BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12427

Length=1053
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620998.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    552   0.0      Nicotiana tomentosiformis
gb|KJB65560.1|  hypothetical protein B456_010G101200                    551   0.0      Gossypium raimondii
gb|KHG00684.1|  Glycine dehydrogenase [decarboxylating], mitochon...    551   0.0      Gossypium arboreum [tree cotton]
ref|XP_009797115.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    548   0.0      Nicotiana sylvestris
gb|KJB54687.1|  hypothetical protein B456_009G045100                    547   0.0      Gossypium raimondii
sp|O49954.1|GCSP_SOLTU  RecName: Full=Glycine dehydrogenase (deca...    545   0.0      Solanum tuberosum [potatoes]
ref|XP_007012280.1|  Glycine decarboxylase P-protein 1                  545   0.0      
gb|KHG06307.1|  Glycine dehydrogenase [decarboxylating], mitochon...    543   0.0      Gossypium arboreum [tree cotton]
ref|XP_011081684.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    543   0.0      Sesamum indicum [beniseed]
ref|XP_010262151.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    541   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_004245101.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    540   2e-180   Solanum lycopersicum
ref|XP_006361002.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    541   3e-180   
ref|XP_003544533.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    540   5e-180   Glycine max [soybeans]
emb|CBI20667.3|  unnamed protein product                                528   5e-180   Vitis vinifera
ref|XP_011097886.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    540   5e-180   Sesamum indicum [beniseed]
emb|CDP08258.1|  unnamed protein product                                537   2e-179   Coffea canephora [robusta coffee]
ref|XP_002516446.1|  glycine dehydrogenase, putative                    536   1e-178   Ricinus communis
ref|XP_010047334.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    535   2e-178   Eucalyptus grandis [rose gum]
ref|XP_008220472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    535   2e-178   Prunus mume [ume]
ref|XP_004498895.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    536   3e-178   
ref|XP_012077290.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    535   3e-178   Jatropha curcas
ref|XP_003550270.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    534   5e-178   Glycine max [soybeans]
ref|XP_011019466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    533   1e-177   Populus euphratica
gb|ABO61734.1|  mitochondrial glycine decarboxylase complex P-pro...    533   2e-177   Populus tremuloides
ref|XP_002308562.1|  P-protein subunit of glycine decarboxylase e...    533   2e-177   Populus trichocarpa [western balsam poplar]
ref|XP_010519851.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    533   2e-177   Tarenaya hassleriana [spider flower]
sp|P26969.1|GCSP_PEA  RecName: Full=Glycine dehydrogenase (decarb...    532   5e-177   Pisum sativum [garden pea]
emb|CAN63089.1|  hypothetical protein VITISV_032016                     531   7e-177   Vitis vinifera
ref|XP_007227061.1|  hypothetical protein PRUPE_ppa000675mg             531   7e-177   
ref|XP_003589000.1|  Glycine dehydrogenase P protein                    531   1e-176   Medicago truncatula
gb|ADM18296.1|  mitochondrial glycine decarboxylase complex P-pro...    506   2e-176   Nicotiana benthamiana
ref|XP_010648358.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    530   2e-176   Vitis vinifera
ref|XP_003523643.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    529   2e-176   Glycine max [soybeans]
ref|XP_008393646.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    530   3e-176   Malus domestica [apple tree]
ref|XP_008444466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    529   4e-176   Cucumis melo [Oriental melon]
dbj|BAD81530.1|  P protein-like                                         503   4e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010049196.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    529   7e-176   Eucalyptus grandis [rose gum]
gb|EYU20359.1|  hypothetical protein MIMGU_mgv1a000655mg                528   8e-176   Erythranthe guttata [common monkey flower]
ref|XP_008797766.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    528   9e-176   Phoenix dactylifera
gb|AAL24244.1|  AT4g33010/F26P21_130                                    517   1e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142925.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    528   1e-175   Cucumis sativus [cucumbers]
