTPFSIEKDLVTPTFKLKRPQLLKYYKDCIDQLYKD  640

Query  245   AK  240
             AK
Sbjct  641   AK  642



>gb|EEC68356.1| hypothetical protein OsI_36489 [Oryza sativa Indica Group]
Length=647

 Score =   449 bits (1154),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 246/302 (81%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGLK DE   F D++ F KIK   GGR+RL+LSGAAPLP H EEF+RVT   V  QG
Sbjct  341   NLRKGLKQDEASPFFDKIVFSKIKEGLGGRIRLLLSGAAPLPRHVEEFMRVTSCSVLVQG  400

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANVF M G+ G P+TTIEARLES+PEMGYDAL  VPRGEICLRG T
Sbjct  401   YGLTESCSGCFTSIANVFSMIGSVGPPVTTIEARLESIPEMGYDALSNVPRGEICLRGHT  460

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  461   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  520

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLV +VWVYGNSFESFLVAVV+PE++A+EDWA  N +TG+F  LC + KAR YI 
Sbjct  521   AYVQSPLVTSVWVYGNSFESFLVAVVVPEKQAIEDWAAQNNKTGNFAELCNDPKARMYIQ  580

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGK+  LRGFEML+A+HLE TPF IE+DLVTPTFKLKRPQLL YYKDCIDQLYK+
Sbjct  581   DELNKTGKRLGLRGFEMLKAIHLETTPFSIEKDLVTPTFKLKRPQLLKYYKDCIDQLYKD  640

Query  245   AK  240
             AK
Sbjct  641   AK  642



>ref|XP_009345786.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Pyrus x bretschneideri]
Length=658

 Score =   449 bits (1154),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 227/302 (75%), Positives = 253/302 (84%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  ++    LD+L FDKIK A GGRVR++LSGAAPLP H EEFLRVT     SQG
Sbjct  353   NLEKGLPQEKAAPLLDKLVFDKIKQALGGRVRILLSGAAPLPRHVEEFLRVTSCSTLSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GG F  I NVFPM GT GVP+TTIEARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  413   YGLTESCGGSFTSIGNVFPMIGTVGVPITTIEARLESVPEMGYDALSSVPRGEICLRGTT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT +V+VDGWFHTGDIGEWQ DGAMKIIDRKKNIFKLSQGEYVAVE++ES
Sbjct  473   LFSGYHKREDLTEEVLVDGWFHTGDIGEWQADGAMKIIDRKKNIFKLSQGEYVAVENIES  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+P+ KAL DWA  +  T DF SLC+N KA KYIL
Sbjct  533   KYLQCPLITSIWVYGNSFESFLVAVVVPDPKALGDWAAEHHLTDDFKSLCQNPKASKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+TG+K QLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL YYKD +D LY E
Sbjct  593   DELNSTGQKQQLRGFELLKAVHLEPKPFDMERDLITPTFKLKRPQLLKYYKDRVDTLYSE  652

Query  245   AK  240
              K
Sbjct  653   GK  654



>ref|NP_001068097.1| Os11g0558300 [Oryza sativa Japonica Group]
 gb|ABA94294.1| AMP-binding enzyme family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28460.1| Os11g0558300 [Oryza sativa Japonica Group]
 dbj|BAG98895.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52279.1| hypothetical protein OsJ_34263 [Oryza sativa Japonica Group]
Length=661

 Score =   448 bits (1153),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 246/302 (81%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGLK DE   F D++ F KIK   GGR+RL+LSGAAPLP H EEF+RVT   V  QG
Sbjct  355   NLRKGLKQDEASPFFDKIVFSKIKEGLGGRIRLLLSGAAPLPRHVEEFMRVTSCSVLVQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANVF M G+ G P+TTIEARLES+PEMGYDAL  VPRGEICLRG T
Sbjct  415   YGLTESCSGCFTSIANVFSMIGSVGPPVTTIEARLESIPEMGYDALSNVPRGEICLRGHT  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  475   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLV +VWVYGNSFESFLVAVV+PE++A+EDWA  N +TG+F  LC + KAR YI 
Sbjct  535   AYVQSPLVTSVWVYGNSFESFLVAVVVPEKQAIEDWAAQNNKTGNFAELCNDPKARMYIQ  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGK+  LRGFEML+A+HLE TPF IE+DLVTPTFKLKRPQLL YYKDCIDQLYK+
Sbjct  595   DELNKTGKRLGLRGFEMLKAIHLETTPFSIEKDLVTPTFKLKRPQLLKYYKDCIDQLYKD  654

Query  245   AK  240
             AK
Sbjct  655   AK  656



>ref|XP_007153144.1| hypothetical protein PHAVU_003G010600g [Phaseolus vulgaris]
 gb|ESW25138.1| hypothetical protein PHAVU_003G010600g [Phaseolus vulgaris]
Length=660

 Score =   448 bits (1152),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 227/316 (72%), Positives = 258/316 (82%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL         +  EKGL   +     DRL FDK K A GGRVR++LSGAAPLP H E
Sbjct  341   QSTLFQCAYNYKLKYLEKGLPQHKAAPLFDRLVFDKTKQALGGRVRILLSGAAPLPRHVE  400

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             EF+RVT G   SQGY LTES  GCF  I +V+ MTGT GVPMTTIEARLESVPEM YDAL
Sbjct  401   EFMRVTSGSTLSQGYGLTESCAGCFTAIGDVYSMTGTVGVPMTTIEARLESVPEMEYDAL  460

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
               V RGEICLRG TLFSGYHKREDLT++V+VDGWFHTGDIGEWQP+G MKIIDRKKNIFK
Sbjct  461   SNVARGEICLRGNTLFSGYHKREDLTKEVMVDGWFHTGDIGEWQPNGVMKIIDRKKNIFK  520

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE++E+ Y +CPL+A++WVYGNSFESFLVAVV+PERKA+EDWA  +  + DF
Sbjct  521   LSQGEYVAVENIENKYLQCPLIASIWVYGNSFESFLVAVVVPERKAIEDWALVHNVSDDF  580

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              SLC N KARKYILDELN+TG+KHQLRGFE+L+A+HLE  PFD+ERD+VTPTFKLKRPQL
Sbjct  581   KSLCDNLKARKYILDELNSTGQKHQLRGFELLKAIHLESNPFDMERDIVTPTFKLKRPQL  640

Query  287   LNYYKDCIDQLYKEAK  240
             L YYKD ID LYKEAK
Sbjct  641   LKYYKDHIDLLYKEAK  656



>gb|KCW62899.1| hypothetical protein EUGRSUZ_G00490 [Eucalyptus grandis]
Length=659

 Score =   447 bits (1151),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 221/302 (73%), Positives = 251/302 (83%), Gaps = 2/302 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKG   D+    +DRL F+K KLA GGR+R + SGAAPLP H EEFLRVT     SQG
Sbjct  356   NLEKGFPQDKAAPLMDRLVFEKTKLALGGRIRALSSGAAPLPKHVEEFLRVTSCSTLSQG  415

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
               LTES GGCF  + NVF M GT G+PM +IEARLESVP+MGY+AL + PRGEICLRG T
Sbjct  416   --LTESCGGCFSSVGNVFSMMGTVGIPMPSIEARLESVPDMGYNALSSTPRGEICLRGTT  473

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKR+DLT DV+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVA+E++ES
Sbjct  474   LFSGYHKRQDLTNDVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAIENVES  533

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y RCPLV ++WVYGNSFESFLVAVV+P+RKALEDWA N   TGDF SLC+N KA+KY+ 
Sbjct  534   VYQRCPLVTSIWVYGNSFESFLVAVVVPDRKALEDWAANQGVTGDFQSLCQNLKAKKYVQ  593

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+ G+ H+LRGFEML+AVHLEP  FDIERDL+TPTFKLKRPQLL YYKD IDQLY +
Sbjct  594   DELNSIGQTHKLRGFEMLKAVHLEPNLFDIERDLITPTFKLKRPQLLKYYKDHIDQLYSQ  653

Query  245   AK  240
             AK
Sbjct  654   AK  655



>gb|KHN25339.1| Long chain acyl-CoA synthetase 2 [Glycine soja]
Length=656

 Score =   447 bits (1150),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/292 (76%), Positives = 249/292 (85%), Gaps = 0/292 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKGL  D+     D+L FDKIK A GGRVRL+LSGAAPLP H EEFLRVT G   SQGY 
Sbjct  356   EKGLPQDKAAPLFDKLVFDKIKQALGGRVRLLLSGAAPLPRHVEEFLRVTFGATMSQGYG  415

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES GGCF  I+NVF M GT GVPMTTIE+RLESVPEMGYDAL +  RGEICLRG TLF
Sbjct  416   LTESCGGCFTAISNVFSMMGTIGVPMTTIESRLESVPEMGYDALSSEARGEICLRGNTLF  475

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHK +DLT +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y
Sbjct  476   SGYHKHQDLTEEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVENIENKY  535

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+ ++WVYGNSFESFLVAVV+PERKALEDWA  +  T DF SLC+N KARKYILDE
Sbjct  536   LQCPLITSIWVYGNSFESFLVAVVVPERKALEDWAVKHNSTDDFKSLCENPKARKYILDE  595

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCI  264
             LNNTG+KHQLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQLL  YK C+
Sbjct  596   LNNTGQKHQLRGFELLKAVHLEPIPFDMERDLITPTFKLKRPQLLKQYKVCL  647



>ref|XP_010909564.1| PREDICTED: long chain acyl-CoA synthetase 2 [Elaeis guineensis]
Length=659

 Score =   446 bits (1147),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 253/307 (82%), Gaps = 0/307 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             +N  +GLK +E   F D+L FDKIK   GGRVR+M+SGAAPLP H EEFLRVT   V  Q
Sbjct  353   KNLRRGLKQNEASPFFDKLVFDKIKQGLGGRVRIMISGAAPLPRHIEEFLRVTCCSVFLQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  IANV PM GT GVP+TTIEARLESVPEMGYDAL  VPRGEICLRGK
Sbjct  413   GYGLTESCSGCFTSIANVLPMMGTVGVPITTIEARLESVPEMGYDALSHVPRGEICLRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KR DLT +V +DGWFHTGDIGEWQP GAMKIIDR+KNIFKLSQGEY+A E+LE
Sbjct  473   TLFSGYYKRPDLTSEVTMDGWFHTGDIGEWQPSGAMKIIDRRKNIFKLSQGEYIAAENLE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             S Y +CPLV +VWVYGNSFESF+V VV+PE++ +E+WA  N  TG F  LCK+ KARKY+
Sbjct  533   SAYLQCPLVTSVWVYGNSFESFIVGVVVPEKRLVEEWAAANDVTGTFEELCKHPKARKYV  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             LDELNNTG+ H+LRGFE+L+AVHLEP PFDIERDL+TPTFKLKRPQLL YYKD ID LY+
Sbjct  593   LDELNNTGRTHELRGFELLKAVHLEPIPFDIERDLITPTFKLKRPQLLKYYKDFIDGLYQ  652

Query  248   EAKNVSA  228
             EAK   A
Sbjct  653   EAKGKRA  659



>gb|EEC68358.1| hypothetical protein OsI_36493 [Oryza sativa Indica Group]
Length=716

 Score =   447 bits (1151),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 246/302 (81%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGLK DE   F D++ F KIK   GGR+RL+LSGAAPLP H EEF+RVT   V  QG
Sbjct  130   NLRKGLKQDEASPFFDKIVFSKIKEGLGGRIRLLLSGAAPLPRHVEEFMRVTSCSVLVQG  189

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANVF M G+ G P+TTIEARLES+PEMGYDAL  VPRGEICLRG T
Sbjct  190   YGLTESCSGCFTSIANVFSMIGSVGPPVTTIEARLESIPEMGYDALSNVPRGEICLRGHT  249

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  250   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  309

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLV +VWVYGNSFESFLVAVV+PE++A+EDWA  N +TG+F  LC + KAR YI 
Sbjct  310   AYVQSPLVTSVWVYGNSFESFLVAVVVPEKQAIEDWAAQNNKTGNFAELCNDPKARMYIE  369

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGK+  LRGFEML+A+HLE TPF IE+DLVTPTFKLKRPQLL YYKDCIDQLYK+
Sbjct  370   DELNKTGKRLGLRGFEMLKAIHLETTPFSIEKDLVTPTFKLKRPQLLKYYKDCIDQLYKD  429

Query  245   AK  240
             AK
Sbjct  430   AK  431


 Score =   430 bits (1105),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 221/320 (69%), Positives = 247/320 (77%), Gaps = 7/320 (2%)
 Frame = -2

Query  1178  LSTMPITTNRRNREKGLKHDEPDLF------LDRLGFD-KIKLAFGGRVRLMLSGAAPLP  1020
             L T P +  +       K   P L       +D+L  D KIK   GGR+RL+LSGAAPLP
Sbjct  392   LETTPFSIEKDLVTPTFKLKRPQLLKYYKDCIDQLYKDAKIKEGLGGRIRLLLSGAAPLP  451

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H EEF+RVT   V  QGY LTES  GCF  IANVF M G+ G P+TTIEARLES+PEMG
Sbjct  452   RHVEEFMRVTSCSVLVQGYGLTESCSGCFTSIANVFSMIGSVGPPVTTIEARLESIPEMG  511

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL  VPRGEICLRG TLFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKK
Sbjct  512   YDALSNVPRGEICLRGHTLFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKK  571

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE LES Y + PLV +VWVYGNSFESFLVAVV+PE++A+EDWA  N +
Sbjct  572   NIFKLSQGEYVAVEVLESAYVQSPLVTSVWVYGNSFESFLVAVVVPEKQAIEDWAAQNNK  631

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             TG+F  LC + KAR YI DELN TGK+  LRGFEML+A+HLE TPF IE+DLVTPTFKLK
Sbjct  632   TGNFAELCNDPKARMYIEDELNKTGKRLGLRGFEMLKAIHLETTPFSIEKDLVTPTFKLK  691

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQLL YYKDCIDQLYK+AK
Sbjct  692   RPQLLKYYKDCIDQLYKDAK  711



>ref|XP_007041379.1| Long-chain acyl-CoA synthetase 2 isoform 2 [Theobroma cacao]
 gb|EOX97210.1| Long-chain acyl-CoA synthetase 2 isoform 2 [Theobroma cacao]
Length=689

 Score =   446 bits (1147),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 230/330 (70%), Positives = 260/330 (79%), Gaps = 28/330 (8%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N E G   D+    LD+L FDK++ A GG+VR+MLSGAAPLP H EEFLRV+     SQG
Sbjct  356   NMEIGFPQDKASPLLDKLVFDKVRQALGGKVRIMLSGAAPLPRHVEEFLRVSCCSNLSQG  415

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGCF  +ANV  M GT GVPMTTIEARLESVPEMGYDAL +VPRGEICLRG T
Sbjct  416   YGLTESCGGCFTSLANVMSMIGTVGVPMTTIEARLESVPEMGYDALSSVPRGEICLRGNT  475

Query  785   LFSGYHKREDLTRDVVVDGWFHTG----------------------------DIGEWQPD  690
             LFSGY+KR+DLT +V+VDGWFHTG                            DIGE QPD
Sbjct  476   LFSGYYKRQDLTDEVLVDGWFHTGIRPSNLHQSNNMQKLNCLIPQHVDIVTGDIGELQPD  535

Query  689   GAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKA  510
             G+MKIIDRKKNIFKLSQGEYVAVE++E+TYSRCP + ++WVYGNSFESFLVAVV+PERKA
Sbjct  536   GSMKIIDRKKNIFKLSQGEYVAVENVENTYSRCPHITSIWVYGNSFESFLVAVVVPERKA  595

Query  509   LEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIER  330
             LEDWA  + E  DF SLC+N+KARKYILDELN+TG+KHQLRGFEML+AV+LEPTPFD+ER
Sbjct  596   LEDWATEHDEAVDFKSLCENRKARKYILDELNSTGQKHQLRGFEMLKAVYLEPTPFDMER  655

Query  329   DLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             DL+TPTFKLKRPQLL YYKD IDQLY EAK
Sbjct  656   DLITPTFKLKRPQLLKYYKDRIDQLYSEAK  685



>ref|XP_004498183.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Cicer 
arietinum]
Length=666

 Score =   443 bits (1140),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/296 (73%), Positives = 251/296 (85%), Gaps = 0/296 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             EKG+   +   F DRL FDK K A GGRVR++LSGAAPLP+H EE+LRVT G   SQGY 
Sbjct  359   EKGIPQHKAAPFFDRLVFDKTKQALGGRVRILLSGAAPLPIHVEEYLRVTSGSTLSQGYG  418

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES  GCF  I +VF M GT GVPMTTIEARLES+PEMGYDAL + PRGEICLRG +LF
Sbjct  419   LTESCAGCFTAIGDVFSMMGTVGVPMTTIEARLESIPEMGYDALSSNPRGEICLRGNSLF  478

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGYHKR+DLT++V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEY+AVE++ES Y
Sbjct  479   SGYHKRKDLTQEVMVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYIAVENIESKY  538

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
              +CPL+  +WVYGNSFESFLVAVV+P++KA+EDWA  N  TGDF SLC+N KARKYILDE
Sbjct  539   LQCPLITTIWVYGNSFESFLVAVVVPDKKAIEDWAVENNLTGDFKSLCENLKARKYILDE  598

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLY  252
             L +TG+K +LRGFEML+A++LEP PFDIERDLVTPTFKLKRPQLL YYK C +Q +
Sbjct  599   LKSTGQKLKLRGFEMLKAIYLEPIPFDIERDLVTPTFKLKRPQLLKYYKVCFNQYF  654



>ref|XP_008236729.1| PREDICTED: long chain acyl-CoA synthetase 2 [Prunus mume]
Length=658

 Score =   441 bits (1135),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 252/302 (83%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  +     LD+L FDK+K A GGRVR++LSGAAPLP H EEF RVT     SQG
Sbjct  353   NLEKGLPQENAAPLLDKLVFDKMKQALGGRVRILLSGAAPLPRHVEEFFRVTACSTLSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGC   I N+FPM GT GVPMTTIE RLESVPEMGYDAL +VPRGEICLRGK+
Sbjct  413   YGLTESCGGCLTSIGNIFPMMGTVGVPMTTIETRLESVPEMGYDALSSVPRGEICLRGKS  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKR+DLT +V++DGWFHTGDIGE Q +GAMKIIDRKKNIFKLSQGEYVAVE++ES
Sbjct  473   LFSGYHKRQDLTEEVLIDGWFHTGDIGELQRNGAMKIIDRKKNIFKLSQGEYVAVENIES  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+ +RKALEDWA  +  T DF SLC+N KARKYIL
Sbjct  533   KYLQCPLITSIWVYGNSFESFLVAVVVADRKALEDWAAEHHLTDDFKSLCQNLKARKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+ G+K QLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRP LL YYKD ID+LY E
Sbjct  593   DELNSVGQKQQLRGFELLKAVHLEPNPFDMERDLITPTFKLKRPHLLKYYKDRIDKLYSE  652

Query  245   AK  240
             AK
Sbjct  653   AK  654



>ref|XP_003577452.1| PREDICTED: long chain acyl-CoA synthetase 2 [Brachypodium distachyon]
Length=662

 Score =   441 bits (1134),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/306 (72%), Positives = 244/306 (80%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG K  E   F D++ F KIK   GGR+RLMLSGAAPLP H EEF+RVT     +QG
Sbjct  356   NLRKGFKQHEASPFFDKIVFSKIKEGLGGRIRLMLSGAAPLPRHIEEFMRVTGCCALAQG  415

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IAN+F M GT G P+T I+ARLES+PEMGYDAL  VPRGEICLRG T
Sbjct  416   YGLTESCAGCFTSIANIFSMIGTVGPPVTAIQARLESIPEMGYDALSNVPRGEICLRGHT  475

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  476   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  535

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLV +VWVYGNSFESFLVAVV+PE++A+EDWA  N +T DF  LC + KAR+YI 
Sbjct  536   AYVQSPLVTSVWVYGNSFESFLVAVVVPEKQAIEDWAALNNKTSDFAELCNDPKARRYIQ  595

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGKK  LRGFEMLRAVHLEP PF IE+DL+TPTFKLKRPQLL YYKD +DQLYK+
Sbjct  596   DELNKTGKKLGLRGFEMLRAVHLEPVPFGIEKDLITPTFKLKRPQLLKYYKDRVDQLYKD  655

Query  245   AKNVSA  228
             AK  +A
Sbjct  656   AKMATA  661



>ref|XP_009411351.1| PREDICTED: long chain acyl-CoA synthetase 2 [Musa acuminata subsp. 
malaccensis]
Length=654

 Score =   439 bits (1130),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 251/303 (83%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             +N  +G K DE   F DRL F+KI+   GGRVR+M+SGAAPLP H EEFLRVT   V  Q
Sbjct  350   QNLRRGFKQDEASPFFDRLIFNKIRQVTGGRVRIMISGAAPLPRHVEEFLRVTTCSVVIQ  409

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTES  GCF  IANVF M GT GVP  TIEARLESV E+GYDAL  VPRGEICLRG 
Sbjct  410   GYGLTESCSGCFTSIANVFSMMGTVGVPAATIEARLESVLELGYDALSDVPRGEICLRGN  469

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGYHKR DL  +V+VDGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE LE
Sbjct  470   TLFSGYHKRADLLDEVLVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVEVLE  529

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             +TY +CPLV +VWVYGNSFESFLV+VV+PE+ +LE+WA  N+  G F  LCK+ +ARK++
Sbjct  530   NTYMQCPLVTSVWVYGNSFESFLVSVVVPEKNSLEEWAAANKVKGSFELLCKHPEARKHV  589

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L+ELN T +KHQL+GFEML+AVHLEP+PFD+ERDL+TPTFKLKRPQLL ++K+CID LY+
Sbjct  590   LEELNYTARKHQLKGFEMLKAVHLEPSPFDMERDLITPTFKLKRPQLLKHFKECIDGLYR  649

Query  248   EAK  240
             EAK
Sbjct  650   EAK  652



>gb|KJB16145.1| hypothetical protein B456_002G214200 [Gossypium raimondii]
Length=687

 Score =   441 bits (1133),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 257/329 (78%), Gaps = 26/329 (8%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN E G   D+    LD+L FDK++ A GG+VRLMLSGAAPLP H EEFLRV+     SQ
Sbjct  355   RNMENGFPQDKASPLLDKLVFDKVRQALGGKVRLMLSGAAPLPRHVEEFLRVSCCSNLSQ  414

Query  968   GYD--------------------------LTES*GGCFKCIANVFpmtgtggvpmtTIEA  867
             GY                           LTES GGCF  +ANV  M GT GVP+TTIEA
Sbjct  415   GYGNKFYALIYRTMNVLNEKFYELFNMTGLTESCGGCFTSLANVMSMIGTVGVPITTIEA  474

Query  866   RLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDG  687
             RLESVPEMGYDAL +VPRGEICLRG TLFSGY+KR+DLT +VV+DGWFHTGDIGE Q DG
Sbjct  475   RLESVPEMGYDALSSVPRGEICLRGNTLFSGYYKRQDLTDEVVIDGWFHTGDIGELQSDG  534

Query  686   AMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKAL  507
             +MKIIDRKKNIFKLSQGEYVAVE++E+TYSRCPL+A++WVYGNSFESFLVAVV+PERKAL
Sbjct  535   SMKIIDRKKNIFKLSQGEYVAVENIENTYSRCPLIASIWVYGNSFESFLVAVVVPERKAL  594

Query  506   EDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERD  327
             EDW   N E  DF SLC+N KARKYIL+ELN+TG+KH LRGFE+L+AV+LEP PFD+ERD
Sbjct  595   EDWGIENGEATDFKSLCENPKARKYILNELNSTGQKHHLRGFELLKAVYLEPNPFDMERD  654

Query  326   LVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             LVTPTFKLKRPQLL YYKD ID+LY E K
Sbjct  655   LVTPTFKLKRPQLLKYYKDRIDELYSEGK  683



>ref|XP_007201738.1| hypothetical protein PRUPE_ppa002568mg [Prunus persica]
 gb|EMJ02937.1| hypothetical protein PRUPE_ppa002568mg [Prunus persica]
Length=658

 Score =   439 bits (1128),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 251/302 (83%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  +     LD+L FDK+K A GGRVR++LSGAAPLP H EEF RVT     SQG
Sbjct  353   NLEKGLPQENAAPLLDKLVFDKMKQALGGRVRILLSGAAPLPRHVEEFFRVTACSTLSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GG    I NVFPM GT GVPMTTIE RLESVPEMGYDAL +VPRGEICLRGK+
Sbjct  413   YGLTESCGGSLTSIGNVFPMMGTVGVPMTTIETRLESVPEMGYDALSSVPRGEICLRGKS  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKR+DLT +V++DGWFHTGDIGE QP+GAMKIIDRKKNIFKLSQGEYVAVE++ES
Sbjct  473   LFSGYHKRQDLTEEVLIDGWFHTGDIGELQPNGAMKIIDRKKNIFKLSQGEYVAVENIES  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+P+RKALEDWA  +  T  F SLC+N KARKYIL
Sbjct  533   KYLQCPLITSIWVYGNSFESFLVAVVVPDRKALEDWAAEHHLTEGFKSLCQNLKARKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN+ G+K QLRGFE+L+AVHLEP PFD+ERDL+TPTFKLKR  LL YYKD ID+LY E
Sbjct  593   DELNSVGQKQQLRGFELLKAVHLEPNPFDMERDLITPTFKLKRTHLLKYYKDRIDKLYSE  652

Query  245   AK  240
             AK
Sbjct  653   AK  654



>ref|XP_004507386.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Cicer 
arietinum]
Length=660

 Score =   438 bits (1127),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 219/298 (73%), Positives = 251/298 (84%), Gaps = 0/298 (0%)
 Frame = -2

Query  1133  GLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLT  954
             GL  D+     D+L FDKIK A GGRVR++LSGAAPL  + EEFLRVT G   +QGY LT
Sbjct  359   GLPQDKAAPLFDKLVFDKIKQALGGRVRILLSGAAPLSRNVEEFLRVTFGSSLAQGYGLT  418

Query  953   ES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSG  774
             E+  GCF  I NVF M GT GVPMTTIEARLESVPEMGYDAL +  RGEICLRG TLFSG
Sbjct  419   ETCAGCFASIFNVFSMIGTVGVPMTTIEARLESVPEMGYDALSSQARGEICLRGNTLFSG  478

Query  773   YHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSR  594
             YHKR+DLT++V+VDGWFHTGDIGEW P+GAMK+IDRKKNIFKLSQGEYVAVE++E+ Y +
Sbjct  479   YHKRQDLTQEVMVDGWFHTGDIGEWLPNGAMKVIDRKKNIFKLSQGEYVAVENIENKYLQ  538

Query  593   CPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELN  414
             CPL+ ++WVYGNSFESFLVAVV+PE++ALEDWA  +  + DF SLC N KARKYILDELN
Sbjct  539   CPLITSIWVYGNSFESFLVAVVVPEKQALEDWAVKHDLSDDFKSLCGNLKARKYILDELN  598

Query  413   NTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
              TG+KHQLRGFE+++AVHLEP PFD+ERDLVTPTFKLKRPQL  +YKDCIDQLY EAK
Sbjct  599   ITGQKHQLRGFELIKAVHLEPIPFDVERDLVTPTFKLKRPQLQKHYKDCIDQLYNEAK  656



>ref|XP_006663529.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Oryza brachyantha]
Length=661

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 220/302 (73%), Positives = 241/302 (80%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGLK  E   F D++ F KIK   GGR+RL+LSGAAPLP H EEF+RVT   V  QG
Sbjct  355   NLRKGLKQHEASPFFDKIVFSKIKEGLGGRIRLLLSGAAPLPRHIEEFIRVTSCSVLVQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANV  M GT G P+TTIEARLES+PEMGYDAL   PRGEICLRG T
Sbjct  415   YGLTESCSGCFTSIANVVSMIGTVGPPVTTIEARLESIPEMGYDALSNAPRGEICLRGDT  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  475   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLV +VWVYGNSFESFLVAVV+PE++A+EDWA  N +TGDF  LC + KAR YI 
Sbjct  535   AYMQSPLVTSVWVYGNSFESFLVAVVVPEKQAIEDWAAQNNKTGDFAELCNDLKARMYIQ  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGKK  LRGFEML+A+HLE  PF IE+DLVTPTFKLKRPQLL YYKD IDQLYK+
Sbjct  595   DELNKTGKKLGLRGFEMLKAIHLETMPFSIEKDLVTPTFKLKRPQLLKYYKDRIDQLYKD  654

Query  245   AK  240
             AK
Sbjct  655   AK  656



>ref|XP_010461777.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Camelina sativa]
Length=665

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 252/308 (82%), Gaps = 2/308 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG   +E    LDRL FDKIK AFGGR  ++LSGAAPLP H EEFLRV      SQG
Sbjct  358   NMKKGFSQEEASPRLDRLMFDKIKEAFGGRAHMLLSGAAPLPRHVEEFLRVIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT-VPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGYDA    VPRGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYDAFSADVPRGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQ-NNRETGDFVSLCKNQKARKY  432
             +TYSRCPL+A +W+YGNSFESFLV VV+P+RKA+EDWA+ NN+   DF SLC+N KA+KY
Sbjct  538   NTYSRCPLIAQIWIYGNSFESFLVGVVVPDRKAIEDWAKLNNQFPNDFESLCQNLKAQKY  597

Query  431   ILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLY  252
              LDELN+T K++QL+GFEML+A+HLEPTPFDIERDL+TPTFKLKRPQLL +YK  +DQLY
Sbjct  598   FLDELNSTAKQYQLKGFEMLKAIHLEPTPFDIERDLITPTFKLKRPQLLQHYKGIVDQLY  657

Query  251   KEAKNVSA  228
              EAK   A
Sbjct  658   SEAKRSMA  665



>dbj|BAJ88162.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=662

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 247/306 (81%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG K  E   F D++ F KIK   GGR+RLMLSGAAPLP H EEF+RVT   V +QG
Sbjct  356   NLMKGFKQHEASPFFDKIVFSKIKEGLGGRIRLMLSGAAPLPRHIEEFMRVTSCSVLAQG  415

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANV  M GT G P+T +EARLESVPEMGYDAL + PRGEICLRG+T
Sbjct  416   YGLTESCSGCFTSIANVISMIGTVGPPVTAVEARLESVPEMGYDALSSAPRGEICLRGQT  475

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  476   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  535

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y++  LVA+VWVYGNSFESFLVAVV+PE++A+EDWA  N ++GD+  LC + KAR+YI 
Sbjct  536   AYAQSQLVASVWVYGNSFESFLVAVVVPEKQAIEDWAALNGKSGDYAELCSDPKARRYIQ  595

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGKK  LRGFEMLRAVHLEP PF I++DL+TPTFKLKRPQLL +YKD +DQLYK+
Sbjct  596   DELNQTGKKLGLRGFEMLRAVHLEPVPFSIDKDLITPTFKLKRPQLLKHYKDRVDQLYKD  655

Query  245   AKNVSA  228
             AK  +A
Sbjct  656   AKMGTA  661



>ref|XP_010479377.1| PREDICTED: long chain acyl-CoA synthetase 2 [Camelina sativa]
Length=665

 Score =   435 bits (1119),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 251/308 (81%), Gaps = 2/308 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG   +E    LDRL FDKIK AFGGR  ++LSGAAPLP H EEFLRV      SQG
Sbjct  358   NMKKGFSQEEASPRLDRLMFDKIKEAFGGRAHMLLSGAAPLPRHVEEFLRVIPASYLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT-VPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGYDA    VPRGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYDAFSADVPRGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQ-NNRETGDFVSLCKNQKARKY  432
             +TYSRCPL+A +W+YGNSFESFLV VV+P+RKA+EDWA+ NN+   DF SLC+N KA+KY
Sbjct  538   NTYSRCPLIAQIWIYGNSFESFLVGVVVPDRKAIEDWAKLNNQFPNDFESLCQNLKAQKY  597

Query  431   ILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLY  252
              LDELN+T K++QL+GFEML+A+HLEP PFDIERDL+TPTFKLKRPQLL +YK  +DQLY
Sbjct  598   FLDELNSTAKQYQLKGFEMLKAIHLEPNPFDIERDLITPTFKLKRPQLLQHYKGIVDQLY  657

Query  251   KEAKNVSA  228
              EAK   A
Sbjct  658   SEAKRSMA  665



>ref|XP_010525687.1| PREDICTED: long chain acyl-CoA synthetase 2 [Tarenaya hassleriana]
Length=665

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 218/305 (71%), Positives = 250/305 (82%), Gaps = 3/305 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGL  +E    LDRL FDKIK A GGR  ++ SGAAPLP H EEFLR+  G   SQG
Sbjct  357   NMRKGLPQEEASPRLDRLVFDKIKEALGGRAHMLFSGAAPLPRHVEEFLRIIPGSNLSQG  416

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT--VPRGEICLRG  792
             Y LTES GG F  +A +F M  T GVPM T+EARL SVPEMGYDA  T  VPRGEICLRG
Sbjct  417   YGLTESCGGSFTTLAGIFSMVSTVGVPMPTVEARLVSVPEMGYDAFSTDDVPRGEICLRG  476

Query  791   KTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESL  612
              ++FSGYHKREDLT  V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEY+AVE+L
Sbjct  477   TSMFSGYHKREDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYIAVENL  536

Query  611   ESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRET-GDFVSLCKNQKARK  435
             E+TYSRCPLVA +WVYGNSFESFLV VV+PER+ LEDW + N ET  DF SLC+N KA+K
Sbjct  537   ENTYSRCPLVAQIWVYGNSFESFLVGVVVPERQTLEDWTKLNNETPKDFESLCQNPKAKK  596

Query  434   YILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
             YILD+LN+T K+ QL+GFEML+AV+LEP PFDIE+DL+TPTFKLKRPQLLN+YKD ID+L
Sbjct  597   YILDQLNSTAKQFQLKGFEMLKAVYLEPNPFDIEKDLITPTFKLKRPQLLNHYKDIIDRL  656

Query  254   YKEAK  240
             Y+EAK
Sbjct  657   YREAK  661



>gb|EMS67297.1| Long chain acyl-CoA synthetase 2 [Triticum urartu]
Length=628

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 244/306 (80%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N   G K  E   F D++ F KIK   GGR+RLMLSGAAPLP H EEF+RVT   V +QG
Sbjct  322   NLMNGFKQHEASPFFDKIVFSKIKEGLGGRIRLMLSGAAPLPRHIEEFMRVTSCSVLAQG  381

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANV  M GT G P+T +EARLESVPEMGYDAL + PRGEICLRG T
Sbjct  382   YGLTESCSGCFTSIANVISMIGTVGPPVTAVEARLESVPEMGYDALSSAPRGEICLRGHT  441

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR DLT +V  DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES
Sbjct  442   LFSGYYKRPDLTEEVFSDGWFHTGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLES  501

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y++  L A+VWVYGNSFESFLVAVV+PE++A+EDWA  N ++GD+  LC + KAR+YI 
Sbjct  502   AYAQSQLAASVWVYGNSFESFLVAVVVPEKQAIEDWAALNGKSGDYAELCNDPKARRYIQ  561

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGKK  LRGFEMLRAVHLEP PF I++DL+TPTFKLKRPQLL +Y+D +DQLYK+
Sbjct  562   DELNQTGKKLGLRGFEMLRAVHLEPVPFSIDKDLITPTFKLKRPQLLKHYRDRVDQLYKD  621

Query  245   AKNVSA  228
             AK  +A
Sbjct  622   AKMGTA  627



>ref|XP_002891504.1| long-chain acyl-CoA synthetase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67763.1| long-chain acyl-CoA synthetase 2 [Arabidopsis lyrata subsp. lyrata]
Length=665

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 249/308 (81%), Gaps = 2/308 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG   +E    LDRL FDK+K A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMRKGFSQEEASPRLDRLMFDKLKEALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT-VPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGYDA    VPRGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYDAFSADVPRGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQ-NNRETGDFVSLCKNQKARKY  432
             +TYSRCPL+A +WVYGNSFESFLV VV+P+RKA+EDWA+ NN+   DF SLC+N KA+KY
Sbjct  538   NTYSRCPLIAQIWVYGNSFESFLVGVVVPDRKAIEDWAKLNNQSPNDFESLCQNLKAQKY  597

Query  431   ILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLY  252
              LDELN+T K++QL+GFEML+A+HLEP PFDIERDL+TPTFKLKRPQLL +YK  +DQLY
Sbjct  598   FLDELNSTAKQYQLKGFEMLKAIHLEPNPFDIERDLITPTFKLKRPQLLQHYKGIVDQLY  657

Query  251   KEAKNVSA  228
              EAK   A
Sbjct  658   SEAKRSMA  665



>ref|XP_011627729.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X2 [Amborella 
trichopoda]
Length=599

 Score =   429 bits (1102),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 216/306 (71%), Positives = 246/306 (80%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KGLK D+   F D+L F+KI+   GGRVR+MLSGAAPLP H EEFLRV+   V  QG
Sbjct  294   NMKKGLKQDKAAPFFDKLVFNKIRQGLGGRVRMMLSGAAPLPKHIEEFLRVSSCSVLLQG  353

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GC   +AN F M+GT G+P+TTIEARLE+VP+MGYDAL   PRGEICLRGKT
Sbjct  354   YGLTESCAGCLTSVANEFSMSGTVGIPVTTIEARLEAVPDMGYDALSDTPRGEICLRGKT  413

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKR DLT +V+ DGWFHTGDIGEW P GAMKIIDRKKNIFKLSQGEY+AVE+LES
Sbjct  414   LFSGYHKRPDLTDEVLKDGWFHTGDIGEWLPSGAMKIIDRKKNIFKLSQGEYIAVENLES  473

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YSR  LVA++WVYGNSFESFLVAVV+P+  ALE WA      GDF SLCKN KA KYIL
Sbjct  474   VYSRSSLVASIWVYGNSFESFLVAVVVPDDIALEKWASTCGIAGDFKSLCKNPKANKYIL  533