gb|EYU29323.1|  hypothetical protein MIMGU_mgv1a000648mg                527   2e-175   Erythranthe guttata [common monkey flower]
ref|XP_009361863.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    527   2e-175   Pyrus x bretschneideri [bai li]
gb|AEP95751.1|  glycine decarboxylase complex subunit P                 500   2e-175   Cicer arietinum [garbanzo]
ref|NP_001289247.1|  glycine dehydrogenase (decarboxylating), mit...    527   2e-175   Pyrus x bretschneideri [bai li]
gb|KHN29723.1|  Glycine dehydrogenase [decarboxylating], mitochon...    526   3e-175   Glycine soja [wild soybean]
ref|XP_009361869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    526   5e-175   Pyrus x bretschneideri [bai li]
ref|XP_010526062.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    526   8e-175   Tarenaya hassleriana [spider flower]
ref|XP_004291039.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    525   1e-174   Fragaria vesca subsp. vesca
dbj|BAD81529.1|  P protein-like                                         506   2e-174   Oryza sativa Japonica Group [Japonica rice]
gb|AFW56072.1|  hypothetical protein ZEAMMB73_271256                    505   5e-174   
ref|XP_007161011.1|  hypothetical protein PHAVU_001G035500g             523   1e-173   Phaseolus vulgaris [French bean]
ref|XP_002867212.1|  hypothetical protein ARALYDRAFT_491390             522   1e-173   
gb|AAK68740.1|  P-Protein - like protein                                522   1e-173   Arabidopsis thaliana [mouse-ear cress]
gb|KHN32209.1|  Glycine dehydrogenase [decarboxylating], mitochon...    522   1e-173   Glycine soja [wild soybean]
ref|XP_003526001.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    522   1e-173   Glycine max [soybeans]
ref|NP_195027.1|  glycine dehydrogenase [decarboxylating] 2             522   2e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392931.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    520   1e-172   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS46370.1|  Glycine dehydrogenase [decarboxylating] B, mitoch...    512   2e-172   Triticum urartu
ref|XP_006644607.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    517   2e-172   Oryza brachyantha
gb|AAL57651.1|  AT4g33010/F26P21_130                                    519   2e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808050.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    519   4e-172   Phoenix dactylifera
ref|NP_180178.1|  glycine decarboxylase P-protein 2                     518   5e-172   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98954.1|  putative glycine dehydrogenase                         518   5e-172   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29912.1|  hypothetical protein AALP_AA7G194500                    518   7e-172   Arabis alpina [alpine rockcress]
gb|AAA63798.1|  victorin binding protein                                517   1e-171   Avena sativa [cultivated oat]
gb|KDO80088.1|  hypothetical protein CISIN_1g001531mg                   513   3e-171   Citrus sinensis [apfelsine]
ref|XP_002880741.1|  hypothetical protein ARALYDRAFT_481465             516   4e-171   
ref|XP_010667776.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    516   6e-171   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006412401.1|  hypothetical protein EUTSA_v10024257mg             518   1e-170   
ref|XP_006450834.1|  hypothetical protein CICLE_v10007310mg             515   1e-170   Citrus clementina [clementine]
ref|XP_006475931.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    515   2e-170   Citrus sinensis [apfelsine]
emb|CDM83805.1|  unnamed protein product                                514   2e-170   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569669.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    514   2e-170   Brachypodium distachyon [annual false brome]
ref|XP_010942763.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    514   3e-170   Elaeis guineensis
gb|EMT12369.1|  Glycine dehydrogenase (decarboxylating), mitochon...    513   3e-170   
ref|XP_010925018.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    513   4e-170   Elaeis guineensis
ref|XP_010097067.1|  Glycine cleavage system P protein 1                514   4e-170   
ref|XP_006408846.1|  hypothetical protein EUTSA_v10001891mg             513   4e-170   Eutrema salsugineum [saltwater cress]
gb|AAB82711.1|  glycine decarboxylase P subunit                         512   1e-169   x Tritordeum sp.