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELNN G+ + LRGFE+L+AVHL+P PFDI RDL+TPTFKLKRPQLL +YKD ID+LY+ 
Sbjct  534   DELNNIGRHNNLRGFEILKAVHLDPNPFDIGRDLITPTFKLKRPQLLKFYKDFIDELYRR  593

Query  245   AKNVSA  228
             AK   A
Sbjct  594   AKGAKA  599



>ref|XP_004979485.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Setaria italica]
Length=661

 Score =   430 bits (1106),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 214/302 (71%), Positives = 243/302 (80%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG+K  E   F D++ F+KIK   GGR+RLM++GAAPLP   EEF+RVT   V  QG
Sbjct  355   NMKKGMKQHEASPFFDKIIFNKIKEGLGGRIRLMIAGAAPLPGQIEEFMRVTSCSVFVQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANVF M GT G P+TTIEARLESVPEMGYDAL   PRGEICLRG T
Sbjct  415   YGLTESCAGCFTSIANVFSMIGTVGPPVTTIEARLESVPEMGYDALSDTPRGEICLRGHT  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KR  LT +V  DGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE +ES
Sbjct  475   LFSGYYKRPSLTEEVFSDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVEVVES  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLVA+VWVYGNSFESFLVAVV+PER+AL++WA  N +T DF  LC + KA+ YI 
Sbjct  535   AYMQSPLVASVWVYGNSFESFLVAVVVPERQALDEWAAANNKTSDFAELCNDPKAKGYIQ  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELN TGKK  LRGFEML+A+HLEP PF IE+DL+TPTFKLKRPQLL YYKD IDQ+Y +
Sbjct  595   DELNKTGKKLGLRGFEMLKAIHLEPVPFSIEKDLITPTFKLKRPQLLKYYKDRIDQMYND  654

Query  245   AK  240
             AK
Sbjct  655   AK  656



>ref|XP_002449702.1| hypothetical protein SORBIDRAFT_05g021840 [Sorghum bicolor]
 gb|EES08690.1| hypothetical protein SORBIDRAFT_05g021840 [Sorghum bicolor]
Length=663

 Score =   430 bits (1106),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 216/302 (72%), Positives = 243/302 (80%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KGLK  E   F D++ F KIK   GGR+RLM++GAAPLP   EEF+RVT   V  QG
Sbjct  356   NMKKGLKQHEASPFFDKIVFSKIKEGLGGRIRLMIAGAAPLPGQIEEFMRVTSCSVVVQG  415

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IANVF M GT G P+TTIEARLESVPEMGYDAL  +PRGEICLRG T
Sbjct  416   YGLTESCAGCFTSIANVFSMIGTVGPPVTTIEARLESVPEMGYDALSDMPRGEICLRGHT  475

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             +FSGY+KR  LT +V  DGWFHTGDIGEWQP+GAMKIIDRKKNIFKLSQGEYVAVE LE 
Sbjct  476   MFSGYYKRPGLTEEVFSDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVEVLER  535

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLVA+VWVYGNSFESFLVAVV+PER+ALE+WA  N + GDF  LC + KAR YI 
Sbjct  536   AYMQSPLVASVWVYGNSFESFLVAVVVPERQALEEWAAANNKAGDFAELCIDPKARSYIQ  595

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             D+LN TGKK  LRGFEML+AV+LEP PF IE+DL+TPTFKLKRPQLL YYKD IDQ+YK+
Sbjct  596   DQLNQTGKKLGLRGFEMLKAVYLEPVPFSIEKDLITPTFKLKRPQLLKYYKDRIDQMYKD  655

Query  245   AK  240
             AK
Sbjct  656   AK  657



>ref|NP_175368.2| long-chain acyl-CoA synthetase 2 [Arabidopsis thaliana]
 sp|Q9XIA9.1|LACS2_ARATH RecName: Full=Long chain acyl-CoA synthetase 2; AltName: Full=Protein 
Botrytis resistant 1; AltName: Full=Protein LATERAL 
ROOT DEVELOPMENT 2 [Arabidopsis thaliana]
 gb|AAD43157.1|AC007504_12 Putative acyl CoA synthetase [Arabidopsis thaliana]
 gb|AAM28869.1|AF503752_1 long chain acyl-CoA synthetase 2 [Arabidopsis thaliana]
 gb|AAL38865.1| putative acyl CoA synthetase [Arabidopsis thaliana]
 gb|AAM19793.1| At1g49430/F13F21_14 [Arabidopsis thaliana]
 gb|AAN71969.1| putative acyl CoA synthetase [Arabidopsis thaliana]
 gb|AEE32429.1| long-chain acyl-CoA synthetase 2 [Arabidopsis thaliana]
Length=665

 Score =   430 bits (1105),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 216/308 (70%), Positives = 249/308 (81%), Gaps = 2/308 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG   +E    LDRL FDKIK A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMRKGFSQEEASPRLDRLMFDKIKEALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT-VPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGYDA    VPRGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYDAFSADVPRGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRET-GDFVSLCKNQKARKY  432
             +TYSRCPL+A +WVYGNSFESFLV VV+P+RKA+EDWA+ N ++  DF SLC+N KA+KY
Sbjct  538   NTYSRCPLIAQIWVYGNSFESFLVGVVVPDRKAIEDWAKLNYQSPNDFESLCQNLKAQKY  597

Query  431   ILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLY  252
              LDELN+T K++QL+GFEML+A+HLEP PFDIERDL+TPTFKLKRPQLL +YK  +DQLY
Sbjct  598   FLDELNSTAKQYQLKGFEMLKAIHLEPNPFDIERDLITPTFKLKRPQLLQHYKGIVDQLY  657

Query  251   KEAKNVSA  228
              EAK   A
Sbjct  658   SEAKRSMA  665



>emb|CDY59237.1| BnaC05g51350D [Brassica napus]
Length=666

 Score =   429 bits (1104),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 219/309 (71%), Positives = 251/309 (81%), Gaps = 3/309 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGL  +E    LDRL FDKIK A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMRKGLSQEEASPRLDRLMFDKIKDALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL-GTVPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGY+A  G V RGEICLRGK
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYEAFSGDVARGEICLRGK  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  VV++GWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVVINGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRET--GDFVSLCKNQKARK  435
             +TYSRCPL+A +W+YGNSFESFLVAVV+PERKA+EDWA+ N ++   DF SLC+N KA+K
Sbjct  538   NTYSRCPLIAQIWIYGNSFESFLVAVVVPERKAIEDWAKLNNQSSPSDFESLCQNLKAQK  597

Query  434   YILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
             Y LDELN+T K++QL+GFEML+AVHLEP  FDIERDL+TPTFKLKRPQLL +YK  IDQL
Sbjct  598   YFLDELNSTAKQYQLKGFEMLKAVHLEPNLFDIERDLITPTFKLKRPQLLKHYKSIIDQL  657

Query  254   YKEAKNVSA  228
             Y EAK   A
Sbjct  658   YTEAKASRA  666



>ref|XP_006856178.1| PREDICTED: long chain acyl-CoA synthetase 2 isoform X1 [Amborella 
trichopoda]
 gb|ERN17645.1| hypothetical protein AMTR_s00059p00179300 [Amborella trichopoda]
Length=658

 Score =   427 bits (1099),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 216/306 (71%), Positives = 246/306 (80%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KGLK D+   F D+L F+KI+   GGRVR+MLSGAAPLP H EEFLRV+   V  QG
Sbjct  353   NMKKGLKQDKAAPFFDKLVFNKIRQGLGGRVRMMLSGAAPLPKHIEEFLRVSSCSVLLQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GC   +AN F M+GT G+P+TTIEARLE+VP+MGYDAL   PRGEICLRGKT
Sbjct  413   YGLTESCAGCLTSVANEFSMSGTVGIPVTTIEARLEAVPDMGYDALSDTPRGEICLRGKT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKR DLT +V+ DGWFHTGDIGEW P GAMKIIDRKKNIFKLSQGEY+AVE+LES
Sbjct  473   LFSGYHKRPDLTDEVLKDGWFHTGDIGEWLPSGAMKIIDRKKNIFKLSQGEYIAVENLES  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YSR  LVA++WVYGNSFESFLVAVV+P+  ALE WA      GDF SLCKN KA KYIL
Sbjct  533   VYSRSSLVASIWVYGNSFESFLVAVVVPDDIALEKWASTCGIAGDFKSLCKNPKANKYIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             DELNN G+ + LRGFE+L+AVHL+P PFDI RDL+TPTFKLKRPQLL +YKD ID+LY+ 
Sbjct  593   DELNNIGRHNNLRGFEILKAVHLDPNPFDIGRDLITPTFKLKRPQLLKFYKDFIDELYRR  652

Query  245   AKNVSA  228
             AK   A
Sbjct  653   AKGAKA  658



>emb|CAA96523.1| acyl CoA synthetase [Brassica napus]
Length=666

 Score =   428 bits (1100),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 249/305 (82%), Gaps = 3/305 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGL  +E    LDRL FDKIK A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMRKGLSQEEASPRLDRLMFDKIKDALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL-GTVPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGY+A  G V RGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYEAFSGDVARGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  VV++GWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTNQVVINGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETG--DFVSLCKNQKARK  435
             +TYSRCPL+A +W+YGNSFESFLVAVV+PERKA+EDWA+ N ++   DF SLC+N KA+K
Sbjct  538   NTYSRCPLIAQIWIYGNSFESFLVAVVVPERKAIEDWAKLNNQSSPNDFESLCQNLKAQK  597

Query  434   YILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
             Y LDELN+T K++QL+GFEML+AVHLEP  FDIERDL+TPTFKLKRPQLL +YK  IDQL
Sbjct  598   YFLDELNSTAKQYQLKGFEMLKAVHLEPNLFDIERDLITPTFKLKRPQLLKHYKSIIDQL  657

Query  254   YKEAK  240
             Y EAK
Sbjct  658   YTEAK  662



>ref|XP_009144978.1| PREDICTED: long chain acyl-CoA synthetase 2 [Brassica rapa]
 emb|CDY29350.1| BnaA05g16170D [Brassica napus]
Length=666

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 217/305 (71%), Positives = 249/305 (82%), Gaps = 3/305 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGL  +E    LDRL FDKIK A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMRKGLSQEEASPRLDRLMFDKIKDALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL-GTVPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGY+A  G V RGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYEAFSGDVARGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  VV++GWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVVINGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETG--DFVSLCKNQKARK  435
             +TYSRCPL+A +W+YGNSFESFLVAVV+PERKA+EDWA+ N ++   DF SLC+N KA+K
Sbjct  538   NTYSRCPLIAQIWIYGNSFESFLVAVVVPERKAIEDWAKLNNQSSPNDFESLCQNLKAQK  597

Query  434   YILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
             Y LDELN+T K++QL+GFEML+AVHLEP  FDIERDL+TPTFKLKRPQLL +YK  IDQL
Sbjct  598   YFLDELNSTAKQYQLKGFEMLKAVHLEPNLFDIERDLITPTFKLKRPQLLKHYKSIIDQL  657

Query  254   YKEAK  240
             Y EAK
Sbjct  658   YTEAK  662



>gb|KFK36012.1| hypothetical protein AALP_AA4G066600 [Arabis alpina]
Length=666

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 246/305 (81%), Gaps = 3/305 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGL  +E    LDRL FDKIK A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMRKGLSQEEASPRLDRLMFDKIKEALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL-GTVPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM  +EARL SVPEMGYDA  G V RGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPPVEARLVSVPEMGYDAFSGDVSRGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  VV+DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVVIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETG--DFVSLCKNQKARK  435
             +TYSRCPL+A +WVYGNSFESFLV VV+PERKA+EDWA+ N +    DF SLC+N KA+K
Sbjct  538   NTYSRCPLIAQIWVYGNSFESFLVGVVVPERKAIEDWAKLNNQPSPNDFESLCQNLKAQK  597

Query  434   YILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
             Y LDELN T K++QL+GFEML+++HLEP  FDIERDL+TPTFKLKRPQLL +YKD IDQL
Sbjct  598   YFLDELNATAKQYQLKGFEMLKSIHLEPNLFDIERDLITPTFKLKRPQLLQHYKDIIDQL  657

Query  254   YKEAK  240
             Y +AK
Sbjct  658   YADAK  662



>ref|NP_001148177.1| LOC100281785 [Zea mays]
 gb|ACG30068.1| acyl CoA synthetase [Zea mays]
 gb|ACR36229.1| unknown [Zea mays]
 gb|AFW65554.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=664

 Score =   423 bits (1087),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 211/302 (70%), Positives = 238/302 (79%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGLK  E   F D++ F KIK   GGR+RLM++GAAPLP   EEF+RVT   V  QG
Sbjct  357   NMRKGLKQHEASPFFDKIVFSKIKEGLGGRIRLMIAGAAPLPGQIEEFMRVTTCSVVVQG  416

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IAN+F M GT G P+TTIEARLESVPEMGYDAL   PRGEICLRG T
Sbjct  417   YGLTESCAGCFTSIANIFSMIGTVGPPVTTIEARLESVPEMGYDALSDTPRGEICLRGHT  476

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             +FSGY+KR  LT +V  DGWFHTGDIGEWQ +G MKIIDRKKNIFKLSQGEYVAVE LE 
Sbjct  477   MFSGYYKRPSLTEEVFSDGWFHTGDIGEWQSNGTMKIIDRKKNIFKLSQGEYVAVEVLER  536

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLVA+VWVYGNSFESFLVAV +PER+ALE+WA  N + GDF  LC + KAR Y+ 
Sbjct  537   AYLQSPLVASVWVYGNSFESFLVAVAVPERQALEEWAAANSKAGDFAELCADPKARTYVR  596

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             D+LN TGKK  LRGFEML+AV+LEP PF IE+DLVTPTFKLKRPQLL YYKD +DQ+YK+
Sbjct  597   DQLNQTGKKLGLRGFEMLKAVYLEPVPFSIEKDLVTPTFKLKRPQLLKYYKDRVDQMYKD  656

Query  245   AK  240
             AK
Sbjct  657   AK  658



>gb|ACL54548.1| unknown [Zea mays]
Length=662

 Score =   422 bits (1086),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 211/302 (70%), Positives = 238/302 (79%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGLK  E   F D++ F KIK   GGR+RLM++GAAPLP   EEF+RVT   V  QG
Sbjct  355   NMRKGLKQHEASPFFDKIVFSKIKEGLGGRIRLMIAGAAPLPGQIEEFMRVTTCSVVVQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  GCF  IAN+F M GT G P+TTIEARLESVPEMGYDAL   PRGEICLRG T
Sbjct  415   YGLTESCAGCFTSIANIFSMIGTVGPPVTTIEARLESVPEMGYDALSDTPRGEICLRGHT  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             +FSGY+KR  LT +V  DGWFHTGDIGEWQ +G MKIIDRKKNIFKLSQGEYVAVE LE 
Sbjct  475   MFSGYYKRPSLTEEVFSDGWFHTGDIGEWQSNGTMKIIDRKKNIFKLSQGEYVAVEVLER  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y + PLVA+VWVYGNSFESFLVAV +PER+ALE+WA  N + GDF  LC + KAR Y+ 
Sbjct  535   AYLQSPLVASVWVYGNSFESFLVAVAVPERQALEEWAAANSKAGDFAELCADPKARTYVR  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             D+LN TGKK  LRGFEML+AV+LEP PF IE+DLVTPTFKLKRPQLL YYKD +DQ+YK+
Sbjct  595   DQLNQTGKKLGLRGFEMLKAVYLEPVPFSIEKDLVTPTFKLKRPQLLKYYKDRVDQMYKD  654

Query  245   AK  240
             AK
Sbjct  655   AK  656



>ref|XP_006393257.1| hypothetical protein EUTSA_v10011292mg [Eutrema salsugineum]
 gb|ESQ30543.1| hypothetical protein EUTSA_v10011292mg [Eutrema salsugineum]
Length=666

 Score =   422 bits (1086),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 215/305 (70%), Positives = 245/305 (80%), Gaps = 3/305 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KGL  +E    LDRL FDKIK A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMRKGLSQEEASPRLDRLIFDKIKEALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL-GTVPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGYDA  G + RGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYDAFSGEMARGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  VV+DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVVIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE--TGDFVSLCKNQKARK  435
             + YSRCPL+A +W+YGNSFESFLV VV+PERKA+EDWA+ N +    DF SLC+N KA+K
Sbjct  538   NIYSRCPLIAQIWIYGNSFESFLVGVVVPERKAIEDWAKLNNQPSVNDFESLCQNLKAKK  597

Query  434   YILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
             Y LDELN+T K++QL+GFEML+AVHLEP  FDI RDL+TPTFKLKRPQLL +YK  IDQL
Sbjct  598   YFLDELNSTAKQYQLKGFEMLKAVHLEPNLFDIGRDLITPTFKLKRPQLLQHYKSIIDQL  657

Query  254   YKEAK  240
             Y EAK
Sbjct  658   YTEAK  662



>ref|XP_004507385.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X1 [Cicer 
arietinum]
Length=692

 Score =   422 bits (1085),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 219/331 (66%), Positives = 251/331 (76%), Gaps = 32/331 (10%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
              GL  D+     D+L FDKIK A GGRVR++LSGAAPL  + EEFLRVT G   +QGY L
Sbjct  358   NGLPQDKAAPLFDKLVFDKIKQALGGRVRILLSGAAPLSRNVEEFLRVTFGSSLAQGYGL  417

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+  GCF  I NVF M GT GVPMTTIEARLESVPEMGYDAL +  RGEICLRG TLFS
Sbjct  418   TETCAGCFASIFNVFSMIGTVGVPMTTIEARLESVPEMGYDALSSQARGEICLRGNTLFS  477

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GYHKR+DLT++V+VDGWFHTGDIGEW P+GAMK+IDRKKNIFKLSQGEYVAVE++E+ Y 
Sbjct  478   GYHKRQDLTQEVMVDGWFHTGDIGEWLPNGAMKVIDRKKNIFKLSQGEYVAVENIENKYL  537

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
             +CPL+ ++WVYGNSFESFLVAVV+PE++ALEDWA  +  + DF SLC N KARKYILDEL
Sbjct  538   QCPLITSIWVYGNSFESFLVAVVVPEKQALEDWAVKHDLSDDFKSLCGNLKARKYILDEL  597

Query  416   NNTGKKH--------------------------------QLRGFEMLRAVHLEPTPFDIE  333
             N TG+KH                                QLRGFE+++AVHLEP PFD+E
Sbjct  598   NITGQKHQVCKYNDDHVLNFWLLCYILISVITFDMIILSQLRGFELIKAVHLEPIPFDVE  657

Query  332   RDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             RDLVTPTFKLKRPQL  +YKDCIDQLY EAK
Sbjct  658   RDLVTPTFKLKRPQLQKHYKDCIDQLYNEAK  688



>ref|XP_010501911.1| PREDICTED: long chain acyl-CoA synthetase 2-like, partial [Camelina 
sativa]
Length=663

 Score =   419 bits (1077),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 209/293 (71%), Positives = 243/293 (83%), Gaps = 2/293 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG   +E    LDRL FDKIK AFGGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMKKGFSQEEASPRLDRLMFDKIKEAFGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT-VPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARL SVPEMGYDA    VPRGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLVSVPEMGYDAFSADVPRGEICLRGN  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQ-NNRETGDFVSLCKNQKARKY  432
             +TYSRCPL+A +W+YGNSFESFLV VV+P+RKA+EDWA+ NN+   DF SLC++ KA+KY
Sbjct  538   NTYSRCPLIAQIWIYGNSFESFLVGVVVPDRKAIEDWAKLNNQFPNDFESLCQDLKAQKY  597

Query  431   ILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYK  273
              LDELN+T K++QL+GFEML+A+HLEPTPFDIERDL+TPTFKLKRPQLL +YK
Sbjct  598   FLDELNSTAKQYQLKGFEMLKAIHLEPTPFDIERDLITPTFKLKRPQLLQHYK  650



>ref|XP_009345814.1| PREDICTED: long chain acyl-CoA synthetase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=641

 Score =   412 bits (1060),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 238/302 (79%), Gaps = 17/302 (6%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N EKGL  ++    LD+L FDKIK   GGRVRL+LSGAAPLP H EEFLRVT     SQG
Sbjct  353   NLEKGLPQEKAAPLLDKLVFDKIKQVLGGRVRLLLSGAAPLPRHVEEFLRVTSCSTLSQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES GGCF  I+NVFPM GT GVP+TTIEARLESVP MGYDAL + PRGEICLRG T
Sbjct  413   YGLTESCGGCFTSISNVFPMIGTVGVPVTTIEARLESVPAMGYDALSSAPRGEICLRGTT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT +V++DGWFHTGDIGEWQ DG+MKIIDRKKNI+KLSQGEYVAVE++E 
Sbjct  473   LFSGYHKREDLTEEVLIDGWFHTGDIGEWQADGSMKIIDRKKNIYKLSQGEYVAVENIEG  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +CPL+ ++WVYGNSFESFLVAVV+P+ KA+E WA  +  TGDF SLC+N K      
Sbjct  533   KYLQCPLITSIWVYGNSFESFLVAVVVPDSKAMEHWAAEHHLTGDFKSLCQNPK------  586

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
                        LRGFE+L+AVHLEP PFD+ERDL+TPTFKLKRPQL  YYKDCID+LY E
Sbjct  587   -----------LRGFELLKAVHLEPNPFDMERDLITPTFKLKRPQLHKYYKDCIDKLYSE  635

Query  245   AK  240
              K
Sbjct  636   GK  637



>gb|EMT18517.1| Fatty acyl-CoA synthetase B [Aegilops tauschii]
Length=656

 Score =   410 bits (1055),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 208/298 (70%), Positives = 236/298 (79%), Gaps = 14/298 (5%)
 Frame = -2

Query  1079  IKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtg  900
             IK   GGR+RLMLSGAAPLP H EEF+RVT   V +QGY LTES  GCF  IANV  M G
Sbjct  358   IKEGLGGRIRLMLSGAAPLPRHIEEFMRVTSCSVLAQGYGLTESCSGCFTSIANVISMIG  417

Query  899   tggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFH  720
             T G P+T +EARLESVPEMGYDAL + PRGEICLRG TLFSGY+KR DLT++V  DGWFH
Sbjct  418   TVGPPVTAVEARLESVPEMGYDALSSAPRGEICLRGHTLFSGYYKRPDLTKEVFSDGWFH  477

Query  719   TGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFL  540
             TGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE LES Y++  LVA+VWVYGNSFESFL
Sbjct  478   TGDIGEWQPDGTMKIIDRKKNIFKLSQGEYVAVEVLESAYAQSQLVASVWVYGNSFESFL  537

Query  539   VAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVH  360
             VAVV+PE++A+EDWA  N ++GD+  LC + KAR+YI DELN TGKK  LRGFEMLRAVH
Sbjct  538   VAVVVPEKQAIEDWAALNSKSGDYAELCSDPKARRYIQDELNQTGKKLGLRGFEMLRAVH  597

Query  359   LEPTPFDIERDLVTPTFKLKRPQLLNYYK--------------DCIDQLYKEAKNVSA  228
             LEP PF I++DL+TPTFKLKRPQLL YYK              + +DQLYK+AK  +A
Sbjct  598   LEPVPFSIDKDLITPTFKLKRPQLLKYYKLVVFAHRKNKIMPQNRVDQLYKDAKMGTA  655



>ref|XP_010910559.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Elaeis guineensis]
Length=431

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 233/302 (77%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG KH+E     D++ F+K+K   GGRVRL+LSGAAPL +H EEFLRV       QG
Sbjct  130   NMTKGSKHEEAAAIFDKIVFNKVKDGLGGRVRLILSGAAPLAIHVEEFLRVVTCAHVLQG  189

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F  + N   M GT G P+  ++ RLESVPEM YDAL  VPRGEIC+RG T
Sbjct  190   YGLTETCAGTFVSLPNNLSMLGTVGPPVPNVDVRLESVPEMNYDALSEVPRGEICVRGNT  249

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++ ++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+
Sbjct  250   LFSGYYKREDLTKEAMIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLEN  309

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y   P V ++W+YGNSFESFLVA+V P ++ALE WA+ N  +GDF ++C+N KA++YIL
Sbjct  310   VYGLVPDVDSIWIYGNSFESFLVAIVNPNKQALEHWAEVNGVSGDFSAICENPKAKEYIL  369

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             +EL    K+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K KRPQLL YY+  ID LYK 
Sbjct  370   EELTKAAKEKKLKGFEFIKAIHLDPEPFDMERDLLTPTYKKKRPQLLKYYQSVIDNLYKS  429

Query  245   AK  240
             AK
Sbjct  430   AK  431



>gb|KJB19004.1| hypothetical protein B456_003G080500 [Gossypium raimondii]
Length=662

 Score =   389 bits (998),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 236/311 (76%), Gaps = 0/311 (0%)
 Frame = -2

Query  1160  TTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGW  981
             T    N +KG KH E     D++ F K+K   GG VRL+LSGAAPL  H EEFLRV    
Sbjct  352   TYKYYNMKKGRKHGEASPICDKIVFSKVKQGLGGNVRLILSGAAPLSTHVEEFLRVVACC  411

Query  980   V*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEIC  801
                QGY LTES  G F  + N   M GT G P+  I+ RLESVPEM YDAL + PRGEIC
Sbjct  412   HVLQGYGLTESCAGSFVSLPNELSMLGTVGPPVPNIDVRLESVPEMNYDALASTPRGEIC  471

Query  800   LRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAV  621
             ++G TLFSGY+KREDLTR+V++DGWFHTGDIGEWQP+G+MKIIDRKKNIFKLSQGEYVAV
Sbjct  472   IKGNTLFSGYYKREDLTREVLIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAV  531

Query  620   ESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKA  441
             E+LE+ YS    + ++W+YGNSFESFLVAVV P ++ALE WA +N  +GDF SLCKN KA
Sbjct  532   ENLENIYSLVSAIDSIWIYGNSFESFLVAVVNPNKEALESWAADNNVSGDFESLCKNPKA  591

Query  440   RKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCID  261
             +++IL EL  TGK+ +L+GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL YY+  ID
Sbjct  592   KEFILGELAKTGKEKKLKGFEIIKAVHLDPMPFDMERDLLTPTYKKKRPQLLKYYQSVID  651

Query  260   QLYKEAKNVSA  228
             ++YK A   +A
Sbjct  652   EMYKSANKPNA  662



>ref|XP_006644526.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Oryza brachyantha]
Length=581

 Score =   384 bits (987),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 238/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG +H+E     D+L F K+K   GGRVRL+LSGAAPL  H EEF
Sbjct  267   TLFGVAYKYKQGNMVKGSRHEEAAAIFDKLVFTKVKRGLGGRVRLILSGAAPLSNHVEEF  326

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV    +  QGY LTE+  G F  + N   M GT G P+  +E RLESVPEMGYDAL  
Sbjct  327   LRVVTCSLVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVRLESVPEMGYDALSK  386

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGY+KR+DLT++V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFKL
Sbjct  387   ESPRGEICIRGDTLFSGYYKRDDLTKEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFKL  446

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAVV P ++ALE WA++N  TGD  
Sbjct  447   SQGEYVAVENLENIFGQAPGVDSIWVYGNSFESCLVAVVNPNKQALERWAESNGVTGDIT  506

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             S+C+N KA+++IL EL  TGK+ +L+GFE++RAVHLEP PFD++RDL+TPT+K KRPQLL
Sbjct  507   SICENPKAKEFILGELTKTGKEKKLKGFELIRAVHLEPVPFDMDRDLITPTYKKKRPQLL  566

Query  284   NYYKDCIDQLYKEAK  240
              YY+  ID +YK  K
Sbjct  567   KYYQSVIDNMYKNMK  581



>gb|ABA00144.1| ACS-like protein [Gossypium hirsutum]
Length=662

 Score =   387 bits (994),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 235/311 (76%), Gaps = 0/311 (0%)
 Frame = -2

Query  1160  TTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGW  981
             T    N +KG KH E     D++ F K+K   GG VRL+LSGAAPL  H EEFLRV    
Sbjct  352   TYKYYNMKKGRKHGEASPICDKIVFSKVKQGLGGNVRLILSGAAPLSTHVEEFLRVVACC  411

Query  980   V*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEIC  801
                QGY LTES  G F  + N   M GT G P+  I+ RLESVPEM YDAL + PRGEIC
Sbjct  412   HVLQGYGLTESCAGSFVSLPNELSMLGTVGPPVPNIDVRLESVPEMNYDALASTPRGEIC  471

Query  800   LRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAV  621
             ++G TLFSGY+KREDLTR+V++DGWFHTGDIGEWQP+G+MKIIDRKKNIFKLSQGEYVAV
Sbjct  472   IKGNTLFSGYYKREDLTREVLIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAV  531

Query  620   ESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKA  441
             E+LE+ Y     + ++W+YGNSFESFLVAVV P ++ALE WA +N  +GDF SLCKN KA
Sbjct  532   ENLENIYGLVSAIDSIWIYGNSFESFLVAVVNPNKEALESWAADNNVSGDFESLCKNPKA  591

Query  440   RKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCID  261
             +++IL EL  TGK+ +L+GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL YY+  ID
Sbjct  592   KEFILGELAKTGKEKKLKGFEIIKAVHLDPMPFDMERDLLTPTYKKKRPQLLKYYQSVID  651

Query  260   QLYKEAKNVSA  228
             ++YK A   +A
Sbjct  652   EMYKSANKPNA  662



>ref|XP_009404490.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   385 bits (989),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 231/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG KH+E     D++ F K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  354   NMSKGQKHEEAAPIFDKIVFSKVKQGLGGNVRIILSGAAPLATHVETFLRVVSCAHVIQG  413

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F  + N F M GT G P+  ++ RLESVPEMGYDAL T PRGE+C+RG T
Sbjct  414   YGLTETCAGTFVSVPNEFSMLGTVGPPVPNVDVRLESVPEMGYDALSTTPRGEVCIRGST  473

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGWFHTGDIGEWQPDG++KIIDRKKNIFKLSQGEYVAVE+LES
Sbjct  474   LFSGYYKREDLTKEVMIDGWFHTGDIGEWQPDGSLKIIDRKKNIFKLSQGEYVAVENLES  533

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y   P + ++W+YGNSFESFLVAVV P ++ALE WA+    TGDF +LC+N KA++YIL
Sbjct  534   IYGLVPTIDSIWIYGNSFESFLVAVVNPNQQALERWAEEKGVTGDFAALCENSKAKEYIL  593

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
             +E+    K  +L+GFE++RA+HLEP PFD++RDL+TPT+K KRPQ+L YY+  I+ LY+ 
Sbjct  594   EEITKVAKSKKLKGFEIIRALHLEPIPFDMDRDLLTPTYKKKRPQMLKYYQSVINSLYES  653

Query  245   AK  240
             AK
Sbjct  654   AK  655



>ref|XP_003530131.1| PREDICTED: long chain acyl-CoA synthetase 2-like [Glycine max]
Length=227

 Score =   370 bits (949),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -2

Query  875  IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
            IEARLESVPEMGYDAL  VPRGEICLRG TLF GYHKREDLT++V+VDGWFHTGDIGEWQ
Sbjct  12   IEARLESVPEMGYDALSNVPRGEICLRGNTLFFGYHKREDLTKEVMVDGWFHTGDIGEWQ  71

Query  695  PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
             + AMKIIDRKKN+FKLSQGEY+AVE++E+ Y +CPL+A++WVYGN+FESFLVAVV+PER
Sbjct  72   SNRAMKIIDRKKNLFKLSQGEYIAVENIENKYLQCPLIASIWVYGNNFESFLVAVVVPER  131

Query  515  KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
            KA+EDWA+ +  T DF SLC N KARK+ILDELNNTG+KHQLRGFE+L+A+HLEP PFDI
Sbjct  132  KAIEDWAKEHNLTDDFKSLCNNLKARKHILDELNNTGQKHQLRGFELLKAIHLEPNPFDI  191

Query  335  ERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
            E+DL+TPTFKLKRPQLL YYKD IDQLYKEAK
Sbjct  192  EKDLITPTFKLKRPQLLKYYKDHIDQLYKEAK  223



>ref|XP_003569480.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Brachypodium 
distachyon]
Length=657

 Score =   384 bits (986),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 240/316 (76%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++T+ ++     +    +G KH+E     D++ F K+K   GG VR++LSGAAPL  H E
Sbjct  342   KSTMFSLAYKFKQFRMMRGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVE  401

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             E+LRV       QGY LTE+  G F  + N   M GT G P+  I+ARLESVPEM YDAL
Sbjct  402   EYLRVVTCAHVLQGYGLTETCAGSFVSLPNQMSMIGTVGPPVPNIDARLESVPEMNYDAL  461

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
              + PRGEIC++G+TLFSGY++REDLT++V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  462   ASTPRGEICIKGETLFSGYYRREDLTQEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  521

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ALE WA+ N  +GDF
Sbjct  522   LSQGEYVAVENLENIYGVVSAIDSIWVYGNSFESFLVAVVNPNKEALESWAEGNGISGDF  581

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              +LC+N KA++YIL EL+ TGK+ +L+GFE +RAVHL+P PFD+ERDL+TPT+K KRPQL
Sbjct  582   EALCENPKAKEYILGELSKTGKEKKLKGFEFIRAVHLDPVPFDMERDLITPTYKRKRPQL  641

Query  287   LNYYKDCIDQLYKEAK  240
             L YY+  ID +YK AK
Sbjct  642   LKYYQGIIDNMYKSAK  657



>emb|CDP12153.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   384 bits (985),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 234/303 (77%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN  KGLKHDE     D++ F K+K   GG+VRL+LSGAAPL  H EE+LRV       Q
Sbjct  356   RNLRKGLKHDEAAPICDKIVFSKVKQGLGGKVRLILSGAAPLASHVEEYLRVVSCAHVLQ  415

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTE+  G F  I +   M GT G P+  ++A LESVPEMGYDAL   PRGE+C+RG 
Sbjct  416   GYGLTETCAGTFVSIPHEMRMLGTVGPPVPNVDACLESVPEMGYDALSRTPRGEVCVRGD  475

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KREDLT++V  DGWFHTGD+GEWQP+G++KIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  476   TLFSGYYKREDLTKEVFEDGWFHTGDVGEWQPNGSLKIIDRKKNIFKLSQGEYVAVENLE  535

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + Y     + ++WVYGNSFES+LVAVV P+++A+E+WAQ N  TGDF SLC+N K ++YI
Sbjct  536   NVYGLVSAIDSIWVYGNSFESYLVAVVNPKKQAVEEWAQENELTGDFNSLCENPKVKEYI  595

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L ELN  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPTFK KRPQLL YY++ ID +YK
Sbjct  596   LGELNKIGKEKKLKGFEFIKAVHLDPEPFDMERDLLTPTFKKKRPQLLKYYQNVIDNMYK  655

Query  248   EAK  240
              AK
Sbjct  656   SAK  658



>ref|XP_003610999.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid-CoA 
ligase [Medicago truncatula]
Length=435

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
              N +KG  H      LD++ FDK+K   GG VRL+LSGAAPL +H E +LRV       Q
Sbjct  129   NNMKKGQNHAVASPLLDKIVFDKVKQGLGGSVRLILSGAAPLSLHVESYLRVVSCAHVLQ  188

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTE+  G F  + N   M GT G P+  ++A LESVPEMGYDAL + PRGEIC++G 
Sbjct  189   GYGLTETCAGTFVSLPNELDMLGTVGPPVPNVDACLESVPEMGYDALASTPRGEICVKGD  248

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KREDLT++V+V+GWFHTGDIGEWQP+G+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  249   TLFSGYYKREDLTKEVLVEGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENLE  308

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + YS+ P V ++WVYGNSFE+FLV VV P + ALE WA+ N  + DF SLC + +A+ YI
Sbjct  309   NIYSQVPSVESIWVYGNSFEAFLVTVVTPSKPALEHWAEENGISMDFNSLCGDSRAKSYI  368

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L+EL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL YY++ ID +YK
Sbjct  369   LEELSKIGKEKKLKGFEFIKAVHLDPVPFDMERDLITPTYKKKRPQLLKYYQNVIDDMYK  428

Query  248   EA  243
               
Sbjct  429   SG  430



>ref|NP_001043879.1| Os01g0681200 [Oryza sativa Japonica Group]
 dbj|BAF05793.1| Os01g0681200 [Oryza sativa Japonica Group]
 gb|EEE55183.1| hypothetical protein OsJ_03021 [Oryza sativa Japonica Group]
Length=665

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 238/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH+E     D+L F K+K   GGRVRL+LSGAAPL  H EE+
Sbjct  351   TLFNVAYKYKQGNMVKGSKHEEAAAMFDKLVFTKVKRGLGGRVRLILSGAAPLSNHVEEY  410

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV    +  QGY LTE+  G F  + N   M GT G P+  +E  LESVPEMGYDAL  
Sbjct  411   LRVVTCSLVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVHLESVPEMGYDALSK  470

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGYHKREDLT++V+VDGWFHTGDIGEWQ DG+MKIIDRKKNIFKL
Sbjct  471   ESPRGEICIRGDTLFSGYHKREDLTKEVLVDGWFHTGDIGEWQSDGSMKIIDRKKNIFKL  530

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAVV P ++ALE WA++N  TGDF 
Sbjct  531   SQGEYVAVENLENIFGQAPGVDSIWVYGNSFESCLVAVVNPNKQALERWAESNGVTGDFA  590

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             ++C++ KA+++IL EL  TGK+ +L+GFE++RAVHLEP PFD++RDL+TPT+K KRPQLL
Sbjct  591   TMCEDPKAKEFILGELTKTGKEKKLKGFELIRAVHLEPVPFDMDRDLITPTYKKKRPQLL  650

Query  284   NYYKDCIDQLYKEAK  240
              YY++ ID +YK  K
Sbjct  651   KYYQNVIDSMYKNMK  665



>dbj|BAD73757.1| putative acyl-CoA synthetase [Oryza sativa Japonica Group]
Length=660

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 238/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH+E     D+L F K+K   GGRVRL+LSGAAPL  H EE+
Sbjct  346   TLFNVAYKYKQGNMVKGSKHEEAAAMFDKLVFTKVKRGLGGRVRLILSGAAPLSNHVEEY  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV    +  QGY LTE+  G F  + N   M GT G P+  +E  LESVPEMGYDAL  
Sbjct  406   LRVVTCSLVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVHLESVPEMGYDALSK  465

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGYHKREDLT++V+VDGWFHTGDIGEWQ DG+MKIIDRKKNIFKL
Sbjct  466   ESPRGEICIRGDTLFSGYHKREDLTKEVLVDGWFHTGDIGEWQSDGSMKIIDRKKNIFKL  525

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAVV P ++ALE WA++N  TGDF 
Sbjct  526   SQGEYVAVENLENIFGQAPGVDSIWVYGNSFESCLVAVVNPNKQALERWAESNGVTGDFA  585

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             ++C++ KA+++IL EL  TGK+ +L+GFE++RAVHLEP PFD++RDL+TPT+K KRPQLL
Sbjct  586   TMCEDPKAKEFILGELTKTGKEKKLKGFELIRAVHLEPVPFDMDRDLITPTYKKKRPQLL  645

Query  284   NYYKDCIDQLYKEAK  240
              YY++ ID +YK  K
Sbjct  646   KYYQNVIDSMYKNMK  660



>emb|CDM82121.1| unnamed protein product [Triticum aestivum]
Length=658

 Score =   382 bits (981),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             +G KH+E     D++ F K+K   GG VR++LSGAAPL  H EE+LRV       QGY L
Sbjct  360   RGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVEEYLRVVTCAHVLQGYGL  419

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+  G F  + N   M GT G P+  I+ARLESVP+M YDAL + PRGEIC++G+TLFS
Sbjct  420   TETCAGSFVSLPNQMSMIGTVGPPVPNIDARLESVPDMNYDALASTPRGEICIKGETLFS  479

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY++REDLT +V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+ Y 
Sbjct  480   GYYRREDLTEEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLENIYG  539

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 + ++WVYGNSFESFLVAVV P ++ALE WA+ N  +GDF +LC+N KA++YIL EL
Sbjct  540   VVSAIDSIWVYGNSFESFLVAVVNPNKEALESWAEANGISGDFEALCENPKAKEYILGEL  599

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             + TGK+ +L+GFE +RAVHL+P PFD+ERDL+TPT+K KRPQLL YY+  ID +YK AK
Sbjct  600   SKTGKEKKLKGFEFIRAVHLDPVPFDMERDLITPTYKRKRPQLLKYYQGAIDNMYKSAK  658



>gb|KHN06160.1| Long chain acyl-CoA synthetase 2 [Glycine soja]
Length=224

 Score =   367 bits (941),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -2

Query  875  IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
            IEARLESVPEMGYDAL +  RGEICLRG TLFSGYHK +DLT +V+VDGWFHTGDIGEWQ
Sbjct  12   IEARLESVPEMGYDALSSEARGEICLRGNTLFSGYHKHQDLTEEVMVDGWFHTGDIGEWQ  71

Query  695  PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
            P+GAMKIIDRKKNIFKLSQGEYVAVE++E+ Y +CPL+ ++WV+GNSFESFLVAVV+PER
Sbjct  72   PNGAMKIIDRKKNIFKLSQGEYVAVENIENKYLQCPLITSIWVHGNSFESFLVAVVVPER  131

Query  515  KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
            K LE WA  +  T DF SLC+N KARKYILDELNNTG+KHQLRGFE+L+AVHLEP PFD+
Sbjct  132  KGLEYWAVKHNSTDDFKSLCENPKARKYILDELNNTGQKHQLRGFELLKAVHLEPIPFDM  191

Query  335  ERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
            ERDL+TPTFKLKRPQLL  YK+CIDQLYKEAK
Sbjct  192  ERDLITPTFKLKRPQLLKQYKECIDQLYKEAK  223



>ref|XP_009780452.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana sylvestris]
Length=657

 Score =   381 bits (979),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 190/329 (58%), Positives = 242/329 (74%), Gaps = 2/329 (1%)
 Frame = -2

Query  1235  YAHAQRIIYWRGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGR  1056
             Y+  Q+ I    G R ++TL  +       N +KG KH E     D++ F K+K   GG+
Sbjct  329   YSGLQQKI--SSGGRLKSTLFNLAYAYKHYNLKKGRKHFEASPLSDKVVFSKVKEGLGGK  386

Query  1055  VRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtT  876
             VRL+LSGAAPL  H E FLRV       QGY LTE+  G F  + N + M GT G P+  
Sbjct  387   VRLILSGAAPLAAHVEAFLRVVACCHVLQGYGLTETCAGTFVSLPNQYDMLGTVGPPVPN  446

Query  875   IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
             ++  LESVPEM YDAL + PRGE+C+RG TLFSGY+KREDLT++V++DGWFHTGDIGEWQ
Sbjct  447   VDVCLESVPEMAYDALSSTPRGEVCVRGDTLFSGYYKREDLTKEVMIDGWFHTGDIGEWQ  506

Query  695   PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
             P+G++KIIDRKKNIFKLSQGEYVAVE+LE+ Y   P++ ++W+YGNSFESFLVAV+ P +
Sbjct  507   PNGSLKIIDRKKNIFKLSQGEYVAVENLENIYGNNPVIDSIWIYGNSFESFLVAVLNPNQ  566

Query  515   KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
             +A+E WAQ N  +GDF SLC+N K ++YIL EL   GK+ +L+GFE ++AVHL+P PFD+
Sbjct  567   RAVEQWAQQNGVSGDFDSLCENPKVKEYILGELTKAGKEKKLKGFEFIKAVHLDPQPFDM  626

Query  335   ERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             ERDL+TPTFK KRPQLL YYKD ID +YK
Sbjct  627   ERDLLTPTFKKKRPQLLKYYKDVIDSMYK  655



>gb|EMT28835.1| Fatty acyl-CoA synthetase A [Aegilops tauschii]
Length=669

 Score =   382 bits (980),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             +G KH+E     D++ F K+K   GG VR++LSGAAPL  H EE+LRV       QGY L
Sbjct  371   RGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVEEYLRVVTCAHVLQGYGL  430

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+  G F  + N   M GT G P+  I+ARLESVP+M YDAL + PRGEIC++G+TLFS
Sbjct  431   TETCAGSFVSLPNQMSMIGTVGPPVPNIDARLESVPDMNYDALASTPRGEICIKGETLFS  490

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY++REDLT +V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+ Y 
Sbjct  491   GYYRREDLTEEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLENIYG  550

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 + ++WVYGNSFESFLVAVV P ++ALE WA+ N  +GDF +LC+N KA++YIL EL
Sbjct  551   VVSAIDSIWVYGNSFESFLVAVVNPNKEALESWAEGNGISGDFEALCENPKAKEYILGEL  610

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             + TGK+ +L+GFE +RAVHL+P PFD+ERDL+TPT+K KRPQLL YY+  ID +YK AK
Sbjct  611   SKTGKEKKLKGFEFIRAVHLDPVPFDMERDLITPTYKRKRPQLLKYYQGAIDNMYKSAK  669



>ref|XP_010676297.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=659

 Score =   381 bits (978),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 233/322 (72%), Gaps = 0/322 (0%)
 Frame = -2

Query  1205  RGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAP  1026
             R G   + TL     +    N +KG KH +     D++ F K+K A GG+VRL+LSGAAP
Sbjct  338   RAGGLLKRTLFGFAYSRKFNNMKKGTKHSDAAPIFDKIVFSKVKEALGGKVRLILSGAAP  397

Query  1025  LPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPE  846
             L  H E FLRV       QGY LTE+  G F  + N   M GT G P+  I+ RLESVPE
Sbjct  398   LASHVETFLRVVACCYVLQGYGLTETCAGSFVSLPNEVQMIGTVGPPVANIDVRLESVPE  457

Query  845   MGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDR  666
             MGYDA  + PRGEIC++GKTLF GYHKREDLT++V+ DGWFHTGD+GEWQPDG+MKIIDR
Sbjct  458   MGYDAHASTPRGEICIKGKTLFKGYHKREDLTKEVMTDGWFHTGDVGEWQPDGSMKIIDR  517

Query  665   KKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNN  486
             KKNIFKLSQGEYVAVE+LE+ +  C  V ++W+YGNSF+SFLVAV  P + ALE WAQ N
Sbjct  518   KKNIFKLSQGEYVAVENLENIFGLCSAVDSIWIYGNSFQSFLVAVANPNQGALERWAQAN  577

Query  485   RETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFK  306
                GDF +LC+N KA+ YIL EL   GK+ +L+GFE++R++HL+P PFDIERDL+TPT+K
Sbjct  578   EIDGDFKTLCENPKAKDYILGELTKIGKEKKLKGFELIRSIHLDPMPFDIERDLLTPTYK  637

Query  305   LKRPQLLNYYKDCIDQLYKEAK  240
              KRPQ+L YY+  ID +YK  K
Sbjct  638   KKRPQMLKYYQSIIDDMYKATK  659



>ref|XP_008791425.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Phoenix dactylifera]
Length=655

 Score =   381 bits (978),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 187/316 (59%), Positives = 236/316 (75%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +       N  KG KH+E     D++ F K+K   GGRVRL+LSGAAPL +H E
Sbjct  340   KSTLFNIAYKYKFYNMMKGSKHEEAATIADKIVFKKVKDGLGGRVRLILSGAAPLAIHVE  399

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             EFLRV       QGY LTE+  G F  + N   M GT G P+  ++ RLESVPEM YDAL
Sbjct  400   EFLRVVTCAHVLQGYGLTETCAGTFVSLPNDLSMLGTVGPPVPNVDVRLESVPEMNYDAL  459

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
               VPRGEIC+RG TLFSGY+KREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  460   SEVPRGEICVRGNTLFSGYYKREDLTKEVMIDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  519

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y   P V ++W+YGNSFESFLVA+V P ++ALE WA+ N  +GDF
Sbjct  520   LSQGEYVAVENLENVYGLVPDVDSIWIYGNSFESFLVAIVNPNKQALEHWAEVNGVSGDF  579

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              ++C+N KA++YIL EL    K+ +L+GFE ++A+H++P PFD++RDL+TPT+K KRPQL
Sbjct  580   SAICENNKAKEYILGELTKAAKEKKLKGFEFIKAIHMDPEPFDMDRDLLTPTYKKKRPQL  639

Query  287   LNYYKDCIDQLYKEAK  240
             L YY+  ID LYK  K
Sbjct  640   LKYYQGVIDSLYKSVK  655



>ref|XP_006644462.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Oryza brachyantha]
Length=607

 Score =   379 bits (972),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/316 (59%), Positives = 235/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +     +    +G KH+E     D++ F K+K   GG VR++LSGAAPL  H E
Sbjct  292   KSTLFNLAYKFKQFRMMQGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVE  351

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             E+LRV       QGY LTE+  G F  + N   M GT G P+  I+ RLESVPEM YDAL
Sbjct  352   EYLRVVTCAHVLQGYGLTETCAGSFVSLPNQMCMIGTVGPPVPNIDVRLESVPEMDYDAL  411

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
              T PRGEIC+RG+TLFSGY+KREDLT+DV++DGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  412   ATRPRGEICIRGETLFSGYYKREDLTKDVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  471

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ALE WA  N   GDF
Sbjct  472   LSQGEYVAVENLENIYGLVSAIDSIWVYGNSFESFLVAVVNPNKEALETWAAANGVCGDF  531

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              +LC+N KA++YIL EL+  GK+ +L+GFE ++AVHLEP PFD++RDL+TPT+K KRPQL
Sbjct  532   EALCENPKAKEYILGELSKVGKEKKLKGFEFIKAVHLEPVPFDMDRDLITPTYKKKRPQL  591

Query  287   LNYYKDCIDQLYKEAK  240
             L YY+  ID +Y+ AK
Sbjct  592   LKYYQGTIDNMYRSAK  607



>ref|XP_008788745.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Phoenix dactylifera]
Length=655

 Score =   380 bits (975),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 230/303 (76%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
              N ++G KHDE     D++ F+K+K AFGG VRL+LSGAAPL  H E FLRV       Q
Sbjct  353   HNMKRGSKHDEASPVFDKIVFNKVKQAFGGNVRLILSGAAPLATHVEAFLRVVTCAHVLQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTE+  G F  + N F M GT G P+  ++ RLESVPEMGYDAL ++PRGEIC+RGK
Sbjct  413   GYGLTETCAGTFVSLPNDFAMVGTVGPPVPNVDVRLESVPEMGYDALSSIPRGEICIRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KREDLT +V++DGWFHTGDIGEWQPDG +KIIDRKKNIFKLSQGEYVA E+LE
Sbjct  473   TLFSGYYKREDLTNEVMIDGWFHTGDIGEWQPDGNLKIIDRKKNIFKLSQGEYVAAENLE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + Y   P +  +W+YGNSFESFLVA+V P ++ALE+WA  N  + DF +LC+N KA++YI
Sbjct  533   NIYGLVPDIDFIWIYGNSFESFLVAIVNPNKQALENWAGENGISEDFPALCENPKAKEYI  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L EL    K  +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL YY+  I+ LYK
Sbjct  593   LGELTKIAKAKKLKGFEFIKAVHLDPVPFDMERDLLTPTYKKKRPQLLKYYQTVINSLYK  652

Query  248   EAK  240
               K
Sbjct  653   STK  655



>gb|AES93957.2| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=536

 Score =   375 bits (964),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
              N +KG  H      LD++ FDK+K   GG VRL+LSGAAPL +H E +LRV       Q
Sbjct  230   NNMKKGQNHAVASPLLDKIVFDKVKQGLGGSVRLILSGAAPLSLHVESYLRVVSCAHVLQ  289

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTE+  G F  + N   M GT G P+  ++A LESVPEMGYDAL + PRGEIC++G 
Sbjct  290   GYGLTETCAGTFVSLPNELDMLGTVGPPVPNVDACLESVPEMGYDALASTPRGEICVKGD  349

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KREDLT++V+V+GWFHTGDIGEWQP+G+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  350   TLFSGYYKREDLTKEVLVEGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENLE  409

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + YS+ P V ++WVYGNSFE+FLV VV P + ALE WA+ N  + DF SLC + +A+ YI
Sbjct  410   NIYSQVPSVESIWVYGNSFEAFLVTVVTPSKPALEHWAEENGISMDFNSLCGDSRAKSYI  469

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L+EL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL YY++ ID +YK
Sbjct  470   LEELSKIGKEKKLKGFEFIKAVHLDPVPFDMERDLITPTYKKKRPQLLKYYQNVIDDMYK  529

Query  248   EA  243
               
Sbjct  530   SG  531



>ref|XP_009626045.1| PREDICTED: long chain acyl-CoA synthetase 4 [Nicotiana tomentosiformis]
Length=657

 Score =   379 bits (974),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 236/313 (75%), Gaps = 0/313 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +       N +KG KH E     D++ F K+K   GG+VRL+LSGAAPL  H E
Sbjct  343   KSTLFNLAYAYKHHNLKKGRKHFEASPLSDKVVFSKVKEGLGGKVRLILSGAAPLAAHVE  402

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
              FLRV       QGY LTE+  G F  + N + M GT G P+  ++  LESVPEM YDAL
Sbjct  403   AFLRVVACCHVLQGYGLTETCAGTFVSLPNQYDMLGTVGPPVPNVDVCLESVPEMAYDAL  462

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
              + PRGE+C+RG TLFSGY+KREDLT++V++DGWFHTGDIGEWQP+G++KIIDRKKNIFK
Sbjct  463   SSTPRGEVCVRGDTLFSGYYKREDLTKEVMIDGWFHTGDIGEWQPNGSLKIIDRKKNIFK  522

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y   P++ ++W+YGNSFESFLVAV+ P ++A+E WAQ+N  +GDF
Sbjct  523   LSQGEYVAVENLENIYGNNPVIDSIWIYGNSFESFLVAVLNPNQRAVEQWAQHNGVSGDF  582

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              SLC+N K ++YIL EL   GK+ +L+GFE ++AVHL+P PFD+ERDL+TPTFK KRPQL
Sbjct  583   DSLCENPKVKEYILGELTKAGKEKKLKGFEFIKAVHLDPQPFDMERDLLTPTFKKKRPQL  642

Query  287   LNYYKDCIDQLYK  249
             L YYKD ID +YK
Sbjct  643   LKYYKDVIDNMYK  655



>ref|XP_009108204.1| PREDICTED: long chain acyl-CoA synthetase 5 [Brassica rapa]
Length=666

 Score =   379 bits (974),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 231/306 (75%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H E   F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVEAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP+M YDALG++PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFVTFPDELDMLGTVGPPVPNVDIRLESVPDMEYDALGSIPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V++DGWFHTGD+GEWQPDG+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYHKREDLTKEVLIDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + ++WVYGNSFESFL+AV  P ++ LE WA  N   GDF S+C+N KA+ ++L
Sbjct  538   VYGQVEAIDSIWVYGNSFESFLIAVANPSQQTLERWAAENGVNGDFDSICQNTKAKAFLL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K+ +L+GFE++RAVHLEP PFDIERDL+TPT+K KRPQLL YY++ ID +YK 
Sbjct  598   GELVKTAKERKLKGFEIIRAVHLEPVPFDIERDLLTPTYKKKRPQLLKYYQNVIDDMYKT  657

Query  245   AKNVSA  228
             AK   A
Sbjct  658   AKEGQA  663



>ref|XP_003579030.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Brachypodium 
distachyon]
Length=672

 Score =   379 bits (974),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 237/315 (75%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH++     DRL F K+K   GGRVR++LSGAAPL  H EEF
Sbjct  358   TLFNVAYKYKQGNMIKGTKHEDAAAIFDRLVFTKVKRGLGGRVRIILSGAAPLSNHVEEF  417

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  +EARLESVPEMGYDAL  
Sbjct  418   LRVVTCSHVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEARLESVPEMGYDALSE  477

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGY+KREDLT++V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFKL
Sbjct  478   ESPRGEICIRGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFKL  537

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAV+ P ++ LE WA++N  TGDF 
Sbjct  538   SQGEYVAVENLENIFGQAPNVDSIWVYGNSFESCLVAVINPNKQGLERWAESNGVTGDFA  597

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             S+C + KA+++IL+EL+ TGK+ +L+GFEM+R VHLEP  FD+ERDL+TPT+K KRPQLL
Sbjct  598   SICGHPKAKEFILEELSKTGKEKKLKGFEMIRTVHLEPVLFDLERDLITPTYKKKRPQLL  657

Query  284   NYYKDCIDQLYKEAK  240
              YY+  ID +Y+  K
Sbjct  658   KYYQTIIDDMYQSMK  672



>ref|XP_003610997.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid-CoA 
ligase [Medicago truncatula]
 gb|AES93955.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=662

 Score =   379 bits (973),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 235/318 (74%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KG  H      LD++ FDK+K   GG VRL+LSGAAPL +H E +
Sbjct  345   TLFNFAYSYKLNNMKKGQNHAVASPLLDKIVFDKVKQGLGGSVRLILSGAAPLSLHVESY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++A LESVPEMGYDAL +
Sbjct  405   LRVVTCAHVLQGYGLTETCAGTFVSLPNELDMLGTVGPPVPNVDACLESVPEMGYDALAS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++G TLFSGY+KREDLT++V+VDGWFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICVKGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS+ P V ++WVYGNSFE+FLVAVV P + ALE WA+ N  + DF S
Sbjct  525   QGEYVAVENLENIYSQVPSVESIWVYGNSFEAFLVAVVNPSKPALEHWAEENGISVDFNS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC + +A+ YILDEL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCGDSRAKGYILDELSKIGKEKKLKGFEFIKAVHLDPVPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY++ ID +YK      A
Sbjct  645   YYQNVIDDMYKSGNKPRA  662



>ref|XP_010053129.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Eucalyptus 
grandis]
 gb|KCW77380.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
 gb|KCW77381.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
Length=659

 Score =   379 bits (973),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 236/318 (74%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    +  KG K+ E     DR  F+K+K   GG VRL+LSGAAPL  H E F
Sbjct  342   TLFNFAYSYKLNSLRKGNKYGEAAPLFDRFVFNKVKQGLGGNVRLILSGAAPLSNHVEAF  401

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL +
Sbjct  402   LRVVTCAHVLQGYGLTETCAGTFVSLPNAHSMLGTVGPPVPNVDVCLESVPEMGYDALSS  461

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++GKTLFSGYHKREDLT++VVVDGWFHTGD+GEWQPDG+++IIDRKKNIFKLS
Sbjct  462   TPRGEVCVKGKTLFSGYHKREDLTKEVVVDGWFHTGDVGEWQPDGSLRIIDRKKNIFKLS  521

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++W+YG+SFESFLVAVV P ++ALE WAQ N  +GDF S
Sbjct  522   QGEYVAVENLENIYDLVSAIDSIWIYGSSFESFLVAVVNPNKEALEKWAQENGVSGDFNS  581

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N KA+++I+ EL  TGK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  582   LCENPKAKEFIIGELAKTGKEKKLKGFEFIKAVHLDPVPFDMERDLLTPTYKKKRPQLLK  641

Query  281   YYKDCIDQLYKEAKNVSA  228
             YYKD ID++Y+ A   SA
Sbjct  642   YYKDVIDKMYESANKPSA  659



>emb|CDX86825.1| BnaA09g22150D [Brassica napus]
Length=666

 Score =   379 bits (973),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 231/306 (75%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H E   F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVEAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP+M YDALG++PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFVTFPDELDMLGTVGPPVPNVDIRLESVPDMEYDALGSIPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V++DGWFHTGD+GEWQPDG+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYHKREDLTKEVLIDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + ++WVYGNSFESFL+AV  P ++ LE WA  N   GDF S+C+N KA+ ++L
Sbjct  538   VYGQVEAIDSIWVYGNSFESFLIAVANPSQQTLERWAAENGVNGDFDSICQNTKAKAFLL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K+ +L+GFE++RAVHLEP PFDIERDL+TPT+K KRPQLL YY++ ID +YK 
Sbjct  598   GELVKTAKERKLKGFEIIRAVHLEPVPFDIERDLLTPTYKKKRPQLLKYYQNVIDDMYKT  657

Query  245   AKNVSA  228
             AK   A
Sbjct  658   AKEGQA  663



>ref|XP_004969552.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X2 [Setaria 
italica]
Length=662

 Score =   379 bits (972),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 239/315 (76%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH+E     D++ F K+K   GGRVRL+LSGAAPL  H EE+
Sbjct  348   TLFNVAYKYKQGNMLKGSKHEEAAAVFDKVVFSKVKQGLGGRVRLILSGAAPLSRHVEEY  407

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  +E RLESVPEMGYDAL +
Sbjct  408   LRVVTCSHVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVRLESVPEMGYDALSS  467

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
              +PRGEIC+RG TLFSGY+KREDLT++V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFKL
Sbjct  468   EMPRGEICIRGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFKL  527

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V +VWVYGNSFES LVAVV P ++ALE WA++N  TG+F 
Sbjct  528   SQGEYVAVENLENIFGQTPGVDSVWVYGNSFESSLVAVVNPNKQALERWAESNGVTGEFA  587

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             ++C++ KA+++IL EL   GK+ +L+GFE++RAVHL+P PFD+ERDL+TPT+K KRPQLL
Sbjct  588   TICEDPKAKEFILGELTKMGKEKKLKGFELIRAVHLDPVPFDMERDLITPTYKKKRPQLL  647

Query  284   NYYKDCIDQLYKEAK  240
              YY+  ID +Y+  K
Sbjct  648   KYYQSIIDGMYRSMK  662



>ref|XP_009394139.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   379 bits (972),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 237/320 (74%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G   + TL  +       N  +G KHDE     D+  F+K+K   GG VRL+LSGAAPL 
Sbjct  336   GGMLKQTLFNVSYKYKLHNMMRGSKHDEAATICDKFVFNKVKHGLGGNVRLILSGAAPLA  395

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H E+FLRV       QGY LTE+  G F  + N   M GT G P+  ++ RLESVPEMG
Sbjct  396   THVEQFLRVVTCAHVLQGYGLTETCAGTFVSLPNDLSMLGTVGPPVPNVDVRLESVPEMG  455

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL  VPRGEIC++G TLFSGY+KREDLT +V+VDGWFHTGD+GEWQPDG+MKIIDRKK
Sbjct  456   YDALSEVPRGEICIKGNTLFSGYYKREDLTEEVMVDGWFHTGDVGEWQPDGSMKIIDRKK  515

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ Y+    + ++WVYGNSFESFL+A++ P ++ALE WA+    
Sbjct  516   NIFKLSQGEYVAVENLENIYALVSGIDSIWVYGNSFESFLIAIINPNKQALEHWAELTGI  575

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             TGDF +LC+N KA++YIL EL   GK+ +L+GFE+++AVHL+P PFD+ERDL+TPT+K K
Sbjct  576   TGDFATLCENPKAKEYILGELTKIGKEKKLKGFELIKAVHLDPEPFDMERDLLTPTYKKK  635

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQLL +Y+  ID+LYK +K
Sbjct  636   RPQLLKHYQSVIDELYKSSK  655



>ref|XP_010913603.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Elaeis 
guineensis]
Length=655

 Score =   379 bits (972),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 235/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +      RN  KG KH++     D++ F+K+K   GGRVR++LSGAAPL  H E
Sbjct  340   KSTLFNIAYKYKFRNMSKGSKHEDAASIFDKVVFNKVKGGLGGRVRIILSGAAPLSTHVE  399

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             EFLRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEM YDAL
Sbjct  400   EFLRVVTCSHVLQGYGLTETCAGTFVTLPNNLSMLGTVGPPVPNVDVHLESVPEMNYDAL  459

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
               VPRGEIC+RG TLFSGY+KREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  460   AEVPRGEICVRGNTLFSGYYKREDLTKEVMIDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  519

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y   P + ++W+YGNSFESFLVA+V P ++ALE WA+     GDF
Sbjct  520   LSQGEYVAVENLENVYGLVPDIDSIWIYGNSFESFLVAIVNPNKQALEHWAEEKGVRGDF  579

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              ++C+N KA++YIL EL    K+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K KRPQ+
Sbjct  580   AAICENPKAKEYILGELTKAAKEKKLKGFEFVKAIHLDPEPFDMERDLLTPTYKKKRPQM  639

Query  287   LNYYKDCIDQLYKEAK  240
             L YY+  ID LYK +K
Sbjct  640   LKYYQSIIDNLYKSSK  655



>gb|ABC02880.1| ACS1 [Ricinus communis]
Length=656

 Score =   378 bits (971),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 230/304 (76%), Gaps = 0/304 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KGL HDE     D+L FDK+K   GG+VRL+LSGAAPL +H E FLRV       QGY 
Sbjct  353   KKGLAHDEASPLSDKLVFDKVKQGLGGKVRLILSGAAPLAIHVEAFLRVVSCAHVLQGYG  412

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTE+  G F  + N   M GT G P+  ++  LESVPEM YDAL + PRGEIC+RG T+F
Sbjct  413   LTETCAGTFVSLPNEMAMLGTVGPPVPNVDVCLESVPEMNYDALSSTPRGEICVRGSTVF  472

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             +GY+KREDLT++V++DGWFHTGDIGEWQ DG++KIIDRKKNIFKLSQGEYVAVE+LE+ Y
Sbjct  473   AGYYKREDLTKEVLIDGWFHTGDIGEWQADGSLKIIDRKKNIFKLSQGEYVAVENLENIY  532

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
                  V ++WVYGNSFESFLVAVV P ++ALE WAQ N   GDF SLC+N +A++YI+ E
Sbjct  533   GLASDVDSIWVYGNSFESFLVAVVNPNKQALEHWAQENSVDGDFKSLCENPRAKQYIIGE  592

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             L   GK+ +L+GFE ++AVHL+P PFDIERDL+TPT+K KRPQLL YY+  ID +YK A 
Sbjct  593   LTKIGKEKKLKGFESIKAVHLDPEPFDIERDLLTPTYKKKRPQLLKYYQKVIDDMYKNAS  652

Query  239   NVSA  228
               SA
Sbjct  653   KPSA  656



>ref|XP_010925724.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Elaeis 
guineensis]
Length=655

 Score =   378 bits (970),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 229/303 (76%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN ++G KHDE     D++ F+++K  FGG VRL+LSGAAPL  H E FLRV       Q
Sbjct  353   RNMKRGNKHDEASPVFDKIVFNQVKQGFGGNVRLILSGAAPLATHVEAFLRVVTCAHVMQ  412

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTE+  G F  + N F M GT G P+  ++ RLESVPEMGYDAL ++PRGEIC+RGK
Sbjct  413   GYGLTETCAGTFVSLPNDFAMVGTVGPPVPNVDVRLESVPEMGYDALSSIPRGEICIRGK  472

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KREDLT +V++DGWFHTGDIGEWQPDG +KIIDRKKNIFKLSQGEYVA E+LE
Sbjct  473   TLFSGYYKREDLTNEVMIDGWFHTGDIGEWQPDGTLKIIDRKKNIFKLSQGEYVAAENLE  532

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + Y   P +  +W+YGNSFESFLVA++ P ++ALE+WA  N  + DF +LC+N KA++YI
Sbjct  533   NIYGLVPDIDFIWIYGNSFESFLVAIINPNKQALENWAGENGISEDFAALCENPKAKEYI  592

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L EL       +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL YY+  I+ LYK
Sbjct  593   LGELTKIANAKKLKGFEFIKAVHLDPVPFDMERDLLTPTYKKKRPQLLKYYQMVINSLYK  652

Query  248   EAK  240
               K
Sbjct  653   STK  655



>ref|XP_004245517.1| PREDICTED: long chain acyl-CoA synthetase 4 [Solanum lycopersicum]
Length=658

 Score =   378 bits (970),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 237/320 (74%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G   ++TL  +      RN +KG  H E     D++ F K+K   GGRVRL+LSGAAPL 
Sbjct  339   GGMLKSTLFNLAYAYKHRNLKKGQSHVEASPLSDKVVFSKVKEGLGGRVRLILSGAAPLA  398

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H E FLRV       QGY LTE+  G F  + N + M GT G P+  ++  LESVPEM 
Sbjct  399   SHVEAFLRVVGCCHVLQGYGLTETCAGTFVSLPNHYDMLGTVGPPVPNVDVCLESVPEMS  458

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL + PRGE+C+RG TLFSGY KREDLT++V++DGWFHTGD+GEWQP+G++KIIDRKK
Sbjct  459   YDALSSTPRGEVCVRGDTLFSGYFKREDLTKEVMIDGWFHTGDVGEWQPNGSLKIIDRKK  518

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ Y   P++ ++W+YGNSFESFLVAV+ P  +A+E WA++N  
Sbjct  519   NIFKLSQGEYVAVENLENIYGDNPVIDSIWIYGNSFESFLVAVINPNERAIEHWAEHNGI  578

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             +GDF SLC+N K ++YI+ EL  TGK+ +L+GFE ++AVHL+P PFD+ERDL+TPTFK K
Sbjct  579   SGDFASLCENAKVKEYIIGELAKTGKEKKLKGFEFIKAVHLDPLPFDMERDLLTPTFKKK  638

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQ+L +YKD ID +YK  K
Sbjct  639   RPQMLKFYKDVIDNMYKSTK  658



>ref|XP_006439354.1| hypothetical protein CICLE_v10019200mg [Citrus clementina]
 ref|XP_006476389.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Citrus sinensis]
 gb|ESR52594.1| hypothetical protein CICLE_v10019200mg [Citrus clementina]
Length=662

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 236/318 (74%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N +KG KH E     D++ FDK+K +FGGRVRL+LSGAAPL  H E F
Sbjct  345   TLFNIAYSYKFHNLKKGHKHVEASPIADKIVFDKVKQSFGGRVRLILSGAAPLTPHVETF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEM YDAL +
Sbjct  405   LRVVACAHVLQGYGLTETCAGTFVSLPNEMSMIGTVGPPVPNVDVCLESVPEMEYDALSS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++G T+FSGY+KREDLT++V+VDGWFHTGDIGEWQPDG++KIIDRKKNIFKLS
Sbjct  465   TPRGEVCVKGSTVFSGYYKREDLTKEVMVDGWFHTGDIGEWQPDGSLKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y+    + +VWVYGNSFESFLVA+V P + ALE WA  N   GDF S
Sbjct  525   QGEYVAVENLENIYALVSAIDSVWVYGNSFESFLVAIVNPNKDALERWAAENGVNGDFKS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N KA+++IL EL+   K+ +L+GFE ++AVHLEP PFDIERDL+TPT+K KRPQLL 
Sbjct  585   LCENPKAKEFILGELSRVAKEKKLKGFEFIKAVHLEPVPFDIERDLLTPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAKNVSA  228
             +Y+D ID +YK A   S+
Sbjct  645   HYQDVIDNMYKSANRPSS  662



>ref|XP_006850521.1| PREDICTED: long chain acyl-CoA synthetase 4 [Amborella trichopoda]
 gb|ERN12102.1| hypothetical protein AMTR_s00159p00012160 [Amborella trichopoda]
Length=659

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 236/321 (74%), Gaps = 0/321 (0%)
 Frame = -2

Query  1202  GGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPL  1023
              G R +  L  +  T      +KG  HD+     D++ F+K+K   GGRVRL+LSGAAPL
Sbjct  339   AGGRFKKILFDVAHTYKFNYMKKGYNHDQAAPIFDKIVFNKVKQGLGGRVRLILSGAAPL  398

Query  1022  PMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEM  843
               H E FLRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEM
Sbjct  399   ASHVEAFLRVVTCAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEM  458

Query  842   GYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRK  663
              YDAL + PRGE+C+RGKTLFSGY+KREDLTR+V++DGWFHTGDIGEWQPDG +KIIDRK
Sbjct  459   NYDALASTPRGEVCVRGKTLFSGYYKREDLTREVMIDGWFHTGDIGEWQPDGCLKIIDRK  518

Query  662   KNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNR  483
             KNIFKLSQGEYVAVE+LE+ Y  C  + ++WVYGNSFESFLVA+V P + ALE WA+ N 
Sbjct  519   KNIFKLSQGEYVAVENLENIYGLCSDIDSIWVYGNSFESFLVAIVNPNQVALEQWAEANG  578

Query  482   ETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKL  303
             ++GDF +LC+N KA+++IL++L    K  +L+GFE L+A+HL+P PFD+ERDL+TPT+K 
Sbjct  579   QSGDFTALCQNPKAKEHILEQLYQIAKAKKLKGFEYLKAIHLDPVPFDMERDLLTPTYKK  638

Query  302   KRPQLLNYYKDCIDQLYKEAK  240
             KRPQLL YY+  ID++YK AK
Sbjct  639   KRPQLLKYYQGVIDEMYKNAK  659



>ref|XP_008776844.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Phoenix dactylifera]
Length=655

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 234/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +      RN  KG KH++     D+L F+K+K   GGRVR++LSGAAPL  H E
Sbjct  340   KSTLFNIAYKYKFRNMSKGSKHEDAAAIFDKLVFNKVKGGLGGRVRIILSGAAPLATHVE  399

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             EFLRV       QGY LTE+  G F  + N   M GT G P+  ++ RLESVPEM YDAL
Sbjct  400   EFLRVVTCSHVLQGYGLTETCAGTFVTLPNNLAMLGTVGPPVPNVDVRLESVPEMNYDAL  459

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
               VP GEIC+RG TLFSGY+K EDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  460   AEVPCGEICVRGNTLFSGYYKCEDLTKEVMIDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  519

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y   P + ++W+YGNSFESFLVA+V P ++ALE WA+ N   GDF
Sbjct  520   LSQGEYVAVENLENVYGLVPDLDSIWIYGNSFESFLVAIVNPNKQALEHWAEENGVRGDF  579

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              ++C+N KA++YIL EL    K+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K KRPQL
Sbjct  580   AAICENPKAKEYILGELTKVAKQKKLKGFEFIKAIHLDPEPFDMERDLLTPTYKKKRPQL  639

Query  287   LNYYKDCIDQLYKEAK  240
               YY+  ID LYK AK
Sbjct  640   RKYYQSVIDNLYKSAK  655



>gb|ACB30545.1| long-chain acyl-CoA synthetase 4 [Ricinus communis]
Length=665

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 230/304 (76%), Gaps = 0/304 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KGL HDE     D+L FDK+K   GG+VRL+LSGAAPL +H E FLRV       QGY 
Sbjct  362   KKGLAHDEASPLSDKLVFDKVKQGLGGKVRLILSGAAPLAIHVEAFLRVVSCAHVLQGYG  421

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTE+  G F  + N   M GT G P+  ++  LESVPEM YDAL + PRGEIC+RG T+F
Sbjct  422   LTETCAGTFVSLPNEMAMLGTVGPPVPNVDVCLESVPEMNYDALSSTPRGEICVRGSTVF  481

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             +GY+KREDLT++V++DGWFHTGDIGEWQ DG++KIIDRKKNIFKLSQGEYVAVE+LE+ Y
Sbjct  482   AGYYKREDLTKEVLIDGWFHTGDIGEWQADGSLKIIDRKKNIFKLSQGEYVAVENLENIY  541

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
                  V ++WVYGNSFESFLVAVV P ++ALE WAQ N   GDF SLC+N +A++YI+ E
Sbjct  542   GLASDVDSIWVYGNSFESFLVAVVNPNKQALEHWAQENSVDGDFKSLCENPRAKQYIIGE  601

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             L   GK+ +L+GFE ++AVHL+P PFDIERDL+TPT+K KRPQLL YY+  ID +YK A 
Sbjct  602   LTKIGKEKKLKGFESIKAVHLDPEPFDIERDLLTPTYKKKRPQLLKYYQKVIDDMYKNAS  661

Query  239   NVSA  228
               SA
Sbjct  662   KPSA  665



>dbj|BAD72330.1| putative acyl-CoA synthetase [Oryza sativa Japonica Group]
Length=596

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 234/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +     +    KG KH+E     D++ F K+K   GG VR++LSGAAPL  H E
Sbjct  281   KSTLFNLAYKFKQFRMMKGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVE  340

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             E+LRV       QGY LTE+  G F  + N   M GT G P+  I+  LESVPEM YDAL
Sbjct  341   EYLRVVTCAHVLQGYGLTETCAGSFVSLPNQMCMIGTVGPPVPNIDVCLESVPEMNYDAL  400

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
              T PRGEIC+RG+T+FSGY+KREDLT+DV++DGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  401   ATRPRGEICIRGETVFSGYYKREDLTKDVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  460

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ALE WA  N  +GD 
Sbjct  461   LSQGEYVAVENLENIYGLVSAIDSIWVYGNSFESFLVAVVNPNKEALESWAAANGISGDL  520

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              +LC+N KA++YIL EL+  GK+ +L+GFE ++AVHLEP PFD++RDL+TPT+K KRPQL
Sbjct  521   EALCENPKAKEYILGELSKVGKEKKLKGFEFIKAVHLEPVPFDMDRDLITPTYKKKRPQL  580

Query  287   LNYYKDCIDQLYKEAK  240
             L YY+  ID +Y+ AK
Sbjct  581   LKYYQGTIDNMYRSAK  596



>ref|XP_010266499.1| PREDICTED: long chain acyl-CoA synthetase 4 [Nelumbo nucifera]
Length=661

 Score =   377 bits (968),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 229/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  +G KH E    LD+L F +IK   GGRVRL+LSGAAPL  H E FLRV       QG
Sbjct  360   NMSRGHKHVEAAPTLDKLIFSQIKQGLGGRVRLILSGAAPLARHVEAFLRVVTCSHVLQG  419

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL + PRGEIC+RGKT
Sbjct  420   YGLTETCAGSFVSLPNQLAMLGTVGPPIPNVDVCLESVPEMGYDALSSTPRGEICIRGKT  479

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V+V+GWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+
Sbjct  480   LFSGYYKREDLTKEVMVNGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLEN  539

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y   P +  +W++GNSF+SFLVAVV P ++ALE WA+ N  TGDF SLC+N  A++YIL
Sbjct  540   VYGLVPDIDLIWIHGNSFQSFLVAVVNPNKEALECWAEENGITGDFSSLCENPMAKEYIL  599

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL    K+ +L+GFE ++AVHLEP PFD+ERDL+TPT+K KRPQLL YY++ ID +YK 
Sbjct  600   GELTKIAKEKKLKGFEFIKAVHLEPVPFDMERDLLTPTYKKKRPQLLKYYQNVIDSMYKS  659

Query  245   AK  240
              K
Sbjct  660   VK  661



>ref|XP_006343862.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Solanum tuberosum]
Length=658

 Score =   377 bits (967),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 235/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +      RN +KG  H E     D++ F K+K   GGRVRL+LSGAAPL  H E
Sbjct  343   KSTLFNLAYAYKHRNLKKGQSHVEASPLSDKVVFSKVKEGLGGRVRLILSGAAPLASHVE  402

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
              FLRV       QGY LTE+  G F  + N + M GT G P+  ++  LESVPEM YDAL
Sbjct  403   AFLRVVGCCHVLQGYGLTETCAGTFVSLPNHYDMLGTVGPPVPNVDVCLESVPEMSYDAL  462

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
              + PRGE+C+RG TLFSGY KREDLT++V++DGWFHTGD+GEWQP+G++KIIDRKKNIFK
Sbjct  463   SSTPRGEVCVRGDTLFSGYFKREDLTKEVMIDGWFHTGDVGEWQPNGSLKIIDRKKNIFK  522

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y   P++ ++W+YGNSFESFLVAV+ P  +A+E WA++N  +GDF
Sbjct  523   LSQGEYVAVENLENIYGDNPIIDSIWIYGNSFESFLVAVINPNERAIEHWAEHNGISGDF  582

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              SLC+N K ++YI+ EL  TGK+ +L+GFE ++AVHL+P PFD+ERDL+TPTFK KRPQL
Sbjct  583   ASLCENVKVKEYIVGELAKTGKEKKLKGFEFIKAVHLDPLPFDMERDLLTPTFKKKRPQL  642

Query  287   LNYYKDCIDQLYKEAK  240
               YYKD ID +YK  K
Sbjct  643   FKYYKDVIDNMYKGTK  658



>ref|XP_012086723.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Jatropha curcas]
 ref|XP_012086724.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Jatropha curcas]
 gb|KDP25300.1| hypothetical protein JCGZ_20456 [Jatropha curcas]
Length=662

 Score =   377 bits (967),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 185/299 (62%), Positives = 230/299 (77%), Gaps = 0/299 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KG  HDE     D++ FDK+K   GGRVRL+LSGAAPL +H E FLRV       QGY 
Sbjct  359   KKGRTHDEASPICDKVVFDKVKQGLGGRVRLILSGAAPLAIHVEAFLRVVSCAHVLQGYG  418

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTE+  G F  + N   M GT G P+  ++  LESVPEM YDAL + PRGE+C+RG T+F
Sbjct  419   LTETCAGTFVSLPNEMAMLGTVGPPVPNVDVCLESVPEMNYDALASTPRGEVCVRGSTVF  478

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGY+KREDLT++V++DGWFHTGDIGEWQPDG++KIIDRKKNIFKLSQGEYVAVE+LE+ +
Sbjct  479   SGYYKREDLTKEVLIDGWFHTGDIGEWQPDGSLKIIDRKKNIFKLSQGEYVAVENLENIF  538

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
                  V  +WVYGNSFESFLVAVV P ++ALE WA+ N   GDF SLCKN KA+++IL E
Sbjct  539   GLASSVDGIWVYGNSFESFLVAVVNPNQQALESWAKENGIGGDFNSLCKNPKAKEFILGE  598

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEA  243
             L  T K+++L+GFE+++AVHL+P PFDIERDL+TPT+K KRPQLL YY++ ID +YK A
Sbjct  599   LTKTAKENKLKGFEIVKAVHLDPEPFDIERDLLTPTYKKKRPQLLKYYQNIIDNMYKSA  657



>ref|XP_002456072.1| hypothetical protein SORBIDRAFT_03g029880 [Sorghum bicolor]
 gb|EES01192.1| hypothetical protein SORBIDRAFT_03g029880 [Sorghum bicolor]
Length=655

 Score =   376 bits (966),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 227/299 (76%), Gaps = 0/299 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             +G KH+E     D++ F K+K   GG VR++LSGAAPL  H EE+LRV       QGY L
Sbjct  357   RGAKHNEAASICDKVVFSKVKEGLGGNVRVILSGAAPLATHVEEYLRVVTCAHVLQGYGL  416

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+  G F  + N   M GT G P+  I+ RLESVPEM YDAL + PRGEIC+RG+TLFS
Sbjct  417   TETCAGSFVSLPNQMSMIGTVGPPVPNIDVRLESVPEMDYDALASTPRGEICIRGETLFS  476

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY+KREDLT++V++DGWFHTGDIGEWQPDG MKIIDRKKNIFKLSQGEYVAVE+LE+ Y 
Sbjct  477   GYYKREDLTKEVLIDGWFHTGDIGEWQPDGCMKIIDRKKNIFKLSQGEYVAVENLENVYG  536

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                   ++WVYGNSFESFLVAVV P ++ALE WA  N  +GDF SLCKN KA++YIL EL
Sbjct  537   LVSASDSIWVYGNSFESFLVAVVNPNKEALESWAAANGISGDFESLCKNPKAKEYILGEL  596

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             +  GK+ +L+GFE ++ VHLEP PFD++RDL+TPT+K KRPQLL YY+  ID +YK AK
Sbjct  597   SRIGKEKKLKGFEFIKDVHLEPVPFDMDRDLITPTYKKKRPQLLKYYQGVIDNMYKSAK  655



>emb|CDY40856.1| BnaC09g26090D [Brassica napus]
Length=733

 Score =   379 bits (972),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 230/306 (75%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H E   F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVEAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP+M YDALG++PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFVTFPDELDMLGTVGPPVPNVDIRLESVPDMEYDALGSIPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYHKREDLTKEVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + ++WVYGNSFESFL+AV  P ++ LE WA  N   GDF S+C+N KAR ++L
Sbjct  538   VYGQVEAIDSIWVYGNSFESFLIAVANPSQQTLERWAAENGVNGDFDSICQNTKARAFLL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K+ +L+GFE++RAVHLEP  FDIERDL+TPT+K KRPQLL YY++ ID +YK 
Sbjct  598   GELVKTAKERKLKGFEIIRAVHLEPVAFDIERDLLTPTYKKKRPQLLKYYQNVIDDMYKT  657

Query  245   AKNVSA  228
             AK   A
Sbjct  658   AKEGQA  663



>gb|ACF17663.1| putative long-chain acyl-CoA synthetase [Capsicum annuum]
Length=658

 Score =   376 bits (966),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 235/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +       N +KG KH E     D++ F K+K   GGRVRL+LSGAAPL  H E
Sbjct  343   KSTLFNLAYAYKHHNLKKGRKHFEASPLSDKVVFSKVKEGLGGRVRLILSGAAPLAAHVE  402

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
              FLRV       QGY LTE+  G F  + N + M GT G P+  ++  LESVPEM YDAL
Sbjct  403   AFLRVVACCHVLQGYGLTETCAGTFVSLPNRYDMLGTVGPPVPNVDVCLESVPEMSYDAL  462

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
              + PRGE+C+RG  LFSGY+KREDLT++V++DGWFHTGD+GEWQP+G++KIIDRKKNIFK
Sbjct  463   SSTPRGEVCVRGDILFSGYYKREDLTKEVMIDGWFHTGDVGEWQPNGSLKIIDRKKNIFK  522

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y   P++ ++W+YGNSFESFLVAV+ P ++A+E WA+ N  +GDF
Sbjct  523   LSQGEYVAVENLENIYGNNPIIDSIWIYGNSFESFLVAVINPNQRAVEQWAEVNGLSGDF  582

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              SLC+  + ++YIL EL  TGK+ +L+GFE L+AVHL+P PFD+ERDL+TPTFK KRPQL
Sbjct  583   ASLCEKPEVKEYILRELTKTGKEKKLKGFEFLKAVHLDPVPFDMERDLLTPTFKKKRPQL  642

Query  287   LNYYKDCIDQLYKEAK  240
             L YYKD ID +YK  K
Sbjct  643   LKYYKDVIDSMYKGTK  658



>ref|XP_009128691.1| PREDICTED: long chain acyl-CoA synthetase 5-like [Brassica rapa]
Length=666

 Score =   376 bits (966),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 229/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP+M YDALG+ PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFVTFPDDLDMLGTVGPPVPNVDIRLESVPDMEYDALGSTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V++DGWFHTGD+GEWQPDG+MKIIDRKKNIFKL+QGEYVAVESLE+
Sbjct  478   LFSGYHKREDLTKEVLIDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLAQGEYVAVESLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + +VWVYGNSFESFL+AVV P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  538   VYGQVEAIDSVWVYGNSFESFLIAVVNPTQRTLESWAVENGVDGDFNSICQNAKAKAFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL   G++ +L+GFE++RAVHLEP  FDIERDL+TPT+K KRPQLL YY++ ID++YK 
Sbjct  598   GELVKAGRERKLKGFEIIRAVHLEPVAFDIERDLLTPTYKKKRPQLLKYYQNVIDEIYKA  657

Query  245   AK  240
             AK
Sbjct  658   AK  659



>ref|XP_010915654.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Elaeis guineensis]
Length=655

 Score =   376 bits (965),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 185/314 (59%), Positives = 233/314 (74%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL         RN ++G KH+E    LD++ F K+K   GG+VRL+LSGAAPL  H E F
Sbjct  342   TLFNFAYKYKLRNMKRGRKHEEASPILDKIVFSKVKQGLGGKVRLILSGAAPLASHVEAF  401

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL +
Sbjct  402   LRVVTCAHVLQGYGLTETCAGTFVSLPNDMAMVGTVGPPVPNVDVCLESVPEMGYDALSS  461

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             +PRGEIC+RGKTLFSGY+KREDLT +V++DGWFHTGD+GEWQ DG++KIIDRKKNIFKLS
Sbjct  462   IPRGEICIRGKTLFSGYYKREDLTNEVMIDGWFHTGDVGEWQADGSLKIIDRKKNIFKLS  521

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LES Y   P +  +W+YGNSFESFLVA+V P+++ALE WA+ N  +GDF +
Sbjct  522   QGEYVAVENLESIYGLVPDIDTIWIYGNSFESFLVAIVNPDKQALECWAEENGLSGDFAA  581

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+N KA++YIL EL    K  +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  582   ICENPKAKEYILGELTKIAKAKKLKGFEFIKAVHLDPIPFDMERDLLTPTYKKKRPQLLK  641

Query  281   YYKDCIDQLYKEAK  240
             YY+  I+ LYK  K
Sbjct  642   YYQTVINGLYKNTK  655



>gb|KJB19006.1| hypothetical protein B456_003G080500 [Gossypium raimondii]
Length=660

 Score =   376 bits (965),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 227/296 (77%), Gaps = 0/296 (0%)
 Frame = -2

Query  1160  TTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGW  981
             T    N +KG KH E     D++ F K+K   GG VRL+LSGAAPL  H EEFLRV    
Sbjct  352   TYKYYNMKKGRKHGEASPICDKIVFSKVKQGLGGNVRLILSGAAPLSTHVEEFLRVVACC  411

Query  980   V*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEIC  801
                QGY LTES  G F  + N   M GT G P+  I+ RLESVPEM YDAL + PRGEIC
Sbjct  412   HVLQGYGLTESCAGSFVSLPNELSMLGTVGPPVPNIDVRLESVPEMNYDALASTPRGEIC  471

Query  800   LRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAV  621
             ++G TLFSGY+KREDLTR+V++DGWFHTGDIGEWQP+G+MKIIDRKKNIFKLSQGEYVAV
Sbjct  472   IKGNTLFSGYYKREDLTREVLIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAV  531

Query  620   ESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKA  441
             E+LE+ YS    + ++W+YGNSFESFLVAVV P ++ALE WA +N  +GDF SLCKN KA
Sbjct  532   ENLENIYSLVSAIDSIWIYGNSFESFLVAVVNPNKEALESWAADNNVSGDFESLCKNPKA  591

Query  440   RKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYK  273
             +++IL EL  TGK+ +L+GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL YY+
Sbjct  592   KEFILGELAKTGKEKKLKGFEIIKAVHLDPMPFDMERDLLTPTYKKKRPQLLKYYQ  647



>ref|XP_008652386.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X2 [Zea 
mays]
Length=607

 Score =   374 bits (960),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 226/298 (76%), Gaps = 0/298 (0%)
 Frame = -2

Query  1133  GLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLT  954
             G KH+E     D++ F K+K   GG VR++LSGAAPL  H EE+LRV       QGY LT
Sbjct  310   GAKHNEAASICDKVVFSKVKEGLGGNVRVILSGAAPLATHVEEYLRVVTCAHVVQGYGLT  369

Query  953   ES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSG  774
             E+  G F  + N   M GT G P+  I+ RLESVPEMGYDAL + PRGEIC+RG+TLFSG
Sbjct  370   ETCAGSFVSLPNQMSMIGTVGPPVPNIDVRLESVPEMGYDALASKPRGEICIRGETLFSG  429

Query  773   YHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSR  594
             Y+KREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+ Y  
Sbjct  430   YYKREDLTKEVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLENVYGL  489

Query  593   CPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELN  414
                + ++W+YGNSFESFLVAVV P ++ LE WA  N  +GDF SLC N + ++YIL EL+
Sbjct  490   VSAIDSIWIYGNSFESFLVAVVNPNKEVLESWAAANGISGDFESLCNNPRTKEYILGELS  549

Query  413   NTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
               GK+ +L+GFE ++ VHLEP PFD++RDL+TPT+K KRPQLL YY+  ID +YK AK
Sbjct  550   RIGKEKRLKGFEFVKDVHLEPVPFDMDRDLITPTYKKKRPQLLKYYQGVIDNMYKSAK  607



>ref|XP_010261577.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261578.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X2 [Nelumbo 
nucifera]
Length=660

 Score =   375 bits (964),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N ++G  H E     D++ F K+K   GG VRL+LSGAAPL  H E FLRV       QG
Sbjct  359   NMKRGQPHAEAAPIFDKIVFSKVKQGLGGNVRLILSGAAPLATHVEAFLRVVACAHVLQG  418

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F  + N   M GT G P+  ++A LESVPEMGYDAL + PRGEIC+RG T
Sbjct  419   YGLTETCAGTFVSLPNQLAMLGTVGPPVPNVDACLESVPEMGYDALSSKPRGEICVRGNT  478

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+
Sbjct  479   LFSGYYKREDLTKEVMVDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLEN  538

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y   P + ++W+YGNSFESFLVA++ P ++ LE WA+ N  +G+F SLC+N K ++YIL
Sbjct  539   VYGLVPAIDSIWIYGNSFESFLVAIINPNKQILERWAEENGISGEFNSLCENPKTKEYIL  598

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL   G++ +L+GFE+++AVHLEP PFD+ERDL+TPT+K KRPQLL YY++ ID +YK 
Sbjct  599   GELTKIGREKKLKGFELIKAVHLEPFPFDMERDLLTPTYKKKRPQLLKYYQNVIDSMYKS  658

Query  245   AK  240
             AK
Sbjct  659   AK  660



>gb|KEH21217.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=659

 Score =   375 bits (964),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 232/314 (74%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             T+     T    + E+G KH+     +D+L F K+K A GG VR++LSGAAPL  H E F
Sbjct  346   TMFNWAYTYKLHSMERGQKHETAAPLMDKLVFSKVKQALGGNVRIVLSGAAPLSKHVEGF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  I N   M G  G P+  IE  LESVPEMGYDAL T
Sbjct  406   LRVVTCAHILQGYGLTETCAGSFVTIPNEINMLGMVGPPLPYIEVCLESVPEMGYDALAT  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++G T+F+GYHKREDLT++V++DGWFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  466   KPRGEICIKGGTVFAGYHKREDLTKEVMIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y +   + ++W+YGNSFE FLVAVV P +KA+EDWAQ N    DF S
Sbjct  526   QGEYVAVENLENIYVQVNAIESIWIYGNSFEHFLVAVVNPSKKAVEDWAQANDMKMDFNS  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ KA+ YIL EL    K+ +L+GFE ++AVHL+P PFD+ERDL+TPTFK KRPQLL 
Sbjct  586   LCEDSKAKHYILGELLKIAKEKKLKGFEFVKAVHLDPVPFDMERDLLTPTFKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAK  240
             YY++ ID++YK AK
Sbjct  646   YYQNIIDEMYKTAK  659



>ref|XP_011026897.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Populus 
euphratica]
Length=665

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 239/318 (75%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    + +KG  HDE     D++ F+K++ A GG VRL+LSGAAPL  H E F
Sbjct  348   TLFNIAYSHKFSSMKKGFAHDEASPICDKIVFNKVRQALGGNVRLILSGAAPLSNHVEAF  407

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N  PM GT G P+  ++  LESVPE+GYDAL +
Sbjct  408   LRVVSCAHVLQGYGLTETCAGTFVSLPNELPMLGTVGPPVPNVDVFLESVPEVGYDALSS  467

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLF+GY+KREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLS
Sbjct  468   TPRGEICIRGKTLFAGYYKREDLTKEVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLS  527

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNSFESFLVAV  P ++ALE WAQ +  +G+F S
Sbjct  528   QGEYVAVENLENIYSLVSDIDSIWVYGNSFESFLVAVANPNQQALEHWAQEHGISGNFKS  587

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N +A+K+IL EL   GK+ +L+GFE+++ VHL+P PFD+ER+L+TPT+K KRPQLL 
Sbjct  588   LCENPEAKKFILGELTKIGKEKKLKGFELVKDVHLDPEPFDMERNLITPTYKKKRPQLLK  647

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY++ ID +YK A   SA
Sbjct  648   YYQNVIDNMYKSASKPSA  665



>ref|XP_008341534.1| PREDICTED: long chain acyl-CoA synthetase 4 [Malus domestica]
Length=660

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 231/314 (74%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             T+  +  +    N +KG  H +     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  347   TMFNLAYSYKYHNMQKGHGHAQASPIADKVVFSKVKQGLGGRVRLILSGAAPLSTHVEAF  406

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL  
Sbjct  407   LRVVACAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEMGYDALSD  466

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C+RG TLFSGY+KREDLT++V++DGWFHTGD+GEWQPDG++KIIDRKKNIFKLS
Sbjct  467   TPRGEVCVRGNTLFSGYYKREDLTKEVLIDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLS  526

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + A+WVYGNSFESFLVAVV P ++A+E WAQ N  +GDF S
Sbjct  527   QGEYVAVENLENIYGLVSDIDAIWVYGNSFESFLVAVVNPNKQAIESWAQQNGISGDFNS  586

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC N K +++IL ELN   K+ +L+GFE+++ VHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  587   LCGNAKVKEHILGELNKIAKEKKLKGFEVIKGVHLDPEPFDMERDLITPTYKKKRPQLLK  646

Query  281   YYKDCIDQLYKEAK  240
             +YKD ID +YK AK
Sbjct  647   HYKDLIDNMYKSAK  660



>gb|KFK33690.1| hypothetical protein AALP_AA5G047100 [Arabis alpina]
Length=658

 Score =   375 bits (962),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 232/312 (74%), Gaps = 0/312 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL        + N EKG  H++     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  346   TLFNFAFNYKKGNMEKGTPHEQASTLSDKIVFKKVKEGLGGRVRLILSGAAPLAAHIESF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDALG+
Sbjct  406   LRVVACAHVLQGYGLTESCGGTFLSIPNELKMIGTVGPPVPNVDIRLESVPEMGYDALGS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLFSGY+KREDLT++V++DGW HTGD+GEWQP+GAMKIIDRKKNIFKLS
Sbjct  466   NPRGEICIRGKTLFSGYYKREDLTQEVLIDGWLHTGDVGEWQPNGAMKIIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + A+WVYGNS+ES+LVAVV P +  +E WA+ +  +GDF S
Sbjct  526   QGEYVAVENLENIYSHVAAIEAIWVYGNSYESYLVAVVCPSKLHIEHWAREHNVSGDFES  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+NQK ++++L E N   K  +L+GFE+++ VHLE  PFD++RDL+TP++K KRPQLL 
Sbjct  586   ICQNQKTKEFLLGEFNRVAKDKKLKGFELIKGVHLETVPFDMDRDLITPSYKKKRPQLLK  645

Query  281   YYKDCIDQLYKE  246
             YY+  ID++YK+
Sbjct  646   YYQKEIDEMYKK  657



>emb|CDX94232.1| BnaC02g28920D [Brassica napus]
Length=661

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 228/302 (75%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  353   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP+M YDALG+ PRGEIC+RGKT
Sbjct  413   YGLTESCAGTFVTFPDDLDMLGTVGPPVPNVDIRLESVPDMEYDALGSTPRGEICIRGKT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V++DGWFHTGD+GEWQPDG+MKIIDRKKNIFKL+QGEYVAVESLE+
Sbjct  473   LFSGYHKREDLTKEVLIDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLAQGEYVAVESLEN  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + +VWVYGNSFESFL+AVV P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  533   VYGQVDAIDSVWVYGNSFESFLIAVVNPTQRTLESWAVENGVDGDFNSICQNAKAKAFIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL   G++ +L+GFE++RAVHLEP  FDIERDL+TPT+K KRPQLL YY++ ID++Y  
Sbjct  593   GELVKAGRERKLKGFEIIRAVHLEPVAFDIERDLLTPTYKKKRPQLLKYYQNVIDEIYNA  652

Query  245   AK  240
             AK
Sbjct  653   AK  654



>ref|XP_002297977.2| acyl-coA synthetase family protein [Populus trichocarpa]
 gb|EEE82782.2| acyl-coA synthetase family protein [Populus trichocarpa]
Length=643

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 238/318 (75%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    + +KG  HDE     D++ F+K++   GG VRL+LSGAAPL  H E F
Sbjct  326   TLFNLAYSHKFSSMKKGFAHDEASPICDKIVFNKVRQGLGGNVRLILSGAAPLSNHVEAF  385

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N  PM GT G P+  ++  LESVPEMGYDAL +
Sbjct  386   LRVVSCAHVLQGYGLTETCAGTFVSLPNELPMLGTVGPPVPNVDVFLESVPEMGYDALSS  445

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLF+GY+KREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLS
Sbjct  446   TPRGEICIRGKTLFAGYYKREDLTKEVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLS  505

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNSFESFL+AV  P ++ALE WAQ +  +G+F S
Sbjct  506   QGEYVAVENLENIYSLVSDIDSIWVYGNSFESFLIAVANPNQQALEHWAQEHGISGNFKS  565

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N +A+K+IL EL   GK+ +L+GFE+++ VHL+P PFD+ER+L+TPT+K KRPQLL 
Sbjct  566   LCENPEAKKFILGELTKIGKEKKLKGFELVKDVHLDPEPFDMERNLITPTYKKKRPQLLK  625

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY++ ID +YK A   +A
Sbjct  626   YYQNVIDNMYKSASKPNA  643



>gb|EEC71207.1| hypothetical protein OsI_03121 [Oryza sativa Indica Group]
 gb|EEE55110.1| hypothetical protein OsJ_02872 [Oryza sativa Japonica Group]
Length=656

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 234/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +     +    KG KH+E     D++ F K+K   GG VR++LSGAAPL  H E
Sbjct  341   KSTLFNLAYKFKQFRMMKGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVE  400

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             E+LRV       QGY LTE+  G F  + N   M GT G P+  I+  LESVPEM YDAL
Sbjct  401   EYLRVVTCAHVLQGYGLTETCAGSFVSLPNQMCMIGTVGPPVPNIDVCLESVPEMNYDAL  460

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
              T PRGEIC+RG+T+FSGY+KREDLT+DV++DGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  461   ATRPRGEICIRGETVFSGYYKREDLTKDVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  520

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ALE WA  N  +GD 
Sbjct  521   LSQGEYVAVENLENIYGLVSAIDSIWVYGNSFESFLVAVVNPNKEALESWAAANGISGDL  580

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              +LC+N KA++YIL EL+  GK+ +L+GFE ++AVHLEP PFD++RDL+TPT+K KRPQL
Sbjct  581   EALCENPKAKEYILGELSKVGKEKKLKGFEFIKAVHLEPVPFDMDRDLITPTYKKKRPQL  640

Query  287   LNYYKDCIDQLYKEAK  240
             L YY+  ID +Y+ AK
Sbjct  641   LKYYQGTIDNMYRSAK  656



>ref|NP_176622.1| long-chain acyl-CoA synthetase [Arabidopsis thaliana]
 sp|Q9C7W4.1|LACS3_ARATH RecName: Full=Long chain acyl-CoA synthetase 3 [Arabidopsis thaliana]
 gb|AAG51719.1|AC066689_18 acyl-CoA synthetase, putative; 23993-27872 [Arabidopsis thaliana]
 gb|AAM28870.1|AF503753_1 long chain acyl-CoA synthetase 3 [Arabidopsis thaliana]
 gb|AAK64039.1| putative acyl-CoA synthetase [Arabidopsis thaliana]
 gb|AAL85045.1| putative acyl-CoA synthetase [Arabidopsis thaliana]
 gb|AEE34237.1| long-chain acyl-CoA synthetase [Arabidopsis thaliana]
Length=665

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 231/306 (75%), Gaps = 0/306 (0%)
 Frame = -2

Query  1151  RRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*S  972
              +N EKG  H++     D++ F K+K   GG VRL+LSGAAPL  H E FLRV       
Sbjct  356   HKNMEKGQPHEQASPIADKIVFKKVKEGLGGNVRLILSGAAPLAAHIESFLRVVACAHVL  415

Query  971   QGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRG  792
             QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL + PRGEIC+RG
Sbjct  416   QGYGLTESCGGTFVSIPNELSMLGTVGPPVPNVDIRLESVPEMGYDALASNPRGEICIRG  475

Query  791   KTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESL  612
             KTLFSGY+KREDLT++V +DGW HTGD+GEWQPDGAMKIIDRKKNIFKLSQGEYVAVE+L
Sbjct  476   KTLFSGYYKREDLTQEVFIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLSQGEYVAVENL  535

Query  611   ESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKY  432
             E+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ ++ +GDF S+C+NQK +++
Sbjct  536   ENIYSHVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHKVSGDFESICRNQKTKEF  595

Query  431   ILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLY  252
             +L E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K+KRPQLL YY+  ID++Y
Sbjct  596   VLGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKMKRPQLLKYYQKEIDEMY  655

Query  251   KEAKNV  234
             K+ + V
Sbjct  656   KKNREV  661



>ref|XP_004969353.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Setaria italica]
Length=655

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 233/316 (74%), Gaps = 0/316 (0%)
 Frame = -2

Query  1187  ETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEE  1008
             ++TL  +     +    +G KHDE     D++ F K+K   GG VR++LSGAAPL  H E
Sbjct  340   KSTLFNLAYKFKQFRMMRGAKHDEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVE  399

Query  1007  EFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL  828
             E+LRV       QGY LTE+  G F  + N   M GT G P+  I+ RLESVPEM YDAL
Sbjct  400   EYLRVVTCAHVIQGYGLTETCAGSFVSLPNQMSMVGTVGPPVPNIDVRLESVPEMNYDAL  459

Query  827   GTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFK  648
                 RGEIC++G+TLFSGY+KREDLT++V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFK
Sbjct  460   ARTARGEICIKGETLFSGYYKREDLTKEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFK  519

Query  647   LSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDF  468
             LSQGEYVAVE+LE+ Y     + ++W+YGNSFESFLVAVV P ++ALE WA  N  +GDF
Sbjct  520   LSQGEYVAVENLENIYGLVSAIDSIWIYGNSFESFLVAVVNPNKEALESWAAANGISGDF  579

Query  467   VSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQL  288
              SLC+N KA++YIL EL+  GK+ +L+GFE ++ VHLEP PFD++RDL+TPT+K KRPQL
Sbjct  580   ESLCQNPKAKEYILGELSRIGKEKKLKGFEFIKDVHLEPVPFDMDRDLITPTYKKKRPQL  639

Query  287   LNYYKDCIDQLYKEAK  240
             L YY+  ID +YK AK
Sbjct  640   LKYYQGVIDNMYKSAK  655



>ref|XP_003610998.1| Annotation was added to scaffolds in November 2011~Long-chain-fatty-acid-CoA 
ligase [Medicago truncatula]
 gb|AES93956.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=662

 Score =   374 bits (961),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
              N +KG  H      LD++ FDK+K   GG VRL+LSGAAPL +H E +LRV       Q
Sbjct  356   NNMKKGQNHAVASPLLDKIVFDKVKQGLGGSVRLILSGAAPLSLHVESYLRVVSCAHVLQ  415

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTE+  G F  + N   M GT G P+  ++A LESVPEMGYDAL + PRGEIC++G 
Sbjct  416   GYGLTETCAGTFVSLPNELDMLGTVGPPVPNVDACLESVPEMGYDALASTPRGEICVKGD  475

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLFSGY+KREDLT++V+V+GWFHTGDIGEWQP+G+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  476   TLFSGYYKREDLTKEVLVEGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENLE  535

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + YS+ P V ++WVYGNSFE+FLV VV P + ALE WA+ N  + DF SLC + +A+ YI
Sbjct  536   NIYSQVPSVESIWVYGNSFEAFLVTVVTPSKPALEHWAEENGISMDFNSLCGDSRAKSYI  595

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L+EL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL YY++ ID +YK
Sbjct  596   LEELSKIGKEKKLKGFEFIKAVHLDPVPFDMERDLITPTYKKKRPQLLKYYQNVIDDMYK  655

Query  248   EA  243
               
Sbjct  656   SG  657



>ref|NP_001043753.1| Os01g0655800 [Oryza sativa Japonica Group]
 dbj|BAF05667.1| Os01g0655800, partial [Oryza sativa Japonica Group]
Length=680

 Score =   375 bits (962),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 184/299 (62%), Positives = 228/299 (76%), Gaps = 0/299 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             KG KH+E     D++ F K+K   GG VR++LSGAAPL  H EE+LRV       QGY L
Sbjct  382   KGAKHNEAAAICDKVVFSKVKEGLGGNVRVILSGAAPLATHVEEYLRVVTCAHVLQGYGL  441

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+  G F  + N   M GT G P+  I+  LESVPEM YDAL T PRGEIC+RG+T+FS
Sbjct  442   TETCAGSFVSLPNQMCMIGTVGPPVPNIDVCLESVPEMNYDALATRPRGEICIRGETVFS  501

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY+KREDLT+DV++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+ Y 
Sbjct  502   GYYKREDLTKDVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLENIYG  561

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 + ++WVYGNSFESFLVAVV P ++ALE WA  N  +GD  +LC+N KA++YIL EL
Sbjct  562   LVSAIDSIWVYGNSFESFLVAVVNPNKEALESWAAANGISGDLEALCENPKAKEYILGEL  621

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             +  GK+ +L+GFE ++AVHLEP PFD++RDL+TPT+K KRPQLL YY+  ID +Y+ AK
Sbjct  622   SKVGKEKKLKGFEFIKAVHLEPVPFDMDRDLITPTYKKKRPQLLKYYQGTIDNMYRSAK  680



>ref|XP_003517503.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Glycine max]
Length=662

 Score =   374 bits (961),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 236/318 (74%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KGL+H E    LD++ FDK+K   GGRVRL+LSGAAPL  H E +
Sbjct  345   TLFNFAYSYKLNNMKKGLRHGEASPLLDKIVFDKVKQGLGGRVRLILSGAAPLSAHVEGY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL +
Sbjct  405   LRVVTCAHVLQGYGLTETCAGTFVSLPNEIEMLGTVGPPVPNVDVCLESVPEMGYDALAS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++GKTLF+GY+KREDLT++V++D WFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICVKGKTLFAGYYKREDLTKEVLIDEWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y +   + ++WVYGNSFE+FLVAVV P ++ALE WAQ N  + DF S
Sbjct  525   QGEYVAVENLENIYGQVSSIESIWVYGNSFEAFLVAVVNPSKQALEHWAQENGISMDFNS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+ YI++EL+   K+ +L+GFE ++AVHL+  PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCEDARAKSYIIEELSKIAKEKKLKGFEFIKAVHLDSIPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY++ ID +YK     SA
Sbjct  645   YYQNAIDNMYKSGSKPSA  662



>ref|XP_002304555.1| acyl-coA synthetase family protein [Populus trichocarpa]
 gb|EEE79534.1| acyl-coA synthetase family protein [Populus trichocarpa]
Length=662

 Score =   374 bits (959),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 237/318 (75%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    + +KGL H +     D++ F+K++   GG+VRL+LSGAAPL  H E F
Sbjct  345   TLFNVAYSHKFSSMKKGLAHHQASPICDKIVFNKVRQGLGGKVRLILSGAAPLSNHVEAF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N  PM GT G P+  ++  LESVPEMGYDAL +
Sbjct  405   LRVVSCAHVLQGYGLTETCAGTFVSLPNELPMLGTVGPPVPNVDVCLESVPEMGYDALSS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLF+GY+KREDLT +V+ DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICIRGKTLFAGYYKREDLTEEVLNDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNSFESFLVAV  P ++ALE WAQ +  +GDF +
Sbjct  525   QGEYVAVENLENIYSLVSDIDSIWVYGNSFESFLVAVANPNQQALEHWAQEHGISGDFKA  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N +A++Y+L EL   GK+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCENPRAKEYMLGELTKIGKEKKLKGFEFIKAIHLDPEPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY++ ID +YK A   SA
Sbjct  645   YYQNVIDNMYKSASKPSA  662



>ref|XP_007211290.1| hypothetical protein PRUPE_ppa002540mg [Prunus persica]
 gb|EMJ12489.1| hypothetical protein PRUPE_ppa002540mg [Prunus persica]
Length=660

 Score =   374 bits (959),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 232/314 (74%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             T+     +    N +KG  H +     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  347   TMFNFAYSYKYHNMQKGHAHGDASPIADKIVFSKVKQGLGGRVRLILSGAAPLSTHVEAF  406

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL  
Sbjct  407   LRVVACAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEMGYDALSD  466

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++G TLFSGY+KREDLT++V++DGWFHTGD+GEWQPDG++KIIDRKKNIFKLS
Sbjct  467   TPRGEICVKGNTLFSGYYKREDLTKEVMIDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLS  526

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + A+WVYGNSFESFL+AVV P ++A+E WA+ N  +GDF S
Sbjct  527   QGEYVAVENLENIYGLVSDIDAIWVYGNSFESFLIAVVNPNKQAIESWAEQNGVSGDFNS  586

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ + ++YIL ELN   K+ +L+GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  587   LCEHTRVKEYILGELNKIAKEKKLKGFEVIKAVHLDPEPFDMERDLITPTYKKKRPQLLK  646

Query  281   YYKDCIDQLYKEAK  240
             YYK+ ID +YK AK
Sbjct  647   YYKEIIDNMYKSAK  660



>ref|XP_002270385.1| PREDICTED: long chain acyl-CoA synthetase 4 [Vitis vinifera]
 emb|CBI34479.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   374 bits (959),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 187/319 (59%), Positives = 235/319 (74%), Gaps = 0/319 (0%)
 Frame = -2

Query  1184  TTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEE  1005
              TL  +     + N  KG+K  E     D++ F K+K   GG VRL+LSGAAPL  H E 
Sbjct  344   NTLFNIAYKYKQYNLWKGVKTLEAAPICDKIVFGKVKQGLGGNVRLILSGAAPLSTHVEA  403

Query  1004  FLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALG  825
             +LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL 
Sbjct  404   YLRVVTCAHVLQGYGLTETCAGTFVSLPNEISMLGTVGPPVPNVDVCLESVPEMGYDALS  463

Query  824   TVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
             + PRGEIC+RGKTLFSGY+KREDLT++V+VDGWFHTGD+GEWQPDG+MKIIDRKKNIFKL
Sbjct  464   STPRGEICIRGKTLFSGYYKREDLTKEVLVDGWFHTGDVGEWQPDGSMKIIDRKKNIFKL  523

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ Y     + ++W+YGNSFESFLVAV  P ++ALE WA+ N  +GDF 
Sbjct  524   SQGEYVAVENLENIYGLVSDIDSIWIYGNSFESFLVAVANPNQQALERWAKENNISGDFD  583

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             SLC+N KA++YIL EL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL
Sbjct  584   SLCENPKAKEYILGELSKIGKEKKLKGFEFVKAVHLDPVPFDMERDLITPTYKKKRPQLL  643

Query  284   NYYKDCIDQLYKEAKNVSA  228
              YY++ ID++YK     SA
Sbjct  644   KYYQNVIDKMYKSINKPSA  662



>gb|EMT19325.1| Fatty acyl-CoA synthetase A [Aegilops tauschii]
Length=633

 Score =   373 bits (957),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 235/315 (75%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH++     D+L F K+K   GGRVR++LSGAAPL  H EEF
Sbjct  319   TLFNVAYKYKQGNMIKGSKHEDAASIFDKLVFTKVKRGLGGRVRVILSGAAPLSNHVEEF  378

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  +E  LESVPEMGYDAL  
Sbjct  379   LRVVTCSHVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVHLESVPEMGYDALSK  438

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGY+KREDLT++V+VDGWFHTGDIGEWQ DG+MKIIDRKKNIFKL
Sbjct  439   ESPRGEICIRGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQHDGSMKIIDRKKNIFKL  498

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAV+ P ++ LE WA++N  +GDF 
Sbjct  499   SQGEYVAVENLENIFGQAPNVDSIWVYGNSFESCLVAVINPNKQGLERWAESNGVSGDFA  558

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             S+C + KA+++IL+EL+ TGK  +L+GFEM+RAVHLEP  FD+ERDL+TPT+K KRPQLL
Sbjct  559   SICGDAKAKEFILEELSKTGKDKKLKGFEMIRAVHLEPVLFDMERDLITPTYKKKRPQLL  618

Query  284   NYYKDCIDQLYKEAK  240
              YY+  ID++YK  K
Sbjct  619   KYYQGIIDEMYKSMK  633



>ref|XP_008675265.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Zea mays]
 ref|XP_008652385.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Zea 
mays]
 tpg|DAA58295.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
 tpg|DAA60601.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=655

 Score =   373 bits (958),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/298 (61%), Positives = 226/298 (76%), Gaps = 0/298 (0%)
 Frame = -2

Query  1133  GLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLT  954
             G KH+E     D++ F K+K   GG VR++LSGAAPL  H EE+LRV       QGY LT
Sbjct  358   GAKHNEAASICDKVVFSKVKEGLGGNVRVILSGAAPLATHVEEYLRVVTCAHVVQGYGLT  417

Query  953   ES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSG  774
             E+  G F  + N   M GT G P+  I+ RLESVPEMGYDAL + PRGEIC+RG+TLFSG
Sbjct  418   ETCAGSFVSLPNQMSMIGTVGPPVPNIDVRLESVPEMGYDALASKPRGEICIRGETLFSG  477

Query  773   YHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSR  594
             Y+KREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE+ Y  
Sbjct  478   YYKREDLTKEVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLENVYGL  537

Query  593   CPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELN  414
                + ++W+YGNSFESFLVAVV P ++ LE WA  N  +GDF SLC N + ++YIL EL+
Sbjct  538   VSAIDSIWIYGNSFESFLVAVVNPNKEVLESWAAANGISGDFESLCNNPRTKEYILGELS  597

Query  413   NTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
               GK+ +L+GFE ++ VHLEP PFD++RDL+TPT+K KRPQLL YY+  ID +YK AK
Sbjct  598   RIGKEKRLKGFEFVKDVHLEPVPFDMDRDLITPTYKKKRPQLLKYYQGVIDNMYKSAK  655



>ref|XP_004964796.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X3 [Setaria 
italica]
Length=539

 Score =   369 bits (948),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 234/314 (75%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +       +  KG+KH++   F D+L F K+K   GG++R+++SG APL +  EEF
Sbjct  226   TLFNIAYKMKLDSMRKGIKHEKAAPFFDKLVFSKVKERLGGKLRVIVSGGAPLAVPVEEF  285

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G    I N +PM GT G P+  I+ RLESVPEMGYDAL +
Sbjct  286   LRVVTCAYVIQGYGLTETCAGSIVSIPNEYPMLGTVGPPIQHIDVRLESVPEMGYDALSS  345

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             +PRGEIC+RG  LFSGY+KREDLT++V++DGWFHTGD+GEWQPDG++K+IDRKKNIFKLS
Sbjct  346   IPRGEICIRGSVLFSGYYKREDLTQEVMIDGWFHTGDVGEWQPDGSLKVIDRKKNIFKLS  405

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ LE WA+ N  TG F  
Sbjct  406   QGEYVAVENLENVYGVLQEIDSIWVYGNSFESFLVAVVNPNQQVLEHWAEQNGITGSFAK  465

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LCKN +A+ +IL EL   GK+ +LRGFE+++A+HL+P PFDIERDL+TPT+K KRPQ+L 
Sbjct  466   LCKNPRAKDHILAELIKIGKEKKLRGFELIKAIHLDPLPFDIERDLITPTYKKKRPQMLK  525

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID LYK +K
Sbjct  526   YYQGEIDALYKGSK  539



>ref|XP_008239039.1| PREDICTED: long chain acyl-CoA synthetase 4 [Prunus mume]
 ref|XP_008239040.1| PREDICTED: long chain acyl-CoA synthetase 4 [Prunus mume]
Length=660

 Score =   373 bits (958),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 231/314 (74%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             T+     +    N +KG  H       D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  347   TMFNFAYSYKYHNMQKGHAHGNASPIADKIVFSKVKQGLGGRVRLILSGAAPLSTHVETF  406

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL  
Sbjct  407   LRVVACAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEMGYDALSD  466

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++G TLFSGY+KREDLTR+V++DGWFHTGD+GEWQPDG++KIIDRKKNIFKLS
Sbjct  467   TPRGEVCVKGNTLFSGYYKREDLTREVMIDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLS  526

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + A+WVYGNSFESFL+AVV P ++A+E WA+ N  +GDF S
Sbjct  527   QGEYVAVENLENIYGLVSDIDAIWVYGNSFESFLIAVVNPNKQAIESWAEQNGVSGDFNS  586

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ + ++Y+L ELN   K+ +L+GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  587   LCEHTRVKEYVLGELNKIAKEKKLKGFEVIKAVHLDPEPFDMERDLITPTYKKKRPQLLK  646

Query  281   YYKDCIDQLYKEAK  240
             YYK+ ID +YK AK
Sbjct  647   YYKEIIDNMYKSAK  660



>ref|XP_001761279.1| predicted protein [Physcomitrella patens]
 gb|EDQ74001.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   373 bits (958),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 232/304 (76%), Gaps = 1/304 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KG K D+   F D+L FDK+K+  GGRVRL++SGAAPL  H E+FLRV       QGY 
Sbjct  359   KKGYKQDQASPFFDKLVFDKVKMGLGGRVRLVISGAAPLSGHVEKFLRVIMCAPVMQGYG  418

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL-GTVPRGEICLRGKTL  783
             LTE+    F  + +V  M GT G P   I+ RLESVPE+GYDAL    P+GEIC+RGKTL
Sbjct  419   LTETCAASFLQVPDVISMNGTVGPPQPIIDVRLESVPELGYDALREDSPQGEICIRGKTL  478

Query  782   FSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLEST  603
             FSGY+KR +LT +V+++GWFHTGDIGEWQ DGA+KIIDRKKNIFKLSQGEYVAVE+LE+ 
Sbjct  479   FSGYYKRPELTEEVLINGWFHTGDIGEWQKDGALKIIDRKKNIFKLSQGEYVAVENLENV  538

Query  602   YSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILD  423
             Y+    V A+WVYGNSFESFLVAV +P ++ALE+WA +N E GD+ +LCK+ KA+K+IL 
Sbjct  539   YNESSSVDAIWVYGNSFESFLVAVAVPNQQALENWANSNGEEGDYATLCKSPKAQKFILS  598

Query  422   ELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEA  243
             EL N GKK  L+GFE ++AVHL+  PFD+ERDL TPTFKLKRPQLL YY+  ID +Y + 
Sbjct  599   ELTNMGKKKGLKGFEFIKAVHLDSQPFDVERDLTTPTFKLKRPQLLKYYQKEIDVMYNKI  658

Query  242   KNVS  231
             K+ S
Sbjct  659   KSNS  662



>ref|NP_001169642.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
 gb|ACN34375.1| unknown [Zea mays]
 tpg|DAA58110.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=664

 Score =   373 bits (958),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 235/315 (75%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH+E     DRL F K+K   GGRVRL+LSGAAPL  H EE+
Sbjct  350   TLFNVAYKYKQGNMLKGNKHEEAAAMFDRLVFTKVKRGLGGRVRLILSGAAPLSRHVEEY  409

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  +E RLESVPEMGYDAL +
Sbjct  410   LRVVTCSHVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVRLESVPEMGYDALSS  469

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGY+KREDLT++V+VDGWFHTGDIGEWQ DG+MKIIDRKKNIFKL
Sbjct  470   ETPRGEICIRGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQSDGSMKIIDRKKNIFKL  529

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAVV P  +ALE WA++N  TG+F 
Sbjct  530   SQGEYVAVENLENIFGQTPAVDSIWVYGNSFESSLVAVVNPNTQALERWAESNGVTGEFA  589

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             ++C++ +AR++IL EL   GK+ +L+GFE++RAVHL+P PFD+ERDL+TPT+K KRPQLL
Sbjct  590   TICEDPRAREFILGELTKMGKEKKLKGFELIRAVHLDPAPFDMERDLITPTYKKKRPQLL  649

Query  284   NYYKDCIDQLYKEAK  240
              +Y+  ID +Y   K
Sbjct  650   KHYQTIIDGMYNSMK  664



>ref|XP_006396970.1| hypothetical protein EUTSA_v10029385mg [Eutrema salsugineum]
 gb|ESQ38423.1| hypothetical protein EUTSA_v10029385mg [Eutrema salsugineum]
Length=667

 Score =   373 bits (958),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  359   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  418

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVP+M YDALG+ PRGEIC+RGKT
Sbjct  419   YGLTESCAGTFVTLPDELDMLGTVGPPVPNVDIRLESVPDMEYDALGSTPRGEICIRGKT  478

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGWFHTGD+GEWQPDG+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  479   LFSGYYKREDLTKEVLIDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLAQGEYVAVENLEN  538

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + ++WVYGNSF+SFL+AV  P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  539   VYGQVEAIDSIWVYGNSFKSFLIAVANPTQQTLERWAVENGVNGDFNSICQNAKAKAFIL  598

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL NT K+ +L+GFE+++AVHLEP PFDIERDL+TPT+K KRPQLL YY++ ID++YK 
Sbjct  599   GELVNTAKERKLKGFEIIKAVHLEPVPFDIERDLLTPTYKKKRPQLLKYYQNVIDEMYKT  658

Query  245   AK  240
              K
Sbjct  659   TK  660



>ref|XP_009112876.1| PREDICTED: long chain acyl-CoA synthetase 3 [Brassica rapa]
Length=660

 Score =   373 bits (957),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 229/315 (73%), Gaps = 0/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL          N  KG  H++     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  346   TLFNFAFNYKHNNMVKGKAHEQAAPIFDKIVFKKVKEGLGGRVRLILSGAAPLAAHIESF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  406   LRVVACAHVLQGYGLTESCGGTFVSIPNELQMLGTVGPPVPNVDIRLESVPEMGYDALAS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLFSGY+KREDLT++V +DGW HTGD+GEWQPDGAMKIIDRKKNIFKLS
Sbjct  466   KPRGEICIRGKTLFSGYYKREDLTQEVFIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  +GDF +
Sbjct  526   QGEYVAVENLENIYSHVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHNVSGDFET  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+NQK +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL 
Sbjct  586   ICQNQKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAKN  237
             YY+  ID++Y + KN
Sbjct  646   YYQKEIDEMYNKTKN  660



>gb|ABK96686.1| unknown [Populus trichocarpa x Populus deltoides]
Length=662

 Score =   373 bits (957),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 236/318 (74%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +   R+ + G  HDE     D+  F+K++   GG VRL+LSGAAPL  H E F
Sbjct  345   TLFNLAYSHKFRSMKMGFAHDEASPICDKFVFNKVRQGLGGNVRLILSGAAPLSNHVEAF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N  PM GT G P+  ++  LESVPEMGYDAL +
Sbjct  405   LRVVSCAHVLQGYGLTETCAGTFVSLPNELPMLGTVGPPVPNVDVFLESVPEMGYDALSS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLF+GY+KREDLT++V++DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICIRGKTLFAGYYKREDLTKEVLIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNSFESFLVAV  P ++AL  WAQ +  +G+F S
Sbjct  525   QGEYVAVENLENIYSLVSDIDSIWVYGNSFESFLVAVANPNQQALGHWAQEHGISGNFKS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N +A+K+IL EL   GK+ +L+GFE+++ VHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCENPEAKKFILGELTKIGKEKKLKGFELVKDVHLDPEPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY++ ID +YK A   +A
Sbjct  645   YYQNVIDNMYKSASKPNA  662



>ref|XP_010541632.1| PREDICTED: long chain acyl-CoA synthetase 4 [Tarenaya hassleriana]
Length=665

 Score =   373 bits (957),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/311 (60%), Positives = 233/311 (75%), Gaps = 2/311 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H E   F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  357   NMKKGHTHVEASPFFDKLVFNKVKQGLGGNVRIILSGAAPLASHVESFLRVVACSHVLQG  416

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + N   M GT G P+  ++ RLESVPEM YDALG+ PRGEIC+RGKT
Sbjct  417   YGLTESCAGTFVSLPNEVEMLGTVGPPVPNVDVRLESVPEMEYDALGSTPRGEICIRGKT  476

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LF+GY+KREDLT +V++DGW HTGDIGEWQPDG+MKIIDRKKNIFKLSQGEY+AVE+LE+
Sbjct  477   LFTGYYKREDLTNEVLIDGWLHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYIAVENLEN  536

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +  ++ ++WVYGNSF+SFLVAVV   ++ALE WA  N   GD+ SLC+N KA+++IL
Sbjct  537   VYGQVHVIDSIWVYGNSFKSFLVAVVNVSQQALEHWAVENGVDGDYSSLCENAKAKEFIL  596

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              ELN T K  +L+GFE ++AVHL+P  FD+ERDL+TPT+K KRPQLL YY+  ID++YK 
Sbjct  597   GELNKTAKAEKLKGFEFIKAVHLDPVAFDMERDLLTPTYKKKRPQLLKYYQSVIDEMYKT  656

Query  245   AKNVSA*NPSR  213
             A++  A  P R
Sbjct  657   AEDALA--PGR  665



>ref|XP_006300830.1| hypothetical protein CARUB_v10019918mg [Capsella rubella]
 gb|EOA33728.1| hypothetical protein CARUB_v10019918mg [Capsella rubella]
Length=660

 Score =   372 bits (955),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/320 (57%), Positives = 231/320 (72%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G   +  L         +N EKG  H++     D++ F K+K   GG VRL+LSGAAPL 
Sbjct  340   GGSIKKALFNFAFNYKHKNMEKGKTHEQASPICDKVVFKKVKEGLGGNVRLILSGAAPLA  399

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H E FLRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMG
Sbjct  400   AHIESFLRVVACAHVLQGYGLTESCGGSFVSIPNELAMLGTVGPPVPNVDIRLESVPEMG  459

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL + PRGEIC+RGKTLFSGY+KREDLT++V++DGW HTGD+GEWQPDGAMKIIDRKK
Sbjct  460   YDALASKPRGEICIRGKTLFSGYYKREDLTQEVLIDGWLHTGDVGEWQPDGAMKIIDRKK  519

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  
Sbjct  520   NIFKLSQGEYVAVENLENIYSHVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHNV  579

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             +GDF S+C+NQK +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K K
Sbjct  580   SGDFESICQNQKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKK  639

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQLL YY+  ID++Y + K
Sbjct  640   RPQLLKYYQKEIDEMYNKTK  659



>ref|XP_010324642.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X2 [Solanum 
lycopersicum]
Length=539

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 240/332 (72%), Gaps = 2/332 (1%)
 Frame = -2

Query  1235  YAHAQRIIYWRGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGR  1056
             Y+  Q+ I    G R  +TL  +      +  + G K+ E     D++ F K++   GG+
Sbjct  210   YSGLQQKI--SSGGRLRSTLFNIAYARKLQYLKDGCKYHEASPISDKVVFSKVRDGLGGK  267

Query  1055  VRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtT  876
             VRL+LSGAAPL  H E FLRV       QGY LTE+  G F  + N F M GT G P+  
Sbjct  268   VRLILSGAAPLSSHVEAFLRVVACAHVLQGYGLTETCAGTFVSLPNQFDMLGTVGPPVPN  327

Query  875   IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
             ++  L SVPEM YDAL + PRGEIC+RG TLFSGY+KREDLT++V++DGWFHTGDIGEWQ
Sbjct  328   VDVCLVSVPEMEYDALSSTPRGEICVRGDTLFSGYYKREDLTKEVLIDGWFHTGDIGEWQ  387

Query  695   PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
             P+G++KIIDR KNIFKLSQGEYVAVE+LE+ +   P++ +VWVYG+SFESFLVAVV P +
Sbjct  388   PNGSLKIIDRMKNIFKLSQGEYVAVENLENVFGNNPVIESVWVYGSSFESFLVAVVNPSK  447

Query  515   KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
             + +E WA+ N  +GDF SLC+N K +++IL EL   GK+ +L+GFE ++A+HL+P PFD+
Sbjct  448   QQVEKWAKQNSLSGDFNSLCENSKVKEHILGELTKVGKEKKLKGFEFIKALHLDPVPFDM  507

Query  335   ERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             ERDL+TPTFK KRPQLL YYKD ID +YK+AK
Sbjct  508   ERDLLTPTFKKKRPQLLKYYKDVIDTMYKDAK  539



>ref|XP_006391620.1| hypothetical protein EUTSA_v10023330mg [Eutrema salsugineum]
 gb|ESQ28906.1| hypothetical protein EUTSA_v10023330mg [Eutrema salsugineum]
Length=660

 Score =   372 bits (955),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL          N EKG  H++     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  346   TLFNFAFNYKHSNMEKGKPHEQAAPIFDKIVFKKVKEGLGGRVRLILSGAAPLAAHIESF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  406   LRVVACAHVLQGYGLTESCGGTFVSIPNELKMLGTVGPPVPNVDIRLESVPEMGYDALAS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLFSGY+KREDLT++V++DGW HTGD+GEWQPDGAMKIIDRKKNIFKLS
Sbjct  466   KPRGEICIRGKTLFSGYYKREDLTQEVLIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  +G+F S
Sbjct  526   QGEYVAVENLENIYSHVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHNVSGNFES  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+N K +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL 
Sbjct  586   ICQNAKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID++Y +AK
Sbjct  646   YYQKEIDEMYNKAK  659



>ref|XP_007040513.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 ref|XP_007040514.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 gb|EOY25014.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
 gb|EOY25015.1| AMP-dependent synthetase and ligase family protein isoform 1 
[Theobroma cacao]
Length=662

 Score =   372 bits (955),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 234/325 (72%), Gaps = 0/325 (0%)
 Frame = -2

Query  1202  GGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPL  1023
             GG   +  L  +  +    N  KG  H E     D++ F K+K   GGRVR++LSGAAPL
Sbjct  338   GGGLLKKKLFDVAYSYKYYNMRKGSNHREASPICDKVVFSKVKQGLGGRVRIILSGAAPL  397

Query  1022  PMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEM  843
               H EEFLRV       QGY LTES  G F  + +   M GT G P+  ++ RLESVPEM
Sbjct  398   SAHVEEFLRVVACCHVLQGYGLTESCAGTFVSLPDELSMLGTVGPPVPNVDIRLESVPEM  457

Query  842   GYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRK  663
             GYDAL + PRGEIC++G TLFSGY+KREDLT +V+VD WFHTGDIGEWQP+G+MK+IDRK
Sbjct  458   GYDALASTPRGEICIKGSTLFSGYYKREDLTNEVMVDEWFHTGDIGEWQPNGSMKVIDRK  517

Query  662   KNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNR  483
             KNIFKLSQGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ALE WA  N 
Sbjct  518   KNIFKLSQGEYVAVENLENIYGLVSDIDSIWVYGNSFESFLVAVVNPNKQALERWAAENG  577

Query  482   ETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKL  303
               GDF SLC+N KA+++IL EL   GK+ +L+GFE ++AVHL+P PFDIERDL+TPT+K 
Sbjct  578   VGGDFDSLCQNPKAKEFILGELAKIGKEKKLKGFEFIKAVHLDPEPFDIERDLLTPTYKK  637

Query  302   KRPQLLNYYKDCIDQLYKEAKNVSA  228
             KRPQLL YY+  ID +YK A+  +A
Sbjct  638   KRPQLLKYYQTVIDNMYKAARKPNA  662



>ref|XP_004511519.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Cicer arietinum]
Length=662

 Score =   372 bits (954),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 234/318 (74%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +       KG  H+      DR+ FDK+K   GG+VRL+LSGAAPL +H E +
Sbjct  345   TLFNFAYSYKSNKMMKGHNHEAASPLFDRIVFDKVKQGLGGKVRLILSGAAPLSVHVESY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++A LESVPEMGYDAL +
Sbjct  405   LRVVTCAHVLQGYGLTETCAGTFVSLPNQHGMLGTVGPPVPNVDACLESVPEMGYDALAS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++G TLFSGY+KREDLT++V++DGWFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICVKGDTLFSGYYKREDLTKEVLIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ + + P + ++WVYGNSFE+FLVAVV P ++ALE WA+ N  + DF S
Sbjct  525   QGEYVAVENLENIFGQVPSIESIWVYGNSFEAFLVAVVNPRKQALEHWAEQNGISMDFNS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+ YIL+EL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCEDSRAKGYILEELSKIGKEKKLKGFEFIKAVHLDPVPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAKNVSA  228
             +Y+  ID +YK      A
Sbjct  645   HYQSVIDNMYKSGSKPRA  662



>ref|XP_009346443.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Pyrus x bretschneideri]
Length=660

 Score =   372 bits (954),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 235/328 (72%), Gaps = 3/328 (1%)
 Frame = -2

Query  1223  QRIIYWRGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLM  1044
             QRI     G   + T+  +  +    N +KG  H +     D++ F K+K A GGRVRL+
Sbjct  336   QRI---SSGGFVKKTMFKLAYSYKYHNMQKGHGHAQASPIADKVVFSKVKQALGGRVRLI  392

Query  1043  LSGAAPLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEAR  864
             LSGAAPL  H E FLRV       QGY LTE+  G F  + N   M GT G P+  ++  
Sbjct  393   LSGAAPLSTHVEAFLRVVACAHVLQGYGLTETCSGTFVSLPNELSMLGTVGPPVPNVDVF  452

Query  863   LESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGA  684
             LESVPEMGYDAL   PRGE+C+RG TLFSGY+KREDLT++V +DGWFHTGD+GEWQPDG+
Sbjct  453   LESVPEMGYDALSDTPRGEVCVRGNTLFSGYYKREDLTKEVRLDGWFHTGDVGEWQPDGS  512

Query  683   MKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALE  504
             +KIIDRKKNIFKLSQGEYVA E+LE+ Y     + A+WVYGNSFESFLVAVV P ++A+E
Sbjct  513   LKIIDRKKNIFKLSQGEYVAAENLENIYGLVSHIDAIWVYGNSFESFLVAVVNPNKQAIE  572

Query  503   DWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDL  324
              WAQ N  +GDF+SLC N K +++IL ELN   K+ +L+GFE+++ VHL+P PFD+ERDL
Sbjct  573   SWAQQNGISGDFISLCGNAKVKEHILGELNKIAKEKKLKGFEVIKGVHLDPEPFDMERDL  632

Query  323   VTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             +TPT+K KRP+LL +YKD ID +YK  K
Sbjct  633   ITPTYKKKRPRLLKHYKDLIDNMYKSVK  660



>ref|XP_010533580.1| PREDICTED: LOW QUALITY PROTEIN: long chain acyl-CoA synthetase 
3 [Tarenaya hassleriana]
Length=659

 Score =   371 bits (952),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +       N EKG  H++     D++ F K+K   GGRVRL+LSGAAPL +H E F
Sbjct  345   TLFNLAFNYKNHNMEKGKPHEQASPICDKIVFKKVKEGLGGRVRLILSGAAPLAVHVESF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  + N   M GT G P+  ++ RLESVPEMGYD L +
Sbjct  405   LRVVACAHVLQGYGLTESCGGTFCSLPNEVGMLGTVGPPVPNVDIRLESVPEMGYDXLSS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RG TLFSGYHKR DLT +V+VDGW HTGD+GEWQ +G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICIRGXTLFSGYHKRTDLTDEVLVDGWLHTGDVGEWQANGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++W+YGNS+ESFLVAVV P R  LE WA++N  +GDF S
Sbjct  525   QGEYVAVENLENIYSHVAAIESMWIYGNSYESFLVAVVCPSRIQLEHWAKDNHISGDFDS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N  A+++IL EL+   K  +L+GFE+++ VHLEP PFD+ERDL+TP++K KRPQLL 
Sbjct  585   LCQNPTAKEFILAELSRIAKDKKLKGFEVIKDVHLEPVPFDMERDLLTPSYKKKRPQLLR  644

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID++Y +AK
Sbjct  645   YYQKVIDEMYNKAK  658



>ref|XP_011022505.1| PREDICTED: long chain acyl-CoA synthetase 4 [Populus euphratica]
Length=662

 Score =   370 bits (951),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 235/318 (74%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    + +KG+ H +     D++ F+K++   GG+VRL+LSGAAPL  H   F
Sbjct  345   TLFNVAYSHKFSSMKKGIAHHKASPICDKIVFNKVRQGLGGKVRLILSGAAPLSNHVGAF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N  PM GT G P+  ++  LESVPEMGYDAL +
Sbjct  405   LRVVSCAHVLQGYGLTETCAGTFASLPNELPMLGTVGPPVPNVDVCLESVPEMGYDALSS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLF+GY+KREDLT +V+ DGWFHTGDIGEWQPDG+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICIRGKTLFAGYYKREDLTEEVLNDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNSFESFL+AV  P ++ALE WAQ +   GDF S
Sbjct  525   QGEYVAVENLENIYSLVSDIDSIWVYGNSFESFLIAVANPNQQALEHWAQEHGIGGDFKS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N +A++YIL EL   GK+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCENPRAKEYILGELTKIGKEKKLKGFEFIKAIHLDPEPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY++ ID +YK A   SA
Sbjct  645   YYQNVIDNMYKSASKPSA  662



>ref|XP_011101042.1| PREDICTED: long chain acyl-CoA synthetase 4 [Sesamum indicum]
Length=658

 Score =   370 bits (951),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/314 (57%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             T+  +  +   R+  KG KH E     D++ F K+K   GG VRL+LSGAAPL  H EEF
Sbjct  345   TMFNLAYSLKLRSMRKGRKHTEASPLCDKIVFSKVKQGLGGNVRLILSGAAPLASHVEEF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV  G    QGY LTE+  G F  I +   M GT G P+  ++  LESVPEMGYDAL +
Sbjct  405   LRVVSGSYVLQGYGLTETCAGTFVSIPDELSMLGTVGPPVPNVDVCLESVPEMGYDALSS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C+RG TLFSGY+KR+DLT++V VDGWFHTGD+GEWQ +G++KIIDRKKNIFKLS
Sbjct  465   TPRGEVCVRGDTLFSGYYKRDDLTKEVFVDGWFHTGDVGEWQANGSLKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y   P + ++W+YGNSFESFLVA++ P ++ +E WA+ N  +GDF +
Sbjct  525   QGEYVAVENLENIYGLVPAIDSIWIYGNSFESFLVAIINPNKQVVEQWAEENGVSGDFNA  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N K ++Y L EL+   K+ +L+GFE ++AVHL+P PFD+ERDL+TPTFK KRPQLL 
Sbjct  585   LCENPKVKEYFLGELSRIAKEKKLKGFEFIKAVHLDPVPFDMERDLITPTFKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID +YK  K
Sbjct  645   YYQGVIDSMYKSGK  658



>ref|XP_002872543.1| hypothetical protein ARALYDRAFT_352166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48802.1| hypothetical protein ARALYDRAFT_352166 [Arabidopsis lyrata subsp. 
lyrata]
Length=666

 Score =   371 bits (952),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 229/306 (75%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCNVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVPEM YDALG+ PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGDIGEWQP+G+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDIGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS+  ++ ++WVYGNSFESFLVA+  P ++ LE WA  N   GDF SLC+N KA+ +IL
Sbjct  538   VYSQVEVIESIWVYGNSFESFLVAIANPAQQTLERWAVENGVNGDFNSLCQNAKAKAFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL    K+ +L+GFE+++A+HLEP  FD+ERDL+TPT+K KRPQLL YY++ ID++YK 
Sbjct  598   GELVKIAKEKKLKGFEIIKAIHLEPVAFDMERDLLTPTYKKKRPQLLKYYQNVIDEMYKA  657

Query  245   AKNVSA  228
             AK   A
Sbjct  658   AKEGQA  663



>ref|XP_010473705.1| PREDICTED: long chain acyl-CoA synthetase 3-like [Camelina sativa]
Length=660

 Score =   370 bits (950),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL        ++N EKG  H +     D++ F K+K   GG VRL+LSGAAPL  H E F
Sbjct  346   TLFNFAFNHKQKNMEKGKTHTQASPLADKVVFKKVKEGLGGNVRLILSGAAPLAAHIESF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  406   LRVVACAHVLQGYGLTESCGGTFVSIPNELAMLGTVGPPVPNVDIRLESVPEMGYDALAS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C+RGKTLFSGY+KREDLT++V++DGW HTGD+GEWQPDGA+KIIDRKKNIFKLS
Sbjct  466   KPRGEVCIRGKTLFSGYYKREDLTQEVLIDGWLHTGDVGEWQPDGALKIIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  +GDF S
Sbjct  526   QGEYVAVENLENIYSHVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHNVSGDFES  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+N K +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL 
Sbjct  586   ICQNPKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID++Y +AK
Sbjct  646   YYQKEIDEMYNKAK  659



>ref|XP_012086726.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Jatropha curcas]
Length=662

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/303 (61%), Positives = 228/303 (75%), Gaps = 0/303 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             KG  HDE     D++ FDK+K   GGRVRL++SGAAPL  H E FLRV+      QGY L
Sbjct  360   KGHSHDEASPICDKIVFDKVKQGLGGRVRLLISGAAPLATHIETFLRVSSCAHVLQGYGL  419

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+  G F  I N   M GT G+P+   +  LESVPEM YDAL + PRGEIC+RG TLFS
Sbjct  420   TETCAGTFISIPNEMSMLGTVGLPVPNSDVCLESVPEMNYDALASTPRGEICVRGSTLFS  479

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY+KREDLT++V++DGWFHTGDIGEWQ DG++KIIDRKKNIFKLSQGEYVAVE LE+ + 
Sbjct  480   GYYKREDLTKEVLIDGWFHTGDIGEWQSDGSLKIIDRKKNIFKLSQGEYVAVEKLENVFC  539

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 V ++WVYGNSFESFLVAVV P ++ALE+WA+ N   GDF SLC+N KA+++ L EL
Sbjct  540   LASSVDSIWVYGNSFESFLVAVVNPNKQALENWAKENGINGDFKSLCENPKAKEFTLGEL  599

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAKN  237
               T ++++L+GFE ++AVHL+P PFDI+RDL+TPT+K KRPQLL YY+D I  +YK A  
Sbjct  600   TMTARENKLKGFEFIKAVHLDPEPFDIQRDLLTPTYKKKRPQLLKYYQDIIANMYKSASK  659

Query  236   VSA  228
              SA
Sbjct  660   PSA  662



>gb|AFD33346.1| acyl-activating enzyme 2 [Cannabis sativa]
Length=662

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 230/313 (73%), Gaps = 0/313 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N  KGLKH +     D++ F K+K   GG VRL+LSGAAPL  H E +
Sbjct  345   TLFNFAYSRKYNNMRKGLKHGDAAPLCDKIVFSKVKQGLGGNVRLILSGAAPLAPHVEAY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  I N  PM GT G P+  ++  LESVPEMGYDAL  
Sbjct  405   LRVVTCAHVCQGYGLTETCAGTFVSIPNELPMLGTVGPPVPNVDVCLESVPEMGYDALAE  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             VPRGE+C++G TLFSGY+KREDLT++V++DGWFHTGD+GEWQ DG++KIIDRKKNIFKLS
Sbjct  465   VPRGEVCVKGSTLFSGYYKREDLTKEVMIDGWFHTGDVGEWQADGSLKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAV+ P ++ALE WA  N  +GDF S
Sbjct  525   QGEYVAVENLENIYGLVSDIDSIWVYGNSFESFLVAVINPNQQALERWAGENNISGDFKS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+N +A++YIL ELN  GK+ +L+GFE +RAVHL+P  FDIERDL+TPT+K KRPQLL 
Sbjct  585   ICENPRAKEYILGELNKIGKEKKLKGFEFIRAVHLDPEAFDIERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEA  243
             YY+  ID +YKE 
Sbjct  645   YYQSVIDNMYKEG  657



>gb|KJB39707.1| hypothetical protein B456_007G026300 [Gossypium raimondii]
 gb|KJB39708.1| hypothetical protein B456_007G026300 [Gossypium raimondii]
Length=663

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 184/318 (58%), Positives = 233/318 (73%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N   G KH E   F DR+ F ++K   GG +R++LSGAAPL  H EEF
Sbjct  346   TLFNVAYSFKFYNMRNGSKHAEASPFSDRIVFSQVKERLGGNLRIILSGAAPLSSHVEEF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + +   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  406   LRVVACCHVMQGYGLTETCAGTFVSLPHELSMLGTVGPPVPNVDVRLESVPEMGYDALAS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEICL+G TLFSGY KREDLT++V++DGWFHTGDIGEWQP+G+MK+IDRKKNIFKLS
Sbjct  466   TPRGEICLKGTTLFSGYFKREDLTKEVMIDGWFHTGDIGEWQPNGSMKVIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFES+LVAVV P ++ALE WA +N  +GDF +
Sbjct  526   QGEYVAVENLENVYGCVSDIESIWVYGNSFESYLVAVVNPNKQALERWAADNGVSGDFET  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +CK+ KA++YIL EL  TGK+ QL+GFE ++AVHL+  PFD++RDL+TPTFK KRPQLL 
Sbjct  586   ICKDPKAKEYILGELTRTGKEKQLKGFEFIKAVHLDHVPFDMDRDLLTPTFKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY+  ID +YK     +A
Sbjct  646   YYQSVIDDMYKSINKPNA  663



>ref|XP_010418506.1| PREDICTED: long chain acyl-CoA synthetase 3 [Camelina sativa]
Length=660

 Score =   370 bits (949),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL        ++N EKG  H +     D++ F K+K   GG VRL+LSGAAPL  H E F
Sbjct  346   TLFNFAFNHKQKNMEKGKTHTQASPLADKVVFKKVKEGLGGNVRLILSGAAPLAAHIESF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  406   LRVVACAHVLQGYGLTESCGGTFVSIPNELAMLGTVGPPVPNVDIRLESVPEMGYDALAS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C+RGKTLFSGY+KREDLT++V++DGW HTGD+GEWQPDGA+KIIDRKKNIFKLS
Sbjct  466   KPRGEVCIRGKTLFSGYYKREDLTQEVLIDGWLHTGDVGEWQPDGALKIIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  +GDF S
Sbjct  526   QGEYVAVENLENIYSHVAAIESIWVYGNSYESYLVAVVCPSKIHIEHWAKEHNVSGDFES  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+N K +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL 
Sbjct  586   ICQNPKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID++Y +AK
Sbjct  646   YYQKEIDEMYNKAK  659



>ref|XP_004964795.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X2 [Setaria 
italica]
Length=612

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 234/314 (75%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +       +  KG+KH++   F D+L F K+K   GG++R+++SG APL +  EEF
Sbjct  299   TLFNIAYKMKLDSMRKGIKHEKAAPFFDKLVFSKVKERLGGKLRVIVSGGAPLAVPVEEF  358

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G    I N +PM GT G P+  I+ RLESVPEMGYDAL +
Sbjct  359   LRVVTCAYVIQGYGLTETCAGSIVSIPNEYPMLGTVGPPIQHIDVRLESVPEMGYDALSS  418

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             +PRGEIC+RG  LFSGY+KREDLT++V++DGWFHTGD+GEWQPDG++K+IDRKKNIFKLS
Sbjct  419   IPRGEICIRGSVLFSGYYKREDLTQEVMIDGWFHTGDVGEWQPDGSLKVIDRKKNIFKLS  478

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ LE WA+ N  TG F  
Sbjct  479   QGEYVAVENLENVYGVLQEIDSIWVYGNSFESFLVAVVNPNQQVLEHWAEQNGITGSFAK  538

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LCKN +A+ +IL EL   GK+ +LRGFE+++A+HL+P PFDIERDL+TPT+K KRPQ+L 
Sbjct  539   LCKNPRAKDHILAELIKIGKEKKLRGFELIKAIHLDPLPFDIERDLITPTYKKKRPQMLK  598

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID LYK +K
Sbjct  599   YYQGEIDALYKGSK  612



>gb|KEH27413.1| long-chain fatty acyl CoA ligase [Medicago truncatula]
Length=648

 Score =   369 bits (948),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 228/303 (75%), Gaps = 0/303 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KG  H      LD++ FDK+K   GG VRL+LSGAAPL +H E +
Sbjct  345   TLFNFAYSYKLNNMKKGQNHAVASPLLDKIVFDKVKQGLGGSVRLILSGAAPLSLHVESY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++A LESVPEMGYDAL +
Sbjct  405   LRVVTCAHVLQGYGLTETCAGTFVSLPNELDMLGTVGPPVPNVDACLESVPEMGYDALAS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++G TLFSGY+KREDLT++V+VDGWFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICVKGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS+ P V ++WVYGNSFE+FLVAVV P + ALE WA+ N  + DF S
Sbjct  525   QGEYVAVENLENIYSQVPSVESIWVYGNSFEAFLVAVVNPSKPALEHWAEENGISVDFNS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC + +A+ YILDEL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCGDSRAKGYILDELSKIGKEKKLKGFEFIKAVHLDPVPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYK  273
             YY+
Sbjct  645   YYQ  647



>ref|XP_010430575.1| PREDICTED: long chain acyl-CoA synthetase 3-like [Camelina sativa]
Length=660

 Score =   370 bits (949),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL        ++N EKG  H +     D++ F K+K   GG VRL+LSGAAPL  H E F
Sbjct  346   TLFNFAFNHKQKNMEKGKTHTQASPLADKVVFKKVKEGLGGNVRLILSGAAPLAAHIESF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  406   LRVVACAHVLQGYGLTESCGGTFVSIPNELAMLGTVGPPVPNVDIRLESVPEMGYDALAS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C+RGKTLFSGY+KREDLT++V++DGW HTGD+GEWQPDGA+KIIDRKKNIFKLS
Sbjct  466   KPRGEVCIRGKTLFSGYYKREDLTQEVLIDGWLHTGDVGEWQPDGALKIIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  +GDF S
Sbjct  526   QGEYVAVENLENIYSHVAAIESIWVYGNSYESYLVAVVCPSQIQIEHWAKEHNVSGDFES  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+N K +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL 
Sbjct  586   ICQNPKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID++Y +AK
Sbjct  646   YYQKEIDEMYNKAK  659



>ref|XP_007158575.1| hypothetical protein PHAVU_002G164000g [Phaseolus vulgaris]
 gb|ESW30569.1| hypothetical protein PHAVU_002G164000g [Phaseolus vulgaris]
Length=658

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 232/314 (74%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KG  H E     D++ F+K+K   GGRVRL+LSGAAPL  H E +
Sbjct  345   TLFNCAYSYKLNNMKKGFTHGEASPICDKIVFEKVKQGLGGRVRLILSGAAPLSAHVEGY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL +
Sbjct  405   LRVVACCHVLQGYGLTETCAGTFVSLPNEMEMLGTVGPPVPNVDVCLESVPEMGYDALAS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++GKTLFSGY+KREDLT++V++D WFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICVKGKTLFSGYYKREDLTKEVLIDEWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y +   + ++WVYGNSFE+FLVAV+ P ++ALE WAQ N  + DF S
Sbjct  525   QGEYVAVENLENIYGQVSSIESIWVYGNSFEAFLVAVINPRKEALEQWAQENGISMDFNS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+ YIL+EL+  GK  +L+GFE ++ VHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCEDARAKSYILEELSKIGKAKKLKGFEFIKGVHLDPIPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAK  240
             +Y++ ID +YK  K
Sbjct  645   FYQNVIDNMYKSGK  658



>ref|XP_009618994.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana tomentosiformis]
Length=657

 Score =   369 bits (947),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 236/320 (74%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G R  +TL  +      +  + G K+ E     D++ F K+K   GG+VRL+LSGAAPL 
Sbjct  338   GGRLRSTLFNIAYARKLQYLKSGCKYHEASPISDKVVFSKVKDGLGGKVRLILSGAAPLS  397

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H E FLRV       QGY LTE+  G F  + N F M GT G P+  ++  LESVPEM 
Sbjct  398   SHVEAFLRVVACAHVLQGYGLTETCAGTFVSLPNQFDMLGTVGPPVPNVDVCLESVPEME  457

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL + PRGEIC+RG T+FSGY+KREDLT++V++DGWFHTGDIGEWQP+G++KIIDRKK
Sbjct  458   YDALSSTPRGEICVRGDTVFSGYYKREDLTKEVMIDGWFHTGDIGEWQPNGSLKIIDRKK  517

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ Y   P++ ++W+YG+SFESFLVAVV P ++ +E WA+ N  
Sbjct  518   NIFKLSQGEYVAVENLENIYGNNPVIDSIWIYGSSFESFLVAVVNPNKQEVEKWAKQNGV  577

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             +GDF SLC+N K +++IL EL    K+ +L+GFE ++A+HL+P PFD+ERDL+TPTFK K
Sbjct  578   SGDFNSLCENSKVKEHILGELTKAAKEKKLKGFEFIKALHLDPVPFDMERDLLTPTFKKK  637

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQLL YYKD ID +YK+AK
Sbjct  638   RPQLLKYYKDVIDTMYKDAK  657



>ref|XP_010087270.1| Long chain acyl-CoA synthetase 4 [Morus notabilis]
 gb|EXB28672.1| Long chain acyl-CoA synthetase 4 [Morus notabilis]
Length=670

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 234/326 (72%), Gaps = 8/326 (2%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRV--------RLMLSGAAP  1026
             TL  +     + + +KG KH+E     D++ F K+K   GG V        RL+LSGAAP
Sbjct  345   TLFNLAYALKQHSMQKGRKHEEASPIFDKIVFSKVKEGLGGNVKEGLGGNVRLILSGAAP  404

Query  1025  LPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPE  846
             L  H E FLRV       QGY LTE+  G F  + N   M GT G P+  ++ RLESVPE
Sbjct  405   LSTHVEAFLRVVTCAHVLQGYGLTETCAGTFVSLPNEMSMLGTVGPPVPNVDVRLESVPE  464

Query  845   MGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDR  666
             MGYDAL  VPRGE+C++G  LFSGY+KREDLT +VVVDGWFHTGDIGEWQP+G++KIIDR
Sbjct  465   MGYDALAEVPRGEVCVKGSPLFSGYYKREDLTSEVVVDGWFHTGDIGEWQPNGSLKIIDR  524

Query  665   KKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNN  486
             KKNIFKLSQGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ALE WA+ N
Sbjct  525   KKNIFKLSQGEYVAVENLENIYGVVSDIDSLWVYGNSFESFLVAVVNPNKQALECWAEEN  584

Query  485   RETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFK  306
               +GDF SLC++ +A++YI+ ELN   K+ +L+GFE ++AVHLEP PFDI+RDL+TPT+K
Sbjct  585   HISGDFESLCEDPRAKEYIIGELNKVAKEKKLKGFEFIKAVHLEPVPFDIDRDLITPTYK  644

Query  305   LKRPQLLNYYKDCIDQLYKEAKNVSA  228
              KRPQLL YY++ ID +YK A    A
Sbjct  645   KKRPQLLKYYQNAIDNMYKSANKPKA  670



>ref|XP_002886345.1| hypothetical protein ARALYDRAFT_474909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62604.1| hypothetical protein ARALYDRAFT_474909 [Arabidopsis lyrata subsp. 
lyrata]
Length=663

 Score =   369 bits (947),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 228/306 (75%), Gaps = 0/306 (0%)
 Frame = -2

Query  1151  RRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*S  972
              +N  KG  H++     DR+ F K+K   GG VRL+LSGAAPL  H E FLRV       
Sbjct  356   HKNMTKGQPHEQASPMADRVVFKKVKEGLGGNVRLILSGAAPLAAHIESFLRVVACAHVL  415

Query  971   QGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRG  792
             QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL + PRGEIC+RG
Sbjct  416   QGYGLTESCGGTFVSIPNELSMLGTVGPPVPNVDIRLESVPEMGYDALASNPRGEICIRG  475

Query  791   KTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESL  612
             KTLFSGY+KREDLT++V++DGW HTGD+GEWQPDGAMKIIDRKKNIFKLSQGEYVAVE+L
Sbjct  476   KTLFSGYYKREDLTQEVLIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLSQGEYVAVENL  535

Query  611   ESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKY  432
             E+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  +GDF S+C+NQK +++
Sbjct  536   ENIYSHVAAIESLWVYGNSYESYLVAVVCPSKIQIEHWAKEHSVSGDFESICRNQKTKEF  595

Query  431   ILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLY  252
             IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL YY+  ID++Y
Sbjct  596   ILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLKYYQKEIDKMY  655

Query  251   KEAKNV  234
              + K +
Sbjct  656   NKDKQL  661



>ref|XP_004969551.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Setaria 
italica]
Length=673

 Score =   369 bits (948),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 233/304 (77%), Gaps = 1/304 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH+E     D++ F K+K   GGRVRL+LSGAAPL  H EE+
Sbjct  348   TLFNVAYKYKQGNMLKGSKHEEAAAVFDKVVFSKVKQGLGGRVRLILSGAAPLSRHVEEY  407

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  +E RLESVPEMGYDAL +
Sbjct  408   LRVVTCSHVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVRLESVPEMGYDALSS  467

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
              +PRGEIC+RG TLFSGY+KREDLT++V+VDGWFHTGDIGEWQPDG+MKIIDRKKNIFKL
Sbjct  468   EMPRGEICIRGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQPDGSMKIIDRKKNIFKL  527

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V +VWVYGNSFES LVAVV P ++ALE WA++N  TG+F 
Sbjct  528   SQGEYVAVENLENIFGQTPGVDSVWVYGNSFESSLVAVVNPNKQALERWAESNGVTGEFA  587

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             ++C++ KA+++IL EL   GK+ +L+GFE++RAVHL+P PFD+ERDL+TPT+K KRPQLL
Sbjct  588   TICEDPKAKEFILGELTKMGKEKKLKGFELIRAVHLDPVPFDMERDLITPTYKKKRPQLL  647

Query  284   NYYK  273
              YY+
Sbjct  648   KYYQ  651



>ref|XP_004964794.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Setaria 
italica]
Length=649

 Score =   368 bits (945),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 234/314 (75%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +       +  KG+KH++   F D+L F K+K   GG++R+++SG APL +  EEF
Sbjct  336   TLFNIAYKMKLDSMRKGIKHEKAAPFFDKLVFSKVKERLGGKLRVIVSGGAPLAVPVEEF  395

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G    I N +PM GT G P+  I+ RLESVPEMGYDAL +
Sbjct  396   LRVVTCAYVIQGYGLTETCAGSIVSIPNEYPMLGTVGPPIQHIDVRLESVPEMGYDALSS  455

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             +PRGEIC+RG  LFSGY+KREDLT++V++DGWFHTGD+GEWQPDG++K+IDRKKNIFKLS
Sbjct  456   IPRGEICIRGSVLFSGYYKREDLTQEVMIDGWFHTGDVGEWQPDGSLKVIDRKKNIFKLS  515

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAVV P ++ LE WA+ N  TG F  
Sbjct  516   QGEYVAVENLENVYGVLQEIDSIWVYGNSFESFLVAVVNPNQQVLEHWAEQNGITGSFAK  575

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LCKN +A+ +IL EL   GK+ +LRGFE+++A+HL+P PFDIERDL+TPT+K KRPQ+L 
Sbjct  576   LCKNPRAKDHILAELIKIGKEKKLRGFELIKAIHLDPLPFDIERDLITPTYKKKRPQMLK  635

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID LYK +K
Sbjct  636   YYQGEIDALYKGSK  649



>ref|XP_006590492.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X5 [Glycine 
max]
Length=542

 Score =   365 bits (936),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 232/313 (74%), Gaps = 0/313 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KGL+H E    LD++ FDK+K   GGRVRL+LSGAAPL  H E +
Sbjct  224   TLFNFAYSYKLNNMKKGLRHGEASPLLDKIVFDKVKQGLGGRVRLILSGAAPLSAHVEGY  283

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+   +  LESVP+MGY+AL T
Sbjct  284   LRVVTCAHVLQGYGLTETCAGTFVSLPNEIEMLGTVGPPVPNGDVCLESVPDMGYNALAT  343

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEICL+GKTLF+GY+K EDLT++V++D WFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  344   TPRGEICLKGKTLFAGYYKCEDLTKEVLIDEWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  403

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y +   + ++WVYGNSFE+FLVAVV P ++ALE WAQ N  + DF S
Sbjct  404   QGEYVAVENLENIYGQVSSIESIWVYGNSFEAFLVAVVNPSKQALEHWAQENGISMDFNS  463

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+ YIL+EL+   K+ +L+GFE ++AVH++P  FD+ERDL+TPT+K KRPQLL 
Sbjct  464   LCEDARAKSYILEELSKIAKEKKLKGFEFIKAVHIDPIQFDMERDLITPTYKKKRPQLLK  523

Query  281   YYKDCIDQLYKEA  243
             YY++ ID +YK  
Sbjct  524   YYQNAIDNMYKSG  536



>ref|XP_006590491.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X4 [Glycine 
max]
Length=575

 Score =   365 bits (938),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 232/313 (74%), Gaps = 0/313 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KGL+H E    LD++ FDK+K   GGRVRL+LSGAAPL  H E +
Sbjct  257   TLFNFAYSYKLNNMKKGLRHGEASPLLDKIVFDKVKQGLGGRVRLILSGAAPLSAHVEGY  316

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+   +  LESVP+MGY+AL T
Sbjct  317   LRVVTCAHVLQGYGLTETCAGTFVSLPNEIEMLGTVGPPVPNGDVCLESVPDMGYNALAT  376

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEICL+GKTLF+GY+K EDLT++V++D WFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  377   TPRGEICLKGKTLFAGYYKCEDLTKEVLIDEWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  436

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y +   + ++WVYGNSFE+FLVAVV P ++ALE WAQ N  + DF S
Sbjct  437   QGEYVAVENLENIYGQVSSIESIWVYGNSFEAFLVAVVNPSKQALEHWAQENGISMDFNS  496

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+ YIL+EL+   K+ +L+GFE ++AVH++P  FD+ERDL+TPT+K KRPQLL 
Sbjct  497   LCEDARAKSYILEELSKIAKEKKLKGFEFIKAVHIDPIQFDMERDLITPTYKKKRPQLLK  556

Query  281   YYKDCIDQLYKEA  243
             YY++ ID +YK  
Sbjct  557   YYQNAIDNMYKSG  569



>dbj|BAJ88757.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   368 bits (945),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 232/315 (74%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH++     D+L F K+K   GGRVR++LSGAAPL  H EEF
Sbjct  353   TLFNVAYKYKQGNMIKGSKHEDAASIFDKLVFTKVKRGLGGRVRVILSGAAPLSNHVEEF  412

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  +E  LESVPEMGYDAL  
Sbjct  413   LRVVTCSHVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVHLESVPEMGYDALSK  472

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGY+KREDLT++V+VDGWFHTGDIGEWQ DG+MKIIDRKKNIFKL
Sbjct  473   ESPRGEICIRGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQYDGSMKIIDRKKNIFKL  532

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAV+ P ++ LE WA  N  +GDF 
Sbjct  533   SQGEYVAVENLENIFGQAPNVDSIWVYGNSFESCLVAVINPNKQGLERWAGLNGVSGDFA  592

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             S+C + KA+++IL+EL+ TGK  +L+GFEM+RAVHLEP  FD+ERDL+TPT+K KRPQLL
Sbjct  593   SICGDPKAKEFILEELSKTGKDKKLKGFEMIRAVHLEPVLFDMERDLITPTYKKKRPQLL  652

Query  284   NYYKDCIDQLYKEAK  240
              YY+  ID +YK  K
Sbjct  653   KYYQGIIDDMYKSMK  667



>emb|CDY25270.1| BnaA02g21860D [Brassica napus]
Length=659

 Score =   368 bits (944),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 227/302 (75%), Gaps = 2/302 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  353   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  412

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP+M YDALG+ PRGEIC+RGKT
Sbjct  413   YGLTESCAGTFVTFPDDLDMLGTVGPPVPNVDIRLESVPDMEYDALGSTPRGEICIRGKT  472

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGYHKREDLT++V++DGWFHTGD+GEWQPDG+MKIIDRKKNIFKL+QGEYVAVESLE+
Sbjct  473   LFSGYHKREDLTKEVLIDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLAQGEYVAVESLEN  532

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + +VWVYGNSFESFL+AVV P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  533   VYGQVEAIDSVWVYGNSFESFLIAVVNPTQRTLESWAVENGVDGDFNSICQNAKAKAFIL  592

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL   G++ ++  FE++RAVHLEP  FDIERDL+TPT+K KRPQLL YY++ ID++YK 
Sbjct  593   GELVKAGRERKV--FEIIRAVHLEPVAFDIERDLLTPTYKTKRPQLLKYYQNVIDEIYKA  650

Query  245   AK  240
             AK
Sbjct  651   AK  652



>gb|EMS57118.1| Long chain acyl-CoA synthetase 4 [Triticum urartu]
Length=690

 Score =   369 bits (946),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 237/329 (72%), Gaps = 15/329 (5%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +     + N  KG KH++     D+L F K+K   GGRVR++LSGAAPL  H EEF
Sbjct  362   TLFNVAYKYKQGNMIKGSKHEDAASIFDKLVFTKVKRGLGGRVRVILSGAAPLSNHVEEF  421

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  +E RLESVPEMGYDAL  
Sbjct  422   LRVVTCSHVLQGYGLTETCAGSFVSLPNNMSMLGTVGPPVPYVEVRLESVPEMGYDALSK  481

Query  821   -VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
               PRGEIC+RG TLFSGY+KREDLT++V+VDGWFHTGDIGEWQ DG+MKIIDRKKNIFKL
Sbjct  482   ESPRGEICIRGDTLFSGYYKREDLTKEVLVDGWFHTGDIGEWQHDGSMKIIDRKKNIFKL  541

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ + + P V ++WVYGNSFES LVAV+ P ++ LE WA++N  +GDF 
Sbjct  542   SQGEYVAVENLENIFGQAPNVDSIWVYGNSFESCLVAVINPNKQGLERWAESNGVSGDFA  601

Query  464   SLCKNQKARKYILDELNNTGKK--------------HQLRGFEMLRAVHLEPTPFDIERD  327
             S+C + KA+++IL+EL+ TGK+               QL+GFEM+RAVHLEP  FD+ERD
Sbjct  602   SICGDAKAKEFILEELSKTGKEKKIYLRHDRSLILLQQLKGFEMIRAVHLEPVLFDMERD  661

Query  326   LVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             L+TPT+K KRPQLL YY+  ID++YK  K
Sbjct  662   LITPTYKKKRPQLLKYYQGIIDEMYKSMK  690



>gb|ABA00145.1| ACS-like protein [Gossypium hirsutum]
Length=663

 Score =   367 bits (943),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 232/318 (73%), Gaps = 0/318 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N   G KH E   F DR+ F ++K   GG +R++LSGAAPL  H EEF
Sbjct  346   TLFNVAYSFKFYNMRNGSKHAEASPFSDRIVFSQVKERLGGNLRIILSGAAPLSSHVEEF  405

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + +   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  406   LRVVACCHVMQGYGLTETCAGTFVSLPHELSMLGTVGPPVPNVDVRLESVPEMGYDALAS  465

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEICL+G TLFSGY KREDLT++V++DGWFHTGDIGEWQP+G+MK+IDRKKNIFKLS
Sbjct  466   TPRGEICLKGTTLFSGYFKREDLTKEVMIDGWFHTGDIGEWQPNGSMKVIDRKKNIFKLS  525

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFES+LVAVV P ++ALE WA +N  +GDF +
Sbjct  526   QGEYVAVENLENVYGCVSDIESIWVYGNSFESYLVAVVNPNKQALERWAADNGVSGDFET  585

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +CK+ KA++YIL EL  TGK+ QL+GFE ++AVHL+  PFD++RDL+TPTFK KRPQLL 
Sbjct  586   ICKDPKAKEYILGELTRTGKEKQLKGFEFIKAVHLDHVPFDMDRDLLTPTFKKKRPQLLK  645

Query  281   YYKDCIDQLYKEAKNVSA  228
             YY+  ID +Y      +A
Sbjct  646   YYQSVIDDMYNSINKPNA  663



>ref|XP_004244632.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324640.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324641.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Solanum 
lycopersicum]
Length=657

 Score =   367 bits (942),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 240/332 (72%), Gaps = 2/332 (1%)
 Frame = -2

Query  1235  YAHAQRIIYWRGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGR  1056
             Y+  Q+ I    G R  +TL  +      +  + G K+ E     D++ F K++   GG+
Sbjct  328   YSGLQQKI--SSGGRLRSTLFNIAYARKLQYLKDGCKYHEASPISDKVVFSKVRDGLGGK  385

Query  1055  VRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtT  876
             VRL+LSGAAPL  H E FLRV       QGY LTE+  G F  + N F M GT G P+  
Sbjct  386   VRLILSGAAPLSSHVEAFLRVVACAHVLQGYGLTETCAGTFVSLPNQFDMLGTVGPPVPN  445

Query  875   IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
             ++  L SVPEM YDAL + PRGEIC+RG TLFSGY+KREDLT++V++DGWFHTGDIGEWQ
Sbjct  446   VDVCLVSVPEMEYDALSSTPRGEICVRGDTLFSGYYKREDLTKEVLIDGWFHTGDIGEWQ  505

Query  695   PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
             P+G++KIIDR KNIFKLSQGEYVAVE+LE+ +   P++ +VWVYG+SFESFLVAVV P +
Sbjct  506   PNGSLKIIDRMKNIFKLSQGEYVAVENLENVFGNNPVIESVWVYGSSFESFLVAVVNPSK  565

Query  515   KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
             + +E WA+ N  +GDF SLC+N K +++IL EL   GK+ +L+GFE ++A+HL+P PFD+
Sbjct  566   QQVEKWAKQNSLSGDFNSLCENSKVKEHILGELTKVGKEKKLKGFEFIKALHLDPVPFDM  625

Query  335   ERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
             ERDL+TPTFK KRPQLL YYKD ID +YK+AK
Sbjct  626   ERDLLTPTFKKKRPQLLKYYKDVIDTMYKDAK  657



>ref|XP_010422032.1| PREDICTED: long chain acyl-CoA synthetase 5-like [Camelina sativa]
Length=666

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 226/306 (74%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVPEM YDALG+ PRGEIC+RG T
Sbjct  418   YGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGNT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS+   + +VWVYGNSFESFLVAV  P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  538   IYSQVEAIDSVWVYGNSFESFLVAVANPAQQTLERWAVENGVNGDFNSICQNAKAKAFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K+ +L+GFE+++AVHLEP  FD+ERDL+TPT+K KRPQLL YY+  ID++YK 
Sbjct  598   GELVKTAKEKKLKGFEIIKAVHLEPVAFDMERDLLTPTYKKKRPQLLKYYQSVIDEMYKT  657

Query  245   AKNVSA  228
              K   A
Sbjct  658   TKEGQA  663



>gb|KCW77379.1| hypothetical protein EUGRSUZ_D01734 [Eucalyptus grandis]
Length=654

 Score =   366 bits (940),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 232/318 (73%), Gaps = 5/318 (2%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    +  KG K+ E     DR  F+K+K   GG VRL+LSGAAPL  H E F
Sbjct  342   TLFNFAYSYKLNSLRKGNKYGEAAPLFDRFVFNKVKQGLGGNVRLILSGAAPLSNHVEAF  401

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL +
Sbjct  402   LRVVTCAHVLQGYGLTETCAGTFVSLPNAHSMLGTVGPPVPNVDVCLESVPEMGYDALSS  461

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++GKTLFSGYHKREDLT++VVVDGWFHTGD+GEWQPDG+++IIDRKKNIFKLS
Sbjct  462   TPRGEVCVKGKTLFSGYHKREDLTKEVVVDGWFHTGDVGEWQPDGSLRIIDRKKNIFKLS  521

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++W+YG+SFESFLVAVV P ++ALE WAQ N  +GDF S
Sbjct  522   QGEYVAVENLENIYDLVSAIDSIWIYGSSFESFLVAVVNPNKEALEKWAQENGVSGDFNS  581

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N KA+++I+ EL  TGK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  582   LCENPKAKEFIIGELAKTGKEKKLKGFEFIKAVHLDPVPFDMERDLLTPTYKKKRPQLLK  641

Query  281   YYKDCIDQLYKEAKNVSA  228
             YYK     +Y+ A   SA
Sbjct  642   YYK-----MYESANKPSA  654



>gb|AFW85771.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=451

 Score =   359 bits (922),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 229/320 (72%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G   + TL  +       N  KG+KH++   F D+L F K+K   GG++R+++SG APL 
Sbjct  132   GGMLKKTLFNIAYKMKLGNMRKGIKHEKAAPFFDKLVFSKVKERLGGKLRVIVSGGAPLA  191

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
             +  EEFLRV       QGY LTE+  G    I N   M GT G P+  I+ RLESVPEMG
Sbjct  192   VPVEEFLRVVTCAYVVQGYGLTETCAGSIVSIPNEHSMLGTVGPPVQHIDVRLESVPEMG  251

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL +VPRGEIC+RG  LFSGY+KREDL ++V++DGWFHTGDIGEWQPDG++K+IDRKK
Sbjct  252   YDALSSVPRGEICIRGSVLFSGYYKREDLEQEVMIDGWFHTGDIGEWQPDGSLKVIDRKK  311

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ Y     + ++WVYGNSFES LVAV  P ++ALE WA+ N  
Sbjct  312   NIFKLSQGEYVAVENLENVYGVLQDIDSIWVYGNSFESSLVAVANPNQQALERWAEQNGV  371

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             TG F  LC++ +AR++IL EL    K  +L+GFE ++AVHL+P PFDIERDL+TPT+K K
Sbjct  372   TGSFAELCEHPRAREHILAELTKIAKDKKLKGFEAIKAVHLDPLPFDIERDLITPTYKKK  431

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQ+L +Y+  ID LYK  K
Sbjct  432   RPQMLKHYQGVIDALYKGMK  451



>gb|KHM99901.1| Long chain acyl-CoA synthetase 4 [Glycine soja]
Length=628

 Score =   365 bits (937),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 232/320 (73%), Gaps = 0/320 (0%)
 Frame = -2

Query  1208  WRGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAA  1029
             + G T++ ++ S M  T    N  KG  H+E     DR+ F+K+K   GG VR++LSGAA
Sbjct  299   YNGLTQKISSGSFMKQTIKLHNMTKGQNHNEASPLFDRIVFNKVKQGLGGNVRIILSGAA  358

Query  1028  PLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVP  849
             PL  H E FLRV       QGY LTE+  G F  + N   M GT G P+  ++ RLES+P
Sbjct  359   PLSRHVEGFLRVVTCAHILQGYGLTETCAGTFVSLPNEKDMLGTVGPPVPYVDVRLESIP  418

Query  848   EMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIID  669
             EMGYDAL T PRGEIC+RG T+F+GY+KREDLT++V++DGWFHTGDIGEW P+G MKIID
Sbjct  419   EMGYDALATTPRGEICVRGSTVFTGYYKREDLTKEVMIDGWFHTGDIGEWLPNGTMKIID  478

Query  668   RKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQN  489
             RKKNIFKLSQGEYVAVE+LE+ Y +   V ++WVYGNSFES+LVA+V P ++AL+ WA+ 
Sbjct  479   RKKNIFKLSQGEYVAVENLENIYVQASSVESIWVYGNSFESYLVAIVNPSKQALDKWAEE  538

Query  488   NRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTF  309
             N  T DF SLC++ + + YI+ EL    K  +L+GFE ++AVHL+P PFD+ER L+TPTF
Sbjct  539   NDITADFNSLCEDSRTKSYIIGELTKIAKDKKLKGFEFIKAVHLDPVPFDMERGLMTPTF  598

Query  308   KLKRPQLLNYYKDCIDQLYK  249
             K KRP+LL YY++ ID +YK
Sbjct  599   KKKRPELLKYYQNTIDNMYK  618



>ref|XP_010435688.1| PREDICTED: LOW QUALITY PROTEIN: long chain acyl-CoA synthetase 
5-like [Camelina sativa]
Length=666

 Score =   366 bits (940),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 226/306 (74%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP M YDALG+ PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPXMNYDALGSTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS+   + +VWVYGNSFESFLVAV  P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  538   IYSQVEAIDSVWVYGNSFESFLVAVANPAQQTLERWAVENGVNGDFNSICQNAKAKAFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K+ +++GFE+++AVHLEP  FD+ERDL+TPT+K KRPQLL YY+  ID++YK 
Sbjct  598   GELVKTAKEKKMKGFEIIKAVHLEPVAFDMERDLLTPTYKKKRPQLLKYYQSVIDEMYKT  657

Query  245   AKNVSA  228
              K   A
Sbjct  658   TKEGQA  663



>gb|AAM28872.1|AF503755_1 long chain acyl-CoA synthetase 5 [Arabidopsis thaliana]
Length=666

 Score =   366 bits (939),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 227/306 (74%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVAASPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCNVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVPEM YDALG+ PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V +DGW HTGD+GEWQP+G+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYYKREDLTKEVFIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS+  ++ ++WVYGNSFESFLVA+  P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  538   VYSQVEVIESIWVYGNSFESFLVAIANPAQQTLERWAVENGVNGDFNSICQNAKAKAFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K+++L+GFE+++ VHLEP  FD+ERDL+TPT+K KRPQLL YY++ I ++YK 
Sbjct  598   GELVKTAKENKLKGFEIIKDVHLEPVAFDMERDLLTPTYKKKRPQLLKYYQNVIHEMYKT  657

Query  245   AKNVSA  228
              K   A
Sbjct  658   TKETLA  663



>ref|XP_009786376.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana sylvestris]
Length=657

 Score =   365 bits (938),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 236/320 (74%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G R  +TL  +      +  + G K+ E     D++ F K+K   GG+VRL+LSGAAPL 
Sbjct  338   GGRLRSTLFNIAYARKLQYLKSGCKYHEASPISDKVVFSKVKDGLGGKVRLILSGAAPLS  397

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H E FLRV       QGY LTE+  G F  + N F M GT G P+  ++  LESVPEM 
Sbjct  398   SHVEAFLRVVACAHVLQGYGLTETCAGTFVSLPNQFDMLGTVGPPVPNVDVCLESVPEME  457

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL + PRGEIC+RG T+FSGY+KREDLT++V++DGWFHTGDIGEWQP+G++KIIDRKK
Sbjct  458   YDALSSTPRGEICVRGDTVFSGYYKREDLTKEVMIDGWFHTGDIGEWQPNGSLKIIDRKK  517

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ Y   P++ ++W+YG+S+ESFLVAVV P ++ +E WA+ N  
Sbjct  518   NIFKLSQGEYVAVENLENIYGNNPVIDSIWIYGSSYESFLVAVVNPNKQEVEKWAKQNGL  577

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             +GDF SLC+N K +++IL EL    K+ +L+GFE ++A+HL+P PFD+ERDL+TPTFK K
Sbjct  578   SGDFNSLCENPKVKEHILGELTKAAKEKKLKGFEFIKALHLDPVPFDMERDLLTPTFKKK  637

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQLL YYKD I+ +YK+AK
Sbjct  638   RPQLLKYYKDVIETMYKDAK  657



>ref|XP_006290076.1| hypothetical protein CARUB_v10003715mg [Capsella rubella]
 gb|EOA22974.1| hypothetical protein CARUB_v10003715mg [Capsella rubella]
Length=666

 Score =   365 bits (938),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 227/306 (74%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLES+PEM YDALG+ PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESIPEMNYDALGSTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKL+QGEYVAVE++E+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENIEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS+   + +VWVYGNSFESFLVA+  P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  538   IYSQVEAIDSVWVYGNSFESFLVAITNPAQQTLERWAAENGVNGDFNSICQNAKAKAFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL    K+ +L+GFE+++AVHLEP  FD+ERDL+TPT+K KRPQLL YY++ ID++YK 
Sbjct  598   GELVKIAKEKKLKGFEIIKAVHLEPLAFDMERDLLTPTYKKKRPQLLKYYQNVIDEMYKT  657

Query  245   AKNVSA  228
              K   A
Sbjct  658   TKEGQA  663



>emb|CDY46530.1| BnaC09g11030D [Brassica napus]
Length=786

 Score =   369 bits (947),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 228/315 (72%), Gaps = 0/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL          N  KG  H++     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  472   TLFNFAFNYKHNNMVKGKAHEQAAPIFDKIVFKKVKEGLGGRVRLILSGAAPLAAHIESF  531

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  532   LRVVACAHVLQGYGLTESCGGTFVSIPNELQMLGTVGPPVPNVDIRLESVPEMGYDALAS  591

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLFSGY+KREDLT++V +DGW HTGD+GEWQPDGAMKIIDRKKNIFKLS
Sbjct  592   KPRGEICIRGKTLFSGYYKREDLTQEVFIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLS  651

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + +VWVYGNS+ES+LVAVV P +  +E WA+ +  +GDF +
Sbjct  652   QGEYVAVENLENIYSHVAAIESVWVYGNSYESYLVAVVCPSKIQIEHWAKEHNVSGDFET  711

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             + +NQK +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL 
Sbjct  712   IGQNQKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLK  771

Query  281   YYKDCIDQLYKEAKN  237
             YY+  ID++Y + KN
Sbjct  772   YYQKEIDEMYNKTKN  786



>ref|NP_192841.1| long-chain acyl-CoA synthetase [Arabidopsis thaliana]
 sp|Q9T009.1|LACS5_ARATH RecName: Full=Long chain acyl-CoA synthetase 5 [Arabidopsis thaliana]
 emb|CAB43038.1| putative acyl-CoA synthetase [Arabidopsis thaliana]
 emb|CAB81204.1| putative acyl-CoA synthetase [Arabidopsis thaliana]
 gb|ACI49793.1| At4g11030 [Arabidopsis thaliana]
 gb|AEE82963.1| long-chain acyl-CoA synthetase [Arabidopsis thaliana]
Length=666

 Score =   365 bits (937),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 226/302 (75%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   NMKKGQSHVAASPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCNVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVPEM YDALG+ PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V +DGW HTGD+GEWQP+G+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  478   LFSGYYKREDLTKEVFIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS+  ++ ++WVYGNSFESFLVA+  P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  538   VYSQVEVIESIWVYGNSFESFLVAIANPAQQTLERWAVENGVNGDFNSICQNAKAKAFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K+++L+GFE+++ VHLEP  FD+ERDL+TPT+K KRPQLL YY++ I ++YK 
Sbjct  598   GELVKTAKENKLKGFEIIKDVHLEPVAFDMERDLLTPTYKKKRPQLLKYYQNVIHEMYKT  657

Query  245   AK  240
              K
Sbjct  658   TK  659



>ref|XP_006590488.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Glycine 
max]
Length=663

 Score =   365 bits (936),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 232/313 (74%), Gaps = 0/313 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KGL+H E    LD++ FDK+K   GGRVRL+LSGAAPL  H E +
Sbjct  345   TLFNFAYSYKLNNMKKGLRHGEASPLLDKIVFDKVKQGLGGRVRLILSGAAPLSAHVEGY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+   +  LESVP+MGY+AL T
Sbjct  405   LRVVTCAHVLQGYGLTETCAGTFVSLPNEIEMLGTVGPPVPNGDVCLESVPDMGYNALAT  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEICL+GKTLF+GY+K EDLT++V++D WFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICLKGKTLFAGYYKCEDLTKEVLIDEWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y +   + ++WVYGNSFE+FLVAVV P ++ALE WAQ N  + DF S
Sbjct  525   QGEYVAVENLENIYGQVSSIESIWVYGNSFEAFLVAVVNPSKQALEHWAQENGISMDFNS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+ YIL+EL+   K+ +L+GFE ++AVH++P  FD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCEDARAKSYILEELSKIAKEKKLKGFEFIKAVHIDPIQFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEA  243
             YY++ ID +YK  
Sbjct  645   YYQNAIDNMYKSG  657



>gb|KFK31882.1| hypothetical protein AALP_AA6G171000 [Arabis alpina]
Length=667

 Score =   365 bits (936),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 226/306 (74%), Gaps = 0/306 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  359   NMKKGQSHVAAAPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCHVLQG  418

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVP+M YDALG+ PRGEIC+RGKT
Sbjct  419   YGLTESCAGTFVTFPDELDMLGTVGPPVPNVDIRLESVPDMEYDALGSTPRGEICIRGKT  478

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQPDG+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  479   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPDGSMKIIDRKKNIFKLAQGEYVAVENLEN  538

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +   + ++WVYGNSFESFL+AV  P +K LE WA  N   GDF ++C+N KA+ +IL
Sbjct  539   VYGQVEAIDSIWVYGNSFESFLIAVANPAQKTLERWATENGVNGDFNTICQNAKAKAFIL  598

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  T K  +L+GFE+++AVHLEP  F+IERDL+TPT+K KRPQLL YY++ ID++YK 
Sbjct  599   GELVKTAKDRKLKGFEVIKAVHLEPVAFNIERDLLTPTYKKKRPQLLKYYQNVIDEMYKT  658

Query  245   AKNVSA  228
              K   A
Sbjct  659   TKEGQA  664



>ref|XP_011074379.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Sesamum indicum]
Length=658

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 230/321 (72%), Gaps = 1/321 (0%)
 Frame = -2

Query  1202  GGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPL  1023
             GG  ++T  +    +   RN   G K        D+L F+ +K   GG VRL+LSGAAPL
Sbjct  339   GGLIKQTAFN-FSYSLKLRNMRNGFKQSVASPICDKLVFNLVKQGLGGNVRLILSGAAPL  397

Query  1022  PMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEM  843
               H EE+LRV       QGY LTE+  G F  I +   M GT G P+  ++  LESVPEM
Sbjct  398   ASHVEEYLRVVTCSYVLQGYGLTETCAGTFVSIPDEMNMLGTVGPPLPNVDVCLESVPEM  457

Query  842   GYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRK  663
             GYDAL   PRGE+C+RG TLFSGY+KREDLT++V++DGWFHTGDIGEWQP+G++KIIDRK
Sbjct  458   GYDALSRTPRGEVCVRGDTLFSGYYKREDLTKEVLIDGWFHTGDIGEWQPNGSLKIIDRK  517

Query  662   KNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNR  483
             KNIFKLSQGEYVAVE+LE+ YS  P + ++WVYGNSFESFLVA++ P ++A+E WA+ N 
Sbjct  518   KNIFKLSQGEYVAVENLENIYSLAPDIESIWVYGNSFESFLVAIINPNKQAVEQWAEQNG  577

Query  482   ETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKL  303
               G+F  LC+N + + Y L EL    K+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K 
Sbjct  578   IFGNFNGLCENTQVKNYFLGELTRIAKEKKLKGFEFIKAIHLDPVPFDMERDLITPTYKK  637

Query  302   KRPQLLNYYKDCIDQLYKEAK  240
             KRPQLL YY+D ID +YK AK
Sbjct  638   KRPQLLKYYQDMIDSMYKNAK  658



>ref|XP_004298900.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Fragaria vesca 
subsp. vesca]
Length=666

 Score =   365 bits (936),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 225/313 (72%), Gaps = 0/313 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     T    N + G  H +     D++ F K+K   GGRVRL+LSGAAPL  H E +
Sbjct  347   TLFNCAYTYKHYNMKNGHAHGDASPMSDKIVFSKVKQGLGGRVRLILSGAAPLSTHVESY  406

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL  
Sbjct  407   LRVVACAHVLQGYGLTETCAGTFVSLPNEMSMLGTVGPPVPNVDVCLESVPEMGYDALAE  466

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
               RGE+C+RGKTLFSGY+KREDLT++V++DGWFHTGDIGEWQ DG++KIIDRKKNIFKLS
Sbjct  467   TARGEVCVRGKTLFSGYYKREDLTKEVMIDGWFHTGDIGEWQQDGSLKIIDRKKNIFKLS  526

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + A+WVYGNSFES LVAVV P ++A+E WAQ N  +GDF S
Sbjct  527   QGEYVAVENLENIYGLVSDIDAIWVYGNSFESCLVAVVNPNKQAIERWAQQNDVSGDFNS  586

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N K ++Y+L ELN   K  +L+GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  587   LCENAKVKEYVLGELNKIAKDKKLKGFEVIKAVHLDPEPFDMERDLITPTYKKKRPQLLK  646

Query  281   YYKDCIDQLYKEA  243
             YYK  ID +YK  
Sbjct  647   YYKSVIDDMYKSV  659



>emb|CDY64879.1| BnaAnng19690D [Brassica napus]
Length=960

 Score =   372 bits (955),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 229/315 (73%), Gaps = 0/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL          N  KG  H++     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  646   TLFNFAFNYKHNNMVKGKAHEQAAPIFDKIVFKKVKEGLGGRVRLILSGAAPLAAHIESF  705

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTES GG F  I N   M GT G P+  ++ RLESVPEMGYDAL +
Sbjct  706   LRVVACAHVLQGYGLTESCGGTFVSIPNELQMLGTVGPPVPNVDIRLESVPEMGYDALAS  765

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RGKTLFSGY+KREDLT++V +DGW HTGD+GEWQPDGAMKIIDRKKNIFKLS
Sbjct  766   KPRGEICIRGKTLFSGYYKREDLTQEVFIDGWLHTGDVGEWQPDGAMKIIDRKKNIFKLS  825

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ YS    + ++WVYGNS+ES+LVAVV P +  +E WA+ +  +GDF +
Sbjct  826   QGEYVAVENLENIYSHVAAIESIWVYGNSYESYLVAVVCPSKIQIEHWAKEHNVSGDFET  885

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             +C+NQK +++IL E N   K  +L+GFE+++ VHL+  PFD+ERDL+TP++K KRPQLL 
Sbjct  886   ICQNQKTKEFILGEFNRVAKDKKLKGFELIKGVHLDTVPFDMERDLITPSYKKKRPQLLK  945

Query  281   YYKDCIDQLYKEAKN  237
             YY+  ID++Y + KN
Sbjct  946   YYQKEIDEMYNKTKN  960



>gb|KHG09916.1| Long chain acyl-CoA synthetase 4 -like protein [Gossypium arboreum]
Length=637

 Score =   363 bits (933),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/306 (60%), Positives = 223/306 (73%), Gaps = 16/306 (5%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG KH E     D++ F K+K   GG VRL+LSGAAPL  H EEFLRV       QG
Sbjct  348   NMKKGRKHGEASPICDKIVFSKVKQGLGGNVRLILSGAAPLSTHVEEFLRVVACCHVLQG  407

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + N   M GT G P+  I+ RLESVPEM YDAL + PRGEIC++G T
Sbjct  408   YGLTESCAGSFVSLPNELSMLGTVGPPVPNIDVRLESVPEMNYDALASTPRGEICIKGNT  467

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLTR+V++DGWFHTGDIGEWQP+G+MKIIDRKKNIFKLSQGEYV       
Sbjct  468   LFSGYYKREDLTREVLIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYV-------  520

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
                      A+W+YGNSFESFLVAVV P ++ALE W  +N  +GDF SLC+N KA+++IL
Sbjct  521   ---------AIWIYGNSFESFLVAVVNPNKEALESWGADNNVSGDFESLCQNPKAKEFIL  571

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL  TGK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL YY+  ID++YK 
Sbjct  572   GELAKTGKEKKLKGFEFIKAVHLDPMPFDMERDLLTPTYKKKRPQLLKYYQSVIDEMYKS  631

Query  245   AKNVSA  228
             A   +A
Sbjct  632   ASKPNA  637



>ref|NP_001056862.1| Os06g0158000 [Oryza sativa Japonica Group]
 dbj|BAD69196.1| putative acyl-CoA synthetase [Oryza sativa Japonica Group]
 dbj|BAD69434.1| putative acyl-CoA synthetase [Oryza sativa Japonica Group]
 dbj|BAF18776.1| Os06g0158000 [Oryza sativa Japonica Group]
Length=615

 Score =   362 bits (930),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 227/299 (76%), Gaps = 0/299 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             KG+KH++   F D+L F K+K   GG++R ++SG APL +  EEFLRV       QGY L
Sbjct  317   KGIKHEKAAPFFDKLVFSKVKERLGGKLRFIVSGGAPLSVAVEEFLRVVTCASVVQGYGL  376

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+    F  I N F M GT G P+  ++ARLESVPEMGYDAL ++PRGE+C++G  LFS
Sbjct  377   TETGAASFVAIPNDFSMVGTVGPPVEHLDARLESVPEMGYDALSSIPRGEVCVKGSVLFS  436

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY+KREDLT++V++DGWFHTGD+GEWQP+G++KIIDRKKNIFKLSQGEYVAVE+LE+ Y 
Sbjct  437   GYYKREDLTQEVMIDGWFHTGDVGEWQPNGSLKIIDRKKNIFKLSQGEYVAVENLENVYG  496

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 + ++W+YGNSFESFLVAV+ P ++ LE WA+ N  +G    LC+N +A++YIL EL
Sbjct  497   VLQEIDSIWIYGNSFESFLVAVINPNQQVLEHWAEQNGISGSLSELCENSRAKEYILSEL  556

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
                 K+ +L+G+E +RAVHL+P PFD+ERDL+TPT+K KRPQLL +Y+  ID LYK AK
Sbjct  557   TKIAKEKKLKGYEFIRAVHLDPLPFDMERDLITPTYKKKRPQLLKHYQGTIDALYKMAK  615



>gb|KDO76524.1| hypothetical protein CISIN_1g006047mg [Citrus sinensis]
Length=663

 Score =   363 bits (933),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 227/303 (75%), Gaps = 0/303 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N +KG KH E     D++ FDK+K +FGGRVRL+LSGAAPL  H E F
Sbjct  345   TLFNIAYSYKFHNLKKGHKHVEASPIADKIVFDKVKQSFGGRVRLILSGAAPLTPHVETF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEM YDAL +
Sbjct  405   LRVVACAHVLQGYGLTETCAGTFVSLPNEMSMIGTVGPPVPNVDVCLESVPEMEYDALSS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++G T+FSGY+KREDLT++V+VDGWFHTGDIGEWQPDG++KIIDRKKNIFKLS
Sbjct  465   TPRGEVCVKGSTVFSGYYKREDLTKEVMVDGWFHTGDIGEWQPDGSLKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y+    + +VWVYGNSFESFLVA+V P + ALE WA  N   GDF S
Sbjct  525   QGEYVAVENLENIYALVSAIDSVWVYGNSFESFLVAIVNPNKDALERWAAENGVNGDFKS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N KA+++IL EL+   K+ +L+GFE ++AVHLEP PFDIERDL+TPT+K KRPQLL 
Sbjct  585   LCENPKAKEFILGELSRVAKEKKLKGFEFIKAVHLEPVPFDIERDLLTPTYKKKRPQLLK  644

Query  281   YYK  273
             +Y+
Sbjct  645   HYQ  647



>ref|XP_009358599.1| PREDICTED: long chain acyl-CoA synthetase 4 [Pyrus x bretschneideri]
Length=660

 Score =   363 bits (933),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N + G  H +     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  347   TLFNVAYSYKYHNMQNGHGHSQASPIADKVVFSKVKQGLGGRVRLILSGAAPLSTHVEAF  406

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL  
Sbjct  407   LRVVACAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEMGYDALSD  466

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++G TLFSGY+KREDLT++V++DGWFHTGD+GEWQPDG++KIIDRKKNIFKLS
Sbjct  467   TPRGEVCVKGNTLFSGYYKREDLTKEVMIDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLS  526

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + A+WVYGNSFESFLVAVV P ++A+E WAQ N  +GDF S
Sbjct  527   QGEYVAVENLENIYGLVSDIDAIWVYGNSFESFLVAVVNPNKQAVESWAQQNGISGDFKS  586

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N K ++YIL EL    K+ +L+GFE+++ VHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  587   LCENAKVKEYILGELKKIAKEKKLKGFEVIKGVHLDPEPFDMERDLITPTYKKKRPQLLK  646

Query  281   YYKDCIDQLYKEAK  240
             YYKD ID +YK AK
Sbjct  647   YYKDLIDNMYKNAK  660



>gb|EEC80050.1| hypothetical protein OsI_21752 [Oryza sativa Indica Group]
 gb|EEE65125.1| hypothetical protein OsJ_20194 [Oryza sativa Japonica Group]
Length=652

 Score =   363 bits (932),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 227/299 (76%), Gaps = 0/299 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             KG+KH++   F D+L F K+K   GG++R ++SG APL +  EEFLRV       QGY L
Sbjct  354   KGIKHEKAAPFFDKLVFSKVKERLGGKLRFIVSGGAPLSVAVEEFLRVVTCASVVQGYGL  413

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TE+    F  I N F M GT G P+  ++ARLESVPEMGYDAL ++PRGE+C++G  LFS
Sbjct  414   TETGAASFVAIPNDFSMVGTVGPPVEHLDARLESVPEMGYDALSSIPRGEVCVKGSVLFS  473

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY+KREDLT++V++DGWFHTGD+GEWQP+G++KIIDRKKNIFKLSQGEYVAVE+LE+ Y 
Sbjct  474   GYYKREDLTQEVMIDGWFHTGDVGEWQPNGSLKIIDRKKNIFKLSQGEYVAVENLENVYG  533

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 + ++W+YGNSFESFLVAV+ P ++ LE WA+ N  +G    LC+N +A++YIL EL
Sbjct  534   VLQEIDSIWIYGNSFESFLVAVINPNQQVLEHWAEQNGISGSLSELCENSRAKEYILSEL  593

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
                 K+ +L+G+E +RAVHL+P PFD+ERDL+TPT+K KRPQLL +Y+  ID LYK AK
Sbjct  594   TKIAKEKKLKGYEFIRAVHLDPLPFDMERDLITPTYKKKRPQLLKHYQGTIDALYKMAK  652



>ref|XP_009358593.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Pyrus x bretschneideri]
 ref|XP_009358594.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Pyrus x bretschneideri]
Length=660

 Score =   363 bits (932),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N + G  H +     D++ F K+K   GGRVRL+LSGAAPL  H E F
Sbjct  347   TLFNVAYSYKYHNMQNGHGHSQASPIADKVVFSKVKQGLGGRVRLILSGAAPLSTHVEAF  406

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL  
Sbjct  407   LRVVACAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEMGYDALSD  466

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++G TLFSGY+KREDLT++V++DGWFHTGD+GEWQPDG++KIIDRKKNIFKLS
Sbjct  467   TPRGEVCVKGNTLFSGYYKREDLTKEVMIDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLS  526

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + A+WVYGNSFESFLVAVV P ++A+E WAQ N  +GDF S
Sbjct  527   QGEYVAVENLENIYGLVSDIDAIWVYGNSFESFLVAVVNPNKQAVESWAQQNGISGDFKS  586

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N K ++YIL EL    K+ +L+GFE+++ VHL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  587   LCENAKVKEYILGELKKIAKEKKLKGFEVIKGVHLDPEPFDMERDLITPTYKKKRPQLLK  646

Query  281   YYKDCIDQLYKEAK  240
             YYKD ID +YK AK
Sbjct  647   YYKDLIDNMYKNAK  660



>ref|XP_006352250.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Solanum tuberosum]
Length=657

 Score =   363 bits (931),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 234/320 (73%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G R  +TL  +      +  + G K+ E     D++ F K++   GG+VRL+LSGAAPL 
Sbjct  338   GGRLRSTLFNIAYARKLQYLKDGCKYHEASPISDKVVFSKVRDGLGGKVRLILSGAAPLS  397

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H E FLRV       QGY LTE+  G F  + N F M GT G P+  ++  L SVPEM 
Sbjct  398   SHVEAFLRVVACAHVLQGYGLTETCAGTFVSLPNQFDMLGTVGPPVPNVDVCLVSVPEME  457

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL + PRGEIC+RG T+FSGY+K EDLT++V++DGWFHTGDIGEWQP+G++KIIDR K
Sbjct  458   YDALSSTPRGEICVRGDTVFSGYYKSEDLTKEVLIDGWFHTGDIGEWQPNGSLKIIDRMK  517

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ +   P++ +VWVYG+SFESFLVAVV P ++ +E WA+ N  
Sbjct  518   NIFKLSQGEYVAVENLENVFGNNPVIESVWVYGSSFESFLVAVVNPSKQQVEKWAKQNGL  577

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             +GDF SLC+N K +++IL EL   GK+ +L+GFE ++A+HL+P PFD+ERDL+TPTFK K
Sbjct  578   SGDFNSLCENSKVKEHILGELTKAGKEKKLKGFEFIKALHLDPVPFDMERDLLTPTFKKK  637

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQLL YYKD ID +YK+AK
Sbjct  638   RPQLLKYYKDVIDTMYKDAK  657



>ref|XP_008451943.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Cucumis melo]
 ref|XP_008451944.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Cucumis melo]
Length=660

 Score =   363 bits (931),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 224/314 (71%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N +KG KH E     DR  F+K+K   GG VRL+LSGAAPL  H E F
Sbjct  345   TLFNIAYSRKYGNMQKGHKHSEASPICDRFVFNKVKEGLGGNVRLILSGAAPLATHVEAF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL T
Sbjct  405   LRVVACAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEMGYDALST  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RG  LFSGY+KR+DLT +V++DGWFHTGDIGEWQ DG++KIIDRKKNIFKLS
Sbjct  465   TPRGEICVRGDPLFSGYYKRDDLTNEVMIDGWFHTGDIGEWQSDGSLKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     +  +WVYGNSFESFLVAV  P + ALE WA  N   GDF S
Sbjct  525   QGEYVAVENLENIYGLVSSIDMIWVYGNSFESFLVAVANPNKLALERWANENGIEGDFDS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++++A+ Y+L ELN   K+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCEDKRAKDYLLGELNKIAKEKKLKGFEFIKAIHLDPLPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID +Y  AK
Sbjct  645   YYQSVIDSMYNNAK  658



>ref|XP_010668007.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=664

 Score =   362 bits (930),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/313 (59%), Positives = 225/313 (72%), Gaps = 1/313 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N   G + +E     D++ F KIK   GG++RL+LSG APL    E F
Sbjct  345   TLFNVAYSYKLSNMNNGYRLEEASPIFDKIVFSKIKEGLGGKLRLILSGGAPLAPSVETF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDAL-G  825
             LRV       QGY LTES    F    N   M GT G P+  ++  LESVPEMGYDAL  
Sbjct  405   LRVVTCAHVLQGYGLTESCAASFIAQPNDMAMVGTVGPPVPNVDVCLESVPEMGYDALLS  464

Query  824   TVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
             T PRGEIC+RG TLF+GYHKREDLT +V+ DGWFHTGDIGEWQPDG MKIIDRKKNIFKL
Sbjct  465   TTPRGEICIRGNTLFTGYHKREDLTEEVMFDGWFHTGDIGEWQPDGCMKIIDRKKNIFKL  524

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYV+VE+LE+ YS    + + WVYGNSFESFLVAVV P + ALE WAQ +   GDF 
Sbjct  525   SQGEYVSVENLENIYSLASEIDSAWVYGNSFESFLVAVVNPNKHALESWAQEHEVAGDFS  584

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             SLC++ +A+ YIL++LN   ++++L+GFE+++AVHL+P PFD+ERDL+TPTFK KRPQLL
Sbjct  585   SLCQHPRAKAYILEKLNKIARENKLKGFELIKAVHLDPMPFDMERDLLTPTFKKKRPQLL  644

Query  284   NYYKDCIDQLYKE  246
              YYKD ID LY+E
Sbjct  645   KYYKDVIDTLYQE  657



>ref|XP_006655812.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Oryza brachyantha]
Length=650

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 230/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +       +  KG+KH++   F D+L F+K+K   GG +R ++SG APL +  EEF
Sbjct  337   TLFNIAYKLKLDSMRKGIKHEKAAPFFDKLVFNKVKERLGGNLRFIVSGGAPLAVAVEEF  396

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+    F  I N   M GT G P+  ++ RLESVPEMGYDAL  
Sbjct  397   LRVVTCASVVQGYGLTETGAASFVAIPNDISMVGTVGPPVQHLDVRLESVPEMGYDALSN  456

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             +PRGEIC++G  LFSGY++REDLT++V++DGWFHTGD+GEWQPDG++KIIDRKKNIFKLS
Sbjct  457   IPRGEICVKGSVLFSGYYRREDLTQEVMIDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLS  516

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFESFLVAV+ P ++ALE+WA+ N   G F  
Sbjct  517   QGEYVAVENLENVYGVLQEIDSIWVYGNSFESFLVAVINPNQQALENWAKQNGIAGSFSE  576

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LCKN +A++YI+ EL    K+ +L+G+E ++A+HL+P PFD+ERDL+TPT+K KRPQ+L 
Sbjct  577   LCKNSRAKEYIISELIKIAKEKKLKGYEFIKAIHLDPLPFDMERDLITPTYKKKRPQMLR  636

Query  281   YYKDCIDQLYKEAK  240
             +Y+  ID LYK AK
Sbjct  637   HYQGIIDALYKTAK  650



>gb|EYU23349.1| hypothetical protein MIMGU_mgv1a0021142mg, partial [Erythranthe 
guttata]
Length=647

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 229/321 (71%), Gaps = 2/321 (1%)
 Frame = -2

Query  1235  YAHAQRIIYWRGGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGR  1056
             YA  Q  I   G  ++  T+     +   RN  KG KH E     D++ F K+K   GG+
Sbjct  329   YAGLQLKISSGGFVKQ--TMFNFAYSLKLRNMRKGQKHAEASPICDKVVFSKVKQGLGGK  386

Query  1055  VRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtT  876
             VRL+LSGAAPL  H EEFLRV  G    QGY LTE+  G F  I +   M GT G P+  
Sbjct  387   VRLILSGAAPLASHVEEFLRVVSGSYVLQGYGLTETCAGTFVSIPDELKMLGTVGPPVPN  446

Query  875   IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
             +E  LESVPEMGYDAL + PRGE+C+RG TLFSGY KREDLT++V VDGWFHTGD+GEWQ
Sbjct  447   VEVCLESVPEMGYDALSSTPRGEVCVRGDTLFSGYFKREDLTKEVFVDGWFHTGDVGEWQ  506

Query  695   PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
              DG++KIIDRKKNIFKLSQGEYVAVE+LE+ Y     + ++WVYGNSFESFLVA++ P +
Sbjct  507   ADGSLKIIDRKKNIFKLSQGEYVAVENLENIYGLVSDIDSIWVYGNSFESFLVAIINPSQ  566

Query  515   KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
              A+E WA+ N  +GDF +LC+N K ++Y L EL    K+ +L+GFE++RAVHL+P PFD+
Sbjct  567   PAVERWAEQNDISGDFKALCENTKVKEYFLGELARISKEKKLKGFEVIRAVHLDPVPFDM  626

Query  335   ERDLVTPTFKLKRPQLLNYYK  273
             ERDL+TPTFK KRPQLL YY+
Sbjct  627   ERDLITPTFKKKRPQLLKYYQ  647



>ref|XP_004149746.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Cucumis sativus]
 gb|KGN53403.1| hypothetical protein Csa_4G051550 [Cucumis sativus]
Length=660

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/314 (58%), Positives = 223/314 (71%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +    N +KG KH E     DR  F+K+K   GG VRL+LSGAAPL  H E F
Sbjct  345   TLFNVAFSRKYGNMQKGHKHSEASPICDRFVFNKVKEGLGGNVRLILSGAAPLATHVEAF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL T
Sbjct  405   LRVVACAHVLQGYGLTETCAGTFVSLPNELSMLGTVGPPVPNVDVCLESVPEMGYDALST  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC+RG  LFSGY+KR+DLT +V++DGWFHTGDIGEWQ DG++KIIDRKKNIFKLS
Sbjct  465   TPRGEICVRGDPLFSGYYKRDDLTNEVMIDGWFHTGDIGEWQSDGSLKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     +  +WVYGNSFESFLVAV  P + ALE WA  N   GDF S
Sbjct  525   QGEYVAVENLENIYGLVSSIDMIWVYGNSFESFLVAVANPNQLALERWANENGIEGDFDS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC +++A+ Y+L ELN   K+ +L+GFE ++A+HL+P PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCGDKRAKDYLLGELNKIAKEKKLKGFEFIKAIHLDPLPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID +Y  AK
Sbjct  645   YYQSVIDSMYNNAK  658



>gb|KHN25648.1| Long chain acyl-CoA synthetase 4 [Glycine soja]
Length=661

 Score =   362 bits (929),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 228/303 (75%), Gaps = 0/303 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL     +    N +KGL+H E    LD++ FDK+K   GGRVRL+LSGAAPL  H E +
Sbjct  345   TLFNFAYSYKLNNMKKGLRHGEASPLLDKIVFDKVKQGLGGRVRLILSGAAPLSAHVEGY  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL +
Sbjct  405   LRVVTCAHVLQGYGLTETCAGTFVSLPNEIEMLGTVGPPVPNVDVCLESVPEMGYDALAS  464

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGEIC++GKTLF+GY+KREDLT++V++D WFHTGDIGEWQP+G+MKIIDRKKNIFKLS
Sbjct  465   TPRGEICVKGKTLFAGYYKREDLTKEVLIDEWFHTGDIGEWQPNGSMKIIDRKKNIFKLS  524

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y +   + ++WVYGNSFE+FLVAVV P ++ALE WAQ N  + DF S
Sbjct  525   QGEYVAVENLENIYGQVSSIESIWVYGNSFEAFLVAVVNPSKQALEHWAQENGISMDFNS  584

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+ YI++EL+   K+ +L+GFE ++AVHL+  PFD+ERDL+TPT+K KRPQLL 
Sbjct  585   LCEDARAKSYIIEELSKIAKEKKLKGFEFIKAVHLDSIPFDMERDLITPTYKKKRPQLLK  644

Query  281   YYK  273
             YY+
Sbjct  645   YYQ  647



>emb|CAN67631.1| hypothetical protein VITISV_035299 [Vitis vinifera]
Length=654

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 226/304 (74%), Gaps = 0/304 (0%)
 Frame = -2

Query  1184  TTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEE  1005
              TL  +     + N  KG+K  E     D++ F K+K   GG VRL+LSGAAPL  H E 
Sbjct  335   NTLFNIAYKYKQYNLWKGVKTLEAAPICDKIVFGKVKQGLGGNVRLILSGAAPLSTHVEA  394

Query  1004  FLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALG  825
             +LRV       QGY LTE+  G F  + N   M GT G P+  ++  LESVPEMGYDAL 
Sbjct  395   YLRVVTCAHVLQGYGLTETCAGTFVSLPNEISMLGTVGPPVPNVDVCLESVPEMGYDALS  454

Query  824   TVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
             + PRGEIC+RGKTLFSGY+KREDLT++V+VDGWFHTGD+GEWQPDG+MKIIDRKKNIFKL
Sbjct  455   STPRGEICIRGKTLFSGYYKREDLTKEVLVDGWFHTGDVGEWQPDGSMKIIDRKKNIFKL  514

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ Y     + ++W+YGNSFESFLVAV  P ++ALE WA+ N  +GDF 
Sbjct  515   SQGEYVAVENLENIYGLVSDIDSIWIYGNSFESFLVAVANPNQQALERWAKENNISGDFD  574

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             SLC+N KA++YIL EL+  GK+ +L+GFE ++AVHL+P PFD+ERDL+TPT+K KRPQLL
Sbjct  575   SLCENPKAKEYILGELSKIGKEKKLKGFEFVKAVHLDPVPFDMERDLITPTYKKKRPQLL  634

Query  284   NYYK  273
              YY+
Sbjct  635   KYYQ  638



>ref|XP_003524440.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Glycine max]
Length=665

 Score =   361 bits (927),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 176/317 (56%), Positives = 228/317 (72%), Gaps = 0/317 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G+  + T+     +    N  KG  H+E     DR+ F+K+K   GG VR++LSGAAPL 
Sbjct  339   GSFMKQTMFNFAYSYKLHNMTKGQNHNEASPLFDRIVFNKVKQGLGGNVRIILSGAAPLS  398

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H E FLRV       QGY LTE+  G F  + N   M GT G P+  ++ RLES+PEMG
Sbjct  399   RHVEGFLRVVTCAHILQGYGLTETCAGTFVSLPNEKDMLGTVGPPVPYVDVRLESIPEMG  458

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL T PRGEIC+RG T+F+GY+KREDLT++V++DGWFHTGDIGEW P+G MKIIDRKK
Sbjct  459   YDALATTPRGEICVRGSTVFTGYYKREDLTKEVMIDGWFHTGDIGEWLPNGTMKIIDRKK  518

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ Y +   V ++WVYGNSFES+LVA+V P ++AL+ WA+ N  
Sbjct  519   NIFKLSQGEYVAVENLENIYVQASSVESIWVYGNSFESYLVAIVNPSKQALDKWAEENDI  578

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             T DF SLC++ + + YI+ EL    K  +L+GFE ++AVHL+P PFD+ER L+TPTFK K
Sbjct  579   TADFNSLCEDSRTKSYIIGELTKIAKDKKLKGFEFIKAVHLDPVPFDMERGLMTPTFKKK  638

Query  299   RPQLLNYYKDCIDQLYK  249
             RP+LL YY++ ID +YK
Sbjct  639   RPELLKYYQNTIDNMYK  655



>ref|XP_007200449.1| hypothetical protein PRUPE_ppa011261mg [Prunus persica]
 gb|EMJ01648.1| hypothetical protein PRUPE_ppa011261mg [Prunus persica]
Length=217

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -2

Query  875  IEARLESVPEMGYDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQ  696
            IE RLESVPEMGYDAL  VPRGEICLRGK+LFSGYHKR+DLT +V++DGWFHTGDIGE Q
Sbjct  11   IETRLESVPEMGYDALSRVPRGEICLRGKSLFSGYHKRQDLTEEVLIDGWFHTGDIGELQ  70

Query  695  PDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPER  516
            P+GAM IIDRKKNIFKLSQGEYVAVE++ES Y +CPL+ ++WVYGNSFESFLVAVV+P+R
Sbjct  71   PNGAMTIIDRKKNIFKLSQGEYVAVENIESKYLQCPLITSIWVYGNSFESFLVAVVVPDR  130

Query  515  KALEDWAQNNRETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDI  336
            KALEDWA  +  T DF SLC+N KARKYILDEL++ G++ QLRGFE+L+AVHLEP PFD+
Sbjct  131  KALEDWAAKHHLTDDFKSLCQNLKARKYILDELSSVGQEQQLRGFELLKAVHLEPKPFDM  190

Query  335  ERDLVTPTFKLKRPQLLNYYKDCI  264
            ERDL+TPTFKLKRP LL YYKD I
Sbjct  191  ERDLITPTFKLKRPHLLKYYKDRI  214



>ref|XP_002867687.1| long-chain-fatty-acid--CoA ligase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43946.1| long-chain-fatty-acid--CoA ligase [Arabidopsis lyrata subsp. 
lyrata]
Length=666

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/299 (59%), Positives = 225/299 (75%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG  H E     D+  F K+K A GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   HMKKGKPHAEASPLCDKHVFGKVKQALGGNVRIILSGAAPLASHVESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL + PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFVSLPDELDMLGTVGPPVPNVDIRLESVPEMEYDALASTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE++E+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y     V +VWVYGNSFESFLVA+  P ++ LE WA  N  +GD+ +LC+N+KA+++IL
Sbjct  538   IYGEVQAVDSVWVYGNSFESFLVAIANPNQQILERWAAENGVSGDYNALCQNEKAKEFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL    K+ +++GFE+++A+HL+P PFD+ERDL+TPTFK KRPQLL YY+  ID++YK
Sbjct  598   GELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTFKKKRPQLLKYYQSVIDEMYK  656



>ref|NP_001147847.1| ACS-like protein [Zea mays]
 gb|ACG28888.1| ACS-like protein [Zea mays]
 gb|AFW85773.1| putative AMP-dependent synthetase and ligase superfamily protein 
[Zea mays]
Length=649

 Score =   358 bits (920),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 229/320 (72%), Gaps = 0/320 (0%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G   + TL  +       N  KG+KH++   F D+L F K+K   GG++R+++SG APL 
Sbjct  330   GGMLKKTLFNIAYKMKLGNMRKGIKHEKAAPFFDKLVFSKVKERLGGKLRVIVSGGAPLA  389

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
             +  EEFLRV       QGY LTE+  G    I N   M GT G P+  I+ RLESVPEMG
Sbjct  390   VPVEEFLRVVTCAYVVQGYGLTETCAGSIVSIPNEHSMLGTVGPPVQHIDVRLESVPEMG  449

Query  839   YDALGTVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKK  660
             YDAL +VPRGEIC+RG  LFSGY+KREDL ++V++DGWFHTGDIGEWQPDG++K+IDRKK
Sbjct  450   YDALSSVPRGEICIRGSVLFSGYYKREDLEQEVMIDGWFHTGDIGEWQPDGSLKVIDRKK  509

Query  659   NIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRE  480
             NIFKLSQGEYVAVE+LE+ Y     + ++WVYGNSFES LVAV  P ++ALE WA+ N  
Sbjct  510   NIFKLSQGEYVAVENLENVYGVLQDIDSIWVYGNSFESSLVAVANPNQQALERWAEQNGV  569

Query  479   TGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLK  300
             TG F  LC++ +AR++IL EL    K  +L+GFE ++AVHL+P PFDIERDL+TPT+K K
Sbjct  570   TGSFAELCEHPRAREHILAELTKIAKDKKLKGFEAIKAVHLDPLPFDIERDLITPTYKKK  629

Query  299   RPQLLNYYKDCIDQLYKEAK  240
             RPQ+L +Y+  ID LYK  K
Sbjct  630   RPQMLKHYQGVIDALYKGMK  649



>emb|CDP08689.1| unnamed protein product [Coffea canephora]
Length=659

 Score =   358 bits (920),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 231/315 (73%), Gaps = 1/315 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +  +   RN  KG KH +     D++ F+K+K   GG +RL+LSGAAPL    E F
Sbjct  345   TLFNIAYSYKLRNMSKGYKHVDAAPRFDKIIFNKVKEGLGGNLRLILSGAAPLSSSVETF  404

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALG-  825
             LRV       QGY LTE+  G F    +V  M GT G P+  ++  LESVPEMGYDAL  
Sbjct  405   LRVVTCAHVLQGYGLTETCAGSFVAQPDVLAMIGTVGPPLPIVDVCLESVPEMGYDALAS  464

Query  824   TVPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKL  645
             T PRGEIC+RGK LFSGY+KREDLT +V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKL
Sbjct  465   TPPRGEICIRGKCLFSGYYKREDLTEEVMIDGWFHTGDIGEWQLDGSMKIIDRKKNIFKL  524

Query  644   SQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFV  465
             SQGEYVAVE+LE+ YS    + A+W+YGNS+ESFLVAVV P  +++E WA+ N +TG F 
Sbjct  525   SQGEYVAVENLENNYSLASCIDAIWIYGNSYESFLVAVVNPNIESVERWAEENGQTGHFS  584

Query  464   SLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLL  285
             +LC++  A+ YIL+EL+  GK+ +L+GFE ++AVHL+PTPFD+ERDL+TPT+K KR Q L
Sbjct  585   ALCESPSAKAYILEELSKIGKEKKLKGFEFVKAVHLDPTPFDMERDLLTPTYKKKRSQFL  644

Query  284   NYYKDCIDQLYKEAK  240
              YY+D ID LYK A+
Sbjct  645   RYYQDVIDGLYKSAR  659



>ref|XP_010439129.1| PREDICTED: long chain acyl-CoA synthetase 4 [Camelina sativa]
Length=666

 Score =   359 bits (921),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 225/299 (75%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG  H E     D+L F K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   HMKKGQSHVEASPICDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL + PRGEIC+RGKT
Sbjct  418   YGLTESCAGSFVSLPDRLDMLGTVGPPVPNVDVRLESVPEMEYDALASTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE++E+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y     V +VWVYGNSFESFLVA+  P +  LE WA +N  +GD+ +LC+N+KA++++L
Sbjct  538   IYGEVQAVDSVWVYGNSFESFLVAIANPNQHILERWAADNNVSGDYNALCQNEKAKEFVL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL    K+ +++GFE+++A+HL+P PFD+ERDL+TPT+K KRPQLL YY+  ID++YK
Sbjct  598   GELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTYKKKRPQLLKYYQTVIDEMYK  656



>ref|NP_194116.1| long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
 sp|Q9T0A0.1|LACS4_ARATH RecName: Full=Long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
 gb|AAM28871.1|AF503754_1 long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
 emb|CAB43885.1| acyl-CoA synthetase-like protein [Arabidopsis thaliana]
 emb|CAB81303.1| acyl-CoA synthetase-like protein [Arabidopsis thaliana]
 gb|AAK83581.1| AT4g23850/T32A16_20 [Arabidopsis thaliana]
 gb|AEE84812.1| long chain acyl-CoA synthetase 4 [Arabidopsis thaliana]
Length=666

 Score =   358 bits (919),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 174/297 (59%), Positives = 222/297 (75%), Gaps = 0/297 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KG  H E     D+L F K+K   GG VR++LSGAAPL  H E FLRV       QGY 
Sbjct  360   KKGQSHVEASPLFDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQGYG  419

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL +  RGEIC+RGKTLF
Sbjct  420   LTESCAGTFVSLPDELGMLGTVGPPVPNVDIRLESVPEMEYDALASTARGEICIRGKTLF  479

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGY+KREDLT++V++DGW HTGD+GEWQPDG+MKIIDRKKNIFKLSQGEYVAVE++E+ Y
Sbjct  480   SGYYKREDLTKEVLIDGWLHTGDVGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENIENIY  539

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
                  V +VWVYGNSFESFL+A+  P +  LE WA  N  +GD+ +LC+N+KA+++IL E
Sbjct  540   GEVQAVDSVWVYGNSFESFLIAIANPNQHILERWAAENGVSGDYDALCQNEKAKEFILGE  599

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L    K+ +++GFE+++A+HL+P PFD+ERDL+TPTFK KRPQLL YY+  ID++YK
Sbjct  600   LVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTFKKKRPQLLKYYQSVIDEMYK  656



>ref|XP_002436512.1| hypothetical protein SORBIDRAFT_10g003970 [Sorghum bicolor]
 gb|EER87879.1| hypothetical protein SORBIDRAFT_10g003970 [Sorghum bicolor]
Length=649

 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 228/314 (73%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +       +  KG+KH++   F D+L F K+K   GG++R+++SG APL +  EEF
Sbjct  336   TLFNIAYKMKLDSMRKGIKHEKAAPFFDKLVFSKVKERLGGKLRVIVSGGAPLSVPVEEF  395

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G    I N + M GT G P+  I+ RLESVPEMGY AL +
Sbjct  396   LRVVTCAYVIQGYGLTETCAGSIVSIPNQYSMLGTVGPPVPHIDVRLESVPEMGYHALSS  455

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             VPRGEIC+RG  LFSGY+KREDL ++V++DGWFHTGDIGEWQPDG++K+IDRKKNIFKLS
Sbjct  456   VPRGEICIRGSVLFSGYYKREDLVQEVMIDGWFHTGDIGEWQPDGSLKVIDRKKNIFKLS  515

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     + ++WVYGNSFES LVAVV P +++LE WA+ N   G F  
Sbjct  516   QGEYVAVENLENVYGVLQDIDSIWVYGNSFESSLVAVVNPNQQSLERWAEQNGTAGSFAE  575

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++ +A+++IL EL    K+ +L+GFE ++A+HL+P PFDIERDL+TPT+K KRPQ+L 
Sbjct  576   LCEHSRAKEHILAELTKIAKEKKLKGFEFIKAIHLDPLPFDIERDLITPTYKKKRPQMLK  635

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID LYK  K
Sbjct  636   YYQGVIDALYKSMK  649



>ref|XP_001769302.1| predicted protein [Physcomitrella patens]
 gb|EDQ65856.1| predicted protein [Physcomitrella patens]
Length=663

 Score =   358 bits (919),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 179/287 (62%), Positives = 215/287 (75%), Gaps = 0/287 (0%)
 Frame = -2

Query  1133  GLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLT  954
             G KHD+    LD++ F+K+K+AFGG V+ ++SGAAPLP H EEFLRV       QGY LT
Sbjct  366   GFKHDKAAPILDKIIFNKVKMAFGGNVKCVISGAAPLPSHLEEFLRVVTCAPVVQGYGLT  425

Query  953   ES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSG  774
             ES    F  + +V  M GT G P+  IE RL SVPEMGYDALG   RGEIC+R KTLFSG
Sbjct  426   ESCAATFIQVPDVISMHGTVGPPLPNIEVRLVSVPEMGYDALGKPARGEICIRSKTLFSG  485

Query  773   YHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSR  594
             Y+KR DLT +V+VDGWF TGD+GEWQ DGAMKIIDRKKNIFKLSQGEYVAVE+LES Y +
Sbjct  486   YYKRPDLTDEVLVDGWFSTGDVGEWQEDGAMKIIDRKKNIFKLSQGEYVAVENLESIYGQ  545

Query  593   CPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELN  414
             C LV  +WVYGNS ES LVAV +P +  +E+WA+NN   GDF  +C++ K   +I+  LN
Sbjct  546   CELVDQIWVYGNSLESTLVAVCVPNQPKVEEWAKNNGLMGDFARICRDPKTHAHIMAALN  605

Query  413   NTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYK  273
              TGK  +++GFE++R V LEP PFD+ERDLVTPTFKLKR QLL YYK
Sbjct  606   ATGKAKKVKGFEVIRGVVLEPLPFDMERDLVTPTFKLKRSQLLQYYK  652



>gb|ACC91252.1| long-chain-fatty-acid-CoA ligase [Arabidopsis halleri]
Length=666

 Score =   358 bits (918),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 223/299 (75%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG  H E     D+  F K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   HMKKGKSHAEASPLCDKHVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL + PRGEIC+RGKT
Sbjct  418   YGLTESCAGTFVSLPDELDMLGTVGPPVPNVDIRLESVPEMEYDALASTPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE++E+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y     V +VWVYGNSFESFLVA+  P ++ LE WA  N  +GD+ +LC+N+KA+ +IL
Sbjct  538   IYGEVQAVDSVWVYGNSFESFLVAIANPNQQILERWAAENGVSGDYNALCQNEKAKDFIL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL    K+ +++GFE+++A+HL+P PFD+ERDL+TPTFK KRPQLL YY+  ID++YK
Sbjct  598   GELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTFKKKRPQLLKYYQSVIDEMYK  656



>ref|XP_009783796.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana sylvestris]
Length=658

 Score =   357 bits (917),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 223/302 (74%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             +  KG KH E    LD++ F+K+K   GG +RL+LSGAAPL    E +LR+       QG
Sbjct  357   SMSKGYKHAEAAPILDKIIFNKVKEGLGGNLRLILSGAAPLSSTVETYLRIVTCANVLQG  416

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F    +   M GT G P+  I+  LESVPEMGYDALG  PRGEIC+RGK 
Sbjct  417   YGLTETCAGSFVARPDELAMVGTVGPPLPIIDVCLESVPEMGYDALGNTPRGEICIRGKC  476

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V+VDGWFHTGD+GEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE 
Sbjct  477   LFSGYYKREDLTKEVLVDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLEG  536

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS    V A+W+YG+S+ESFLVAVV P   AL+ WA+ N  TGDF ++C+N KA+ YIL
Sbjct  537   IYSLASSVDAIWIYGSSYESFLVAVVNPNMGALQSWAEENGLTGDFDTICENPKAKAYIL  596

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL NT ++ +L+GFE ++AVHL+P PFD+ER+L+TPT K KR Q L YY++ ID LYK 
Sbjct  597   SELTNTAQEKKLKGFEFIKAVHLDPIPFDMERELLTPTHKKKRVQFLKYYQNIIDTLYKS  656

Query  245   AK  240
              +
Sbjct  657   KR  658



>ref|XP_009627714.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Nicotiana tomentosiformis]
Length=658

 Score =   357 bits (917),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 221/302 (73%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG KH E     D++ F+K+K   GG +RL+LSGAAPL    E +LRV       QG
Sbjct  357   NMSKGYKHAEAAPIFDKIIFNKVKEGLGGNLRLILSGAAPLSSTVETYLRVVTCANVLQG  416

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F    +   M GT G P+  I+  LESVPEMGYDALG  PRGEIC+RGK 
Sbjct  417   YGLTETCAGSFVARPDELAMVGTVGPPLPIIDVCLESVPEMGYDALGNTPRGEICIRGKC  476

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V+VDGWFHTGD+GEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE 
Sbjct  477   LFSGYYKREDLTKEVLVDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLEG  536

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS    V A+W+YG+S+ESFLVAVV P   AL+ WA+ N  TGDF ++C+N KA+ YIL
Sbjct  537   IYSLASSVDAIWIYGSSYESFLVAVVNPNMGALQSWAEENGLTGDFDTICENPKAKAYIL  596

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL NT K+ +L+GFE ++ VHL+P PFD+ER+L+TPT K KR Q L YY++ ID LY+ 
Sbjct  597   SELTNTAKEKKLKGFEFIKVVHLDPIPFDMERELLTPTHKKKRVQFLKYYQNIIDTLYES  656

Query  245   AK  240
              +
Sbjct  657   TR  658



>ref|XP_010448651.1| PREDICTED: long chain acyl-CoA synthetase 4 [Camelina sativa]
Length=666

 Score =   357 bits (916),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/299 (58%), Positives = 224/299 (75%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG  H E     D+L F K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  358   HMKKGQSHVEASPICDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL   PRGEIC+RGKT
Sbjct  418   YGLTESCAGSFVSLPDRLDMLGTVGPPVPNVDVRLESVPEMEYDALADKPRGEICIRGKT  477

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE++E+
Sbjct  478   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIEN  537

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y     V +VWVYGNSFESFLVA+  P +  LE WA +N  +GD+ +LC+N+KA++++L
Sbjct  538   IYGEVQAVDSVWVYGNSFESFLVAIANPNQHILEHWAADNNVSGDYNALCQNEKAKEFVL  597

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL    K+ +++GFE+++A+HL+P PFD+ERDL+TPT+K KRPQLL YY+  ID++YK
Sbjct  598   GELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTYKKKRPQLLKYYQTVIDEMYK  656



>ref|XP_002448672.1| hypothetical protein SORBIDRAFT_06g031250 [Sorghum bicolor]
 gb|EES13000.1| hypothetical protein SORBIDRAFT_06g031250 [Sorghum bicolor]
Length=661

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 227/303 (75%), Gaps = 2/303 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG KH+E     D+L F K+K   GGRVRL++SG APL  H EE+LRV       Q 
Sbjct  360   NMLKGSKHEEAAAVFDKLVFTKVKWGLGGRVRLIISGGAPLSRHVEEYLRVVTCSHVLQA  419

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT-VPRGEICLRGK  789
             Y LTE+  G F  + N   M GT G P+  +E RLESVPEMGYDA+ +  PRGEIC++G 
Sbjct  420   YGLTET-CGSFISLPNNMSMLGTVGPPLPHVEVRLESVPEMGYDAVSSETPRGEICIKGD  478

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             TLF GY+KREDLT +V+VDGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE++E
Sbjct  479   TLFLGYYKREDLTNEVLVDGWFHTGDIGEWQFDGSMKIIDRKKNIFKLSQGEYVAVENIE  538

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             + + + P V ++WVYGNSFES LV VV P ++ALE WAQ N  TGDF ++C++ K +++I
Sbjct  539   NIFGQTPGVDSIWVYGNSFESSLVTVVNPNKQALEHWAQTNGVTGDFATICEDPKVKEFI  598

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L EL  TGK+++L+GFE++RAVHL+P PFD +RDL+TPT+K KRPQLL +Y+  ID +YK
Sbjct  599   LRELTKTGKENKLKGFELVRAVHLDPAPFDKDRDLITPTYKKKRPQLLKHYQSIIDGMYK  658

Query  248   EAK  240
               K
Sbjct  659   SMK  661



>ref|XP_002975814.1| hypothetical protein SELMODRAFT_442966 [Selaginella moellendorffii]
 gb|EFJ23443.1| hypothetical protein SELMODRAFT_442966 [Selaginella moellendorffii]
Length=657

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 177/298 (59%), Positives = 221/298 (74%), Gaps = 2/298 (1%)
 Frame = -2

Query  1133  GLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDLT  954
             G K ++     D L F K+K   GGR RL++SGAAPL  H EEFLRV      +QGY LT
Sbjct  361   GFKQEKASPMADVLVFSKVKQRLGGRARLLISGAAPLADHVEEFLRVASCARMTQGYGLT  420

Query  953   ES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFSG  774
             E+    F  I +V+ M GT G P+  IE  L+SVPEM YDAL   P+GE+C+RGKTLFSG
Sbjct  421   ETCAASFISIPDVYSMHGTVGPPIPVIEVCLQSVPEMNYDALAETPKGEVCIRGKTLFSG  480

Query  773   YHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYSR  594
             Y+KREDLT + ++DGWFHTGDIGEW P+GA+KIIDRKKNIFKLSQGEYVAVE+LE+ Y +
Sbjct  481   YYKREDLTAECMIDGWFHTGDIGEWLPNGALKIIDRKKNIFKLSQGEYVAVENLENIYGQ  540

Query  593   CPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDELN  414
             CP   ++W+YGNSFESFLVAVVIP   AL+ WA+ N   GD   L  + KA+ +I+DEL+
Sbjct  541   CPTFDSIWIYGNSFESFLVAVVIPNEAALDAWAKENDVKGD--DLYTSPKAKAFIMDELS  598

Query  413   NTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEAK  240
              T K ++L+GFE ++AVHLE  PFD ERDL+TPTFK KRPQLLN+Y++ ID+LY+  K
Sbjct  599   RTAKNNKLKGFEFIKAVHLEKLPFDTERDLITPTFKKKRPQLLNFYRETIDELYRGLK  656



>ref|XP_010326994.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Solanum lycopersicum]
Length=661

 Score =   355 bits (912),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 177/302 (59%), Positives = 220/302 (73%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG +H E     D++ F+K+K   GG +RL+LSGAAPL    E +LRV       QG
Sbjct  360   NMSKGYRHSEAAPIFDKIIFNKVKEGLGGNLRLILSGAAPLSSTVETYLRVVTCANVLQG  419

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F    +   M GT G P+  I+  LESVPEMGYDALG  PRGEIC+RGK 
Sbjct  420   YGLTETCAGSFVARPDELAMVGTVGPPLPIIDVCLESVPEMGYDALGDTPRGEICIRGKC  479

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V+VDGWFHTGD+GEWQPDG+MKI+DRKKNIFKLSQGEYVAVE+LE 
Sbjct  480   LFSGYYKREDLTKEVLVDGWFHTGDVGEWQPDGSMKIVDRKKNIFKLSQGEYVAVENLEG  539

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS    V ++W+YG+S+ESFLVAVV P  +AL  WA  N  TGDF ++C+N KA+ YIL
Sbjct  540   IYSLASSVDSIWIYGSSYESFLVAVVNPNMEALRSWANENGMTGDFDTICENPKAKAYIL  599

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL N  K+ +L+GFE ++AVHL+P PFD+ER+L+TPT K KR Q L YY++ ID LYK 
Sbjct  600   SELTNIAKEKKLKGFEFIKAVHLDPVPFDMERELITPTHKKKRAQFLKYYQNNIDTLYKN  659

Query  245   AK  240
              +
Sbjct  660   TR  661



>gb|AAC33962.1| contains similarity to AMP-binding enzymes (Pfam: AMP-binding.hmm, 
score: 18.66, 25.90 and 43.55); most similar to acyl-CoA 
synthetases [Arabidopsis thaliana]
Length=733

 Score =   357 bits (916),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 175/297 (59%), Positives = 222/297 (75%), Gaps = 0/297 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG  H     F D+L F+K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  410   NMKKGQSHVAASPFCDKLVFNKVKQGLGGNVRIILSGAAPLASHIESFLRVVACCNVLQG  469

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F    +   M GT G P+  ++ RLESVPEM YDALG+ PRGEIC+RGKT
Sbjct  470   YGLTESCAGTFATFPDELDMLGTVGPPVPNVDIRLESVPEMNYDALGSTPRGEICIRGKT  529

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V +DGW HTGD+GEWQP+G+MKIIDRKKNIFKL+QGEYVAVE+LE+
Sbjct  530   LFSGYYKREDLTKEVFIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLAQGEYVAVENLEN  589

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS+  ++ ++WVYGNSFESFLVA+  P ++ LE WA  N   GDF S+C+N KA+ +IL
Sbjct  590   VYSQVEVIESIWVYGNSFESFLVAIANPAQQTLERWAVENGVNGDFNSICQNAKAKAFIL  649

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQL  255
              EL  T K+++L+GFE+++ VHLEP  FD+ERDL+TPT+K KRPQLL YY+  ++ L
Sbjct  650   GELVKTAKENKLKGFEIIKDVHLEPVAFDMERDLLTPTYKKKRPQLLKYYQVILNIL  706



>ref|XP_010433856.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X2 [Camelina 
sativa]
Length=623

 Score =   354 bits (908),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 220/296 (74%), Gaps = 0/296 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             KG  H E     D+  F K+K   GG VR++LSGAAPL  H E FLRV       QGY L
Sbjct  318   KGQSHVEASPICDKYVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQGYGL  377

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TES  G F  + +   M GT G P+  ++ RLESVPEM YDAL   PRGEIC+RGKTLFS
Sbjct  378   TESCAGSFVSLPDRLDMLGTVGPPVPNVDVRLESVPEMEYDALADKPRGEICIRGKTLFS  437

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE++E+ Y 
Sbjct  438   GYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIENIYG  497

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 V +VWVYGNSFESFLVAV  P +  LE WA  N  +GD+ +LC+N+KA++++L EL
Sbjct  498   EVQAVDSVWVYGNSFESFLVAVANPNQHILEHWAAENGVSGDYNALCQNEKAKEFVLGEL  557

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
                 K+ +++GFE+++A+HL+P PFD+ERDL+TPT+K KRPQLL YY+  ID++YK
Sbjct  558   VKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTYKKKRPQLLKYYQTVIDEMYK  613



>ref|XP_006285040.1| hypothetical protein CARUB_v10006348mg [Capsella rubella]
 gb|EOA17938.1| hypothetical protein CARUB_v10006348mg [Capsella rubella]
Length=687

 Score =   355 bits (912),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 222/299 (74%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG  H E     D+L F K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  379   HMKKGQSHVEASPMCDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQG  438

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL + PRGEIC+RGKT
Sbjct  439   YGLTESCAGSFVSLPDKLDMLGTVGPPVPNVDIRLESVPEMEYDALASTPRGEICIRGKT  498

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE++E+
Sbjct  499   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIEN  558

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y     V +VWVYGNSFESFLVAV  P +  LE WA  N  +GD+ +LC+N KA+++IL
Sbjct  559   IYGEVQAVDSVWVYGNSFESFLVAVANPNQHILEHWAAENGVSGDYEALCQNAKAKEFIL  618

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL    K+ +++GFE+++A+HL+P PFD+ERDL+TPT+K KRPQL  YY+  ID++YK
Sbjct  619   GELVKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTYKKKRPQLQKYYQSVIDEMYK  677



>ref|XP_003564297.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Brachypodium 
distachyon]
Length=650

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 227/314 (72%), Gaps = 0/314 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             TL  +       +  KG KH++   F D+L F K+K   GGR+R+++SG APL +  EEF
Sbjct  337   TLFNLAYKLKLDSMRKGFKHEKASPFFDKLVFSKVKERLGGRLRVIMSGGAPLAVAVEEF  396

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
             LRV       QGY LTE+  G F  I N F M GT G P+  ++ RLESV EMGYDAL +
Sbjct  397   LRVVTCAHVVQGYGLTETCAGSFVAIPNDFSMLGTVGPPVPHVDVRLESVSEMGYDALSS  456

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
             +PRGE+C++G  LFSGY+KREDLT++V++DGWFHTGD+GEWQ +G++KIIDRKKNIFKLS
Sbjct  457   IPRGEVCVKGSVLFSGYYKREDLTQEVMIDGWFHTGDVGEWQSNGSLKIIDRKKNIFKLS  516

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE+ Y     V ++WVYGNSFES+LVA++ P ++ALE WA++N   G    
Sbjct  517   QGEYVAVENLENVYGVLQEVDSIWVYGNSFESYLVAIINPNQQALEQWAEHNGIAGSLAE  576

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC+N + +++ L EL    K+ +L+GFE +RA+HL+P PFD+ER+L+TPT+K KRPQ+L 
Sbjct  577   LCENSRTKEHFLAELAKIAKERKLKGFEFIRAIHLDPLPFDMERNLITPTYKKKRPQMLK  636

Query  281   YYKDCIDQLYKEAK  240
             YY+  ID LYK  K
Sbjct  637   YYQGAIDALYKSTK  650



>ref|XP_010433854.1| PREDICTED: long chain acyl-CoA synthetase 4-like isoform X1 [Camelina 
sativa]
Length=666

 Score =   353 bits (907),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 220/296 (74%), Gaps = 0/296 (0%)
 Frame = -2

Query  1136  KGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYDL  957
             KG  H E     D+  F K+K   GG VR++LSGAAPL  H E FLRV       QGY L
Sbjct  361   KGQSHVEASPICDKYVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQGYGL  420

Query  956   TES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLFS  777
             TES  G F  + +   M GT G P+  ++ RLESVPEM YDAL   PRGEIC+RGKTLFS
Sbjct  421   TESCAGSFVSLPDRLDMLGTVGPPVPNVDVRLESVPEMEYDALADKPRGEICIRGKTLFS  480

Query  776   GYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTYS  597
             GY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE++E+ Y 
Sbjct  481   GYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENIENIYG  540

Query  596   RCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDEL  417
                 V +VWVYGNSFESFLVAV  P +  LE WA  N  +GD+ +LC+N+KA++++L EL
Sbjct  541   EVQAVDSVWVYGNSFESFLVAVANPNQHILEHWAAENGVSGDYNALCQNEKAKEFVLGEL  600

Query  416   NNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
                 K+ +++GFE+++A+HL+P PFD+ERDL+TPT+K KRPQLL YY+  ID++YK
Sbjct  601   VKMAKEKKMKGFEIIKAIHLDPVPFDMERDLLTPTYKKKRPQLLKYYQTVIDEMYK  656



>ref|XP_006339697.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Solanum tuberosum]
Length=656

 Score =   352 bits (903),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 219/302 (73%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG +H E     D++ F+K+K   GG +RL+LSGAAPL    E +LRV       QG
Sbjct  355   NMSKGYRHSEAAPIFDKIIFNKVKEGLGGNLRLILSGAAPLSSTVETYLRVVTCANVLQG  414

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F    +   M GT G P+  I+  LESVPEMGYDA G  PRGEIC+RGK 
Sbjct  415   YGLTETCAGSFVARPDELAMVGTVGPPLPIIDVCLESVPEMGYDAFGDTPRGEICIRGKC  474

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V+VDGWFHTGD+GEWQPDG+MKIIDRKKNIFKLSQGEYVAVE+LE 
Sbjct  475   LFSGYYKREDLTKEVLVDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLEG  534

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              YS    V ++W+YG+S+ESFLVAVV P  +AL  WA  N  TGDF ++C+N KA+ +IL
Sbjct  535   IYSLASSVDSIWIYGSSYESFLVAVVNPNMEALRSWANENGMTGDFDTICENPKAKVHIL  594

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL N  K+ +L+GFE ++AVHL+P PFD+ER+L+TPT K KR Q L YY++ ID LYK 
Sbjct  595   SELTNIAKEKKLKGFEFIKAVHLDPVPFDMERELITPTHKKKRAQFLKYYQNNIDTLYKN  654

Query  245   AK  240
              +
Sbjct  655   TR  656



>ref|XP_007160159.1| hypothetical protein PHAVU_002G297800g [Phaseolus vulgaris]
 gb|ESW32153.1| hypothetical protein PHAVU_002G297800g [Phaseolus vulgaris]
Length=665

 Score =   352 bits (904),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 170/299 (57%), Positives = 220/299 (74%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N  KG  H++     DR+ F+K+K A GGRVR++LSGAAPL  H E FLRV       QG
Sbjct  357   NISKGKSHEDASPLFDRIVFNKVKQALGGRVRIILSGAAPLSKHVEGFLRVVTCAHILQG  416

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F  + N   M GT G P+  ++  LES+PEMGYDAL + P GEIC+RGKT
Sbjct  417   YGLTETCAGTFVSLPNEKDMLGTVGPPVPFVDVCLESIPEMGYDALASTPSGEICVRGKT  476

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             +F+GYHKREDLT++V+ +GWFHTGDIGEWQP+GAMKI+DRKKNIFKLSQGEYVAVE LE+
Sbjct  477   VFTGYHKREDLTKEVMTNGWFHTGDIGEWQPNGAMKIVDRKKNIFKLSQGEYVAVEHLEN  536

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y +  +V ++W+YGNSFES+LVA+V   +   E WA+ N  T DF SLC + + + Y++
Sbjct  537   IYVQASVVESIWIYGNSFESYLVAIVNLHKPTTEQWAEENNITADFDSLCGDSRTKTYVI  596

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL    K  +L+GFE ++AVHL+P PFD+ER L+TPTFK KRP+LL YY++ ID++YK
Sbjct  597   GELVKIAKDKKLKGFEFIKAVHLDPVPFDMERGLMTPTFKKKRPELLKYYQNTIDEMYK  655



>gb|EPS71028.1| hypothetical protein M569_03729, partial [Genlisea aurea]
Length=610

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 229/323 (71%), Gaps = 3/323 (1%)
 Frame = -2

Query  1199  GTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLP  1020
             G   + TL     +   RN  KG K  E   F D+L F+K+K   GG+VR++LSGAAPL 
Sbjct  288   GGLVKNTLFNFSYSLKLRNMRKGCKVSEAAPFADKLVFNKVKQGLGGKVRIILSGAAPLA  347

Query  1019  MHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMG  840
              H EEFLRV       QGY LTE+  G F  + +   M GT G P+  ++  LESVPEMG
Sbjct  348   AHVEEFLRVVSCCYVLQGYGLTETCAGTFVSLPDKLTMLGTVGPPVPNVDVCLESVPEMG  407

Query  839   YDALGTV--PRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDR  666
             YDA+ +   PRGEIC+RG  LFSGY+KR+DLT +V VDGWFHTGDIGEWQ DG++KIIDR
Sbjct  408   YDAVSSSVPPRGEICIRGGVLFSGYYKRDDLTAEVFVDGWFHTGDIGEWQADGSLKIIDR  467

Query  665   KKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNN  486
             KKNIFKLSQGEYVAVE+LE+ Y +  ++ ++W+YGNSFESFLVAVV P + A+E WA +N
Sbjct  468   KKNIFKLSQGEYVAVENLENIYGQLSILDSLWIYGNSFESFLVAVVNPNQAAVERWAADN  527

Query  485   R-ETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTF  309
                +GD  +LC N   + +IL EL    K+ +L+GFE+++ VH++P PFD+ERDL+TPTF
Sbjct  528   GIPSGDLETLCSNPGVKDHILGELKRIAKEKKLKGFEIMKDVHIDPIPFDMERDLITPTF  587

Query  308   KLKRPQLLNYYKDCIDQLYKEAK  240
             K KR QLL YY+D ID++YK AK
Sbjct  588   KKKRAQLLKYYQDVIDRMYKNAK  610



>ref|XP_006413507.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
 ref|XP_006413508.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
 gb|ESQ54960.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
 gb|ESQ54961.1| hypothetical protein EUTSA_v10024614mg [Eutrema salsugineum]
Length=666

 Score =   350 bits (898),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 178/297 (60%), Positives = 224/297 (75%), Gaps = 0/297 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KG  H E     D+L F K+K   GG VR++LSGAAPL  H E FLRV       QGY 
Sbjct  360   KKGQSHVEASPLSDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQGYG  419

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL + PRGEIC+RGKTLF
Sbjct  420   LTESCAGTFVSLPDRLDMLGTVGPPVPNVDIRLESVPEMEYDALASTPRGEICIRGKTLF  479

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE+LE+ Y
Sbjct  480   SGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENLENIY  539

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
                  V +VWVYGNSFESFLVAV  P +  LE WA  N  +GD+ +LC+N KA+++IL E
Sbjct  540   GEAQAVDSVWVYGNSFESFLVAVANPNQHILEKWAAENGVSGDYSALCQNAKAKEFILGE  599

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L   GK+ +++GFE+++AVHL+P PFD+ERDL+TPTFK KRPQLL +Y++ ID++YK
Sbjct  600   LVKMGKEKKMKGFEIIKAVHLDPVPFDMERDLLTPTFKKKRPQLLKHYQNVIDEMYK  656



>ref|XP_004143868.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Cucumis sativus]
Length=664

 Score =   349 bits (895),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 222/299 (74%), Gaps = 0/299 (0%)
 Frame = -2

Query  1139  EKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQGYD  960
             +KG  H +     D++ FDK+K   GG VR++LSG APL  H E F RV       QGY 
Sbjct  361   QKGKTHQQAAPLFDKVVFDKVKKGLGGNVRIILSGGAPLAAHIETFFRVVSCAHVLQGYG  420

Query  959   LTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKTLF  780
             LTE+ GG F  + +  PM GT G P+  ++  LESVPEMGYD+  + PRGE+C++G TLF
Sbjct  421   LTETCGGTFVSLPDELPMLGTVGPPVPNVDICLESVPEMGYDSHASTPRGEVCIKGDTLF  480

Query  779   SGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLESTY  600
             SGY+KR+DLT +V+VDGWFHTGD+GEWQPDG++KIIDRKKNIFKLSQGEYVAVE+LE  Y
Sbjct  481   SGYYKRDDLTTEVLVDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLSQGEYVAVENLELIY  540

Query  599   SRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYILDE  420
                  +  +W+YGNSFESFLVAVV P+++ALE WA+ N   GDF +LC++++A+ YIL +
Sbjct  541   GLVSDIEMIWIYGNSFESFLVAVVNPKKQALEQWAEENGIKGDFNALCEDKRAKDYILGQ  600

Query  419   LNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKEA  243
             L+   K+ +L+G+E +RAVHL+P PFDIERDL+TP+FK KRPQLL YY+  ID +YK  
Sbjct  601   LSKIAKEQKLKGYENIRAVHLDPLPFDIERDLLTPSFKKKRPQLLKYYQKEIDDMYKSG  659



>ref|XP_008437390.1| PREDICTED: long chain acyl-CoA synthetase 4-like [Cucumis melo]
Length=664

 Score =   348 bits (894),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 226/313 (72%), Gaps = 0/313 (0%)
 Frame = -2

Query  1181  TLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEF  1002
             +L  +  +      +KG KH +     D++ FDK+K   GG VR++LSG APL  H E F
Sbjct  347   SLFNLAYSYKYNQMQKGKKHQQAAPLFDKVVFDKVKKGLGGNVRIILSGGAPLAAHIETF  406

Query  1001  LRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT  822
              RV       QGY LTE+ GG F  + +  PM GT G P+  ++  LESVPEMGYD+  +
Sbjct  407   FRVVSCAHVLQGYGLTETCGGTFVTLPDELPMLGTVGPPVPNVDICLESVPEMGYDSHAS  466

Query  821   VPRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLS  642
              PRGE+C++G TLFSGY+KR+DLT +V+VDGWFHTGD+GEWQPDG++KIIDRKKNIFKLS
Sbjct  467   TPRGEVCIKGDTLFSGYYKRDDLTTEVLVDGWFHTGDVGEWQPDGSLKIIDRKKNIFKLS  526

Query  641   QGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVS  462
             QGEYVAVE+LE  Y     +  +W+YGNSFESFLVAVV P+++ALE WA+ N    DF +
Sbjct  527   QGEYVAVENLELIYGLVSDIEMIWIYGNSFESFLVAVVNPKKQALEQWAEENGIKEDFNA  586

Query  461   LCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLN  282
             LC++++A+ YIL +L+   K+ +L+G+E +RAVHL+P PFDIERDL+TP+FK KRPQLL 
Sbjct  587   LCEDKRAKDYILGQLSKIAKEQKLKGYENIRAVHLDPLPFDIERDLLTPSFKKKRPQLLK  646

Query  281   YYKDCIDQLYKEA  243
             YY+  ID +YK  
Sbjct  647   YYQKEIDDMYKSG  659



>gb|EMT05055.1| Fatty acyl-CoA synthetase A [Aegilops tauschii]
Length=735

 Score =   350 bits (898),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 226/302 (75%), Gaps = 0/302 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG+KH++   F D+L F K+K   GG++R+++SG APL +  EEFLRV       QG
Sbjct  368   SMKKGIKHEKASPFFDKLVFSKVKERLGGKIRIIVSGGAPLAVAVEEFLRVVTCAHVVQG  427

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTE+  G F  I N F M GT G P+  I+ RLESV EMGYDAL ++PRGE+C++G  
Sbjct  428   YGLTETCAGSFAAIPNEFSMAGTVGPPVPHIDVRLESVSEMGYDALASIPRGEVCVKGSV  487

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V+ DGWFHTGD+GEWQP+GA+KIIDRKKNIFKLSQGEYVAVE+LE+
Sbjct  488   LFSGYYKREDLTQEVLTDGWFHTGDVGEWQPNGALKIIDRKKNIFKLSQGEYVAVENLEN  547

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y   P + ++WVYGNSFESFL+AV+ P ++ALE+WA  N  TG    LC+N K +++ +
Sbjct  548   IYGVLPEIDSIWVYGNSFESFLIAVINPNQQALENWAGQNGVTGSLAELCENAKTKEHFI  607

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYKE  246
              EL    K+ +L+GFE +RAVHL+  PFD+ERDL+TPT+K KRPQ+L YY+  ID LYK 
Sbjct  608   AELAKAAKEKKLKGFEFVRAVHLDAVPFDMERDLITPTYKKKRPQMLKYYQGAIDALYKS  667

Query  245   AK  240
             + 
Sbjct  668   SN  669



>emb|CDY47618.1| BnaA01g13470D [Brassica napus]
Length=667

 Score =   348 bits (892),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 224/299 (75%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG  H E     D+L F K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  359   HMKKGQSHVEASPLCDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQG  418

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL + PRGEIC+RGKT
Sbjct  419   YGLTESCAGTFVSLPDRLDMLGTVGPPVPNVDIRLESVPEMEYDALASTPRGEICIRGKT  478

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE+LE+
Sbjct  479   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENLEN  538

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y     V +VWVYGNSFESFL+AV  P +  LE WA  N  +GD+ +LC+N KA+++IL
Sbjct  539   IYGEVQAVDSVWVYGNSFESFLIAVANPNQHILEKWAAENGVSGDYNALCQNAKAKEFIL  598

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL   GK+ +++GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL +Y+  ID++YK
Sbjct  599   GELVKMGKEKKMKGFEIIKAVHLDPVPFDMERDLLTPTYKKKRPQLLKHYQSVIDEMYK  657



>ref|XP_009137437.1| PREDICTED: long chain acyl-CoA synthetase 4 [Brassica rapa]
Length=667

 Score =   348 bits (892),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 176/299 (59%), Positives = 224/299 (75%), Gaps = 0/299 (0%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             + +KG  H E     D+L F K+K   GG VR++LSGAAPL  H E FLRV       QG
Sbjct  359   HMKKGQSHVEASPLCDKLVFSKVKQGLGGNVRIILSGAAPLASHVESFLRVVACCHVLQG  418

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGKT  786
             Y LTES  G F  + +   M GT G P+  ++ RLESVPEM YDAL + PRGEIC+RGKT
Sbjct  419   YGLTESCAGTFVSLPDRLDMLGTVGPPVPNVDIRLESVPEMEYDALASTPRGEICIRGKT  478

Query  785   LFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLES  606
             LFSGY+KREDLT++V++DGW HTGD+GEWQP+G+MKIIDRKKNIFKLSQGEYVAVE+LE+
Sbjct  479   LFSGYYKREDLTKEVLIDGWLHTGDVGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENLEN  538

Query  605   TYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYIL  426
              Y     V +VWVYGNSFESFL+AV  P +  LE WA  N  +GD+ +LC+N KA+++IL
Sbjct  539   IYGEVQAVDSVWVYGNSFESFLIAVANPNQHILEKWAAENGVSGDYNALCQNAKAKEFIL  598

Query  425   DELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
              EL   GK+ +++GFE+++AVHL+P PFD+ERDL+TPT+K KRPQLL +Y+  ID++YK
Sbjct  599   GELVKMGKEKKMKGFEIIKAVHLDPVPFDMERDLLTPTYKKKRPQLLKHYQSVIDEMYK  657



>gb|EYU32231.1| hypothetical protein MIMGU_mgv1a002558mg [Erythranthe guttata]
Length=659

 Score =   345 bits (886),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/303 (57%), Positives = 222/303 (73%), Gaps = 0/303 (0%)
 Frame = -2

Query  1148  RNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQ  969
             RN  KG  H E    LD+L FDK+K   GG +RL+LSGAAPL    E FLRV       Q
Sbjct  357   RNMSKGYSHAEAAPLLDKLVFDKVKEGLGGNLRLILSGAAPLSSSVETFLRVVTCAHVLQ  416

Query  968   GYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGTVPRGEICLRGK  789
             GY LTE+  G F  + +   M GT G P+  I+  LESVP+MGYDAL   PRGEIC+RGK
Sbjct  417   GYGLTETCAGSFVALPDELTMIGTVGPPLPGIDICLESVPDMGYDALSVTPRGEICVRGK  476

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGY+KR+DLT++VV+D WFHTGDIGEWQ +G+MKIIDRKKNIFKLSQGEYV+VE+LE
Sbjct  477   SVFSGYYKRDDLTKEVVIDEWFHTGDIGEWQQNGSMKIIDRKKNIFKLSQGEYVSVENLE  536

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNNRETGDFVSLCKNQKARKYI  429
             S YS    V A+W+YG+S+ESFLV+V+ P  ++L  WA+ N+  GD  ++C++Q+ARKYI
Sbjct  537   SIYSLAYCVDAIWIYGSSYESFLVSVINPNIESLHRWAEANQIFGDIGTICEDQRARKYI  596

Query  428   LDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFKLKRPQLLNYYKDCIDQLYK  249
             L EL   GK+ +L+GFE ++AVHL+PTPFD+ERDL+TPT+K KR     YY+  ++ +YK
Sbjct  597   LGELTKIGKEKKLKGFEFIKAVHLDPTPFDMERDLITPTYKKKRNCFYKYYQIAVEDMYK  656

Query  248   EAK  240
               K
Sbjct  657   STK  659



>ref|XP_006303931.1| hypothetical protein CARUB_v10008590mg [Capsella rubella]
 gb|EOA36829.1| hypothetical protein CARUB_v10008590mg [Capsella rubella]
Length=623

 Score =   344 bits (882),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 207/260 (80%), Gaps = 2/260 (1%)
 Frame = -2

Query  1145  NREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPLPMHEEEFLRVTRGWV*SQG  966
             N +KG   +E    LDRL FDK+K A GGR  ++LSGAAPLP H EEFLR+      SQG
Sbjct  358   NMKKGFSQEEASPRLDRLMFDKLKEALGGRAHMLLSGAAPLPRHVEEFLRIIPASNLSQG  417

Query  965   YDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEMGYDALGT-VPRGEICLRGK  789
             Y LTES GG F  +A VF M GT GVPM T+EARLESVPEMGYDA    VPRGEICLRG 
Sbjct  418   YGLTESCGGSFTTLAGVFSMVGTVGVPMPTVEARLESVPEMGYDAFSADVPRGEICLRGT  477

Query  788   TLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDRKKNIFKLSQGEYVAVESLE  609
             ++FSGYHKR+DLT  V++DGWFHTGDIGEWQ DG+MKIIDRKKNIFKLSQGEYVAVE+LE
Sbjct  478   SMFSGYHKRQDLTDQVLIDGWFHTGDIGEWQEDGSMKIIDRKKNIFKLSQGEYVAVENLE  537

Query  608   STYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQ-NNRETGDFVSLCKNQKARKY  432
             +TYSRCPL+A +W+YGNSFESFLV VV+P++KA+EDWA+ NN+   DF SLC+N KA+KY
Sbjct  538   NTYSRCPLIAQIWIYGNSFESFLVGVVVPDKKAIEDWAKLNNQFPNDFESLCQNLKAQKY  597

Query  431   ILDELNNTGKKHQLRGFEML  372
              LDELN+T K++Q+    +L
Sbjct  598   FLDELNSTAKQYQVSTLLIL  617



>ref|XP_001768992.1| predicted protein [Physcomitrella patens]
 gb|EDQ66190.1| predicted protein [Physcomitrella patens]
Length=686

 Score =   346 bits (887),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 173/311 (56%), Positives = 227/311 (73%), Gaps = 1/311 (0%)
 Frame = -2

Query  1202  GGTREETTLSTMPITTNRRNREKGLKHDEPDLFLDRLGFDKIKLAFGGRVRLMLSGAAPL  1023
               +R ++ L  +  +      + G K D+     D+L F+K+++  GGRVRL++SGAAPL
Sbjct  339   AASRTKSLLFNLAYSNKLWWMKNGYKQDKASPLFDKLVFNKVRMGLGGRVRLVISGAAPL  398

Query  1022  PMHEEEFLRVTRGWV*SQGYDLTES*GGCFKCIANVFpmtgtggvpmtTIEARLESVPEM  843
               H EEFLRV       QGY LTE+    F  + +V  M+GT G  +  IE RLESVPE+
Sbjct  399   AGHVEEFLRVIMCAPVLQGYGLTETCAASFIQMPDVISMSGTVGPSLCNIETRLESVPEL  458

Query  842   GYDALGTV-PRGEICLRGKTLFSGYHKREDLTRDVVVDGWFHTGDIGEWQPDGAMKIIDR  666
             GYDAL    PRGEIC+RGKT+FSGY+KR +LT +V+VDGWFHTGDIGEWQ DG+MKIIDR
Sbjct  459   GYDALDKKRPRGEICIRGKTVFSGYYKRPELTEEVLVDGWFHTGDIGEWQADGSMKIIDR  518

Query  665   KKNIFKLSQGEYVAVESLESTYSRCPLVAAVWVYGNSFESFLVAVVIPERKALEDWAQNN  486
             KKNIFKLSQGEY+AVE LE+ Y++   V A+WVYGNSFES +VAV +P  + L DWA++N
Sbjct  519   KKNIFKLSQGEYIAVEKLENVYNQSAAVDAIWVYGNSFESSMVAVAVPNEQVLLDWAKSN  578

Query  485   RETGDFVSLCKNQKARKYILDELNNTGKKHQLRGFEMLRAVHLEPTPFDIERDLVTPTFK  306
              +  +F +LCK  +A+K+IL EL++TGKK  +RGFE ++ V L+P PFD+ERDL+TPT+K
Sbjct  579   GKKEEFAALCKIPEAQKFILSELSSTGKKSGVRGFEFIKGVLLDPQPFDMERDLITPTYK  638

Query  305   LKRPQLLNYYK  273
             LKRPQLL +Y+
Sbjct  639   LKRPQLLKHYQ  649



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3726600057484