gb|KFK32542.1|  hypothetical protein AALP_AA6G256500                    511   2e-169   Arabis alpina [alpine rockcress]
ref|XP_002441849.1|  hypothetical protein SORBIDRAFT_08g003440          511   3e-169   Sorghum bicolor [broomcorn]
ref|XP_004969722.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    511   3e-169   
gb|EAZ13293.1|  hypothetical protein OsJ_03218                          511   4e-169   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75571.1|  hypothetical protein OsI_03474                          510   6e-169   Oryza sativa Indica Group [Indian rice]
gb|EAZ37623.1|  hypothetical protein OsJ_21958                          509   6e-169   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044046.1|  Os01g0711400                                       510   7e-169   
emb|CBI27919.3|  unnamed protein product                                509   8e-169   Vitis vinifera
dbj|BAD35509.1|  putative glycine dehydrogenase                         509   1e-168   Oryza sativa Japonica Group [Japonica rice]
gb|AEP95746.1|  glycine decarboxylase complex subunit P                 483   1e-168   Cicer arietinum [garbanzo]
ref|XP_002282271.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    509   1e-168   Vitis vinifera
ref|NP_001292744.1|  glycine dehydrogenase (decarboxylating), mit...    509   2e-168   Zea mays [maize]
ref|XP_006858311.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    506   5e-167   Amborella trichopoda
sp|O49852.1|GCSP_FLATR  RecName: Full=Glycine dehydrogenase (deca...    504   1e-166   Flaveria trinervia
emb|CDX75316.1|  BnaA01g03860D                                          504   1e-166   
sp|P49362.1|GCSPB_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    504   1e-166   Flaveria pringlei
ref|XP_009125119.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    504   1e-166   Brassica rapa
sp|O49850.1|GCSP_FLAAN  RecName: Full=Glycine dehydrogenase (deca...    503   3e-166   Flaveria anomala
emb|CDX68930.1|  BnaC01g05230D                                          503   3e-166   
ref|XP_007136824.1|  hypothetical protein PHAVU_009G077400g             502   4e-166   Phaseolus vulgaris [French bean]
ref|XP_010432628.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    503   7e-166   Camelina sativa [gold-of-pleasure]
emb|CAA81076.1|  P protein                                              502   1e-165   Flaveria pringlei
sp|P49361.1|GCSPA_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    502   1e-165   Flaveria pringlei
ref|XP_009401914.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    501   2e-165   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    501   3e-165   Camelina sativa [gold-of-pleasure]
ref|XP_010417387.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    499   1e-164   Camelina sativa [gold-of-pleasure]
ref|XP_010429623.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    499   2e-164   Camelina sativa [gold-of-pleasure]
ref|XP_006283054.1|  hypothetical protein CARUB_v10004049mg             499   2e-164   Capsella rubella
ref|XP_010472637.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    498   4e-164   Camelina sativa [gold-of-pleasure]
ref|XP_006296473.1|  hypothetical protein CARUB_v10025658mg             491   1e-161   Capsella rubella
gb|KJB54688.1|  hypothetical protein B456_009G045100                    491   3e-161   Gossypium raimondii
gb|ACN39938.1|  unknown                                                 482   5e-161   Picea sitchensis
gb|KDO80089.1|  hypothetical protein CISIN_1g001531mg                   476   1e-155   Citrus sinensis [apfelsine]
ref|XP_001755004.1|  predicted protein                                  470   2e-154   
ref|XP_001754864.1|  predicted protein                                  471   5e-154   
ref|XP_001780310.1|  predicted protein                                  468   3e-153   
ref|XP_002979861.1|  hypothetical protein SELMODRAFT_153563             454   2e-148   
ref|XP_002988429.1|  hypothetical protein SELMODRAFT_159459             454   4e-148   
gb|AFW56071.1|  glycine cleavage complex P-protein                      438   1e-140   
ref|XP_001692993.1|  glycine cleavage system, P protein                 425   3e-136   Chlamydomonas reinhardtii
gb|EPS69441.1|  glycine dehydrogenase [decarboxylating], mitochon...    405   7e-134   Genlisea aurea
ref|XP_002956892.1|  hypothetical protein VOLCADRAFT_107448             417   1e-133   Volvox carteri f. nagariensis
ref|XP_008347531.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    386   8e-131   
ref|NP_001119106.1|  glycine dehydrogenase [decarboxylating] 2          409   9e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011398598.1|  Glycine dehydrogenase [decarboxylating], mit...    413   4e-130   Auxenochlorella protothecoides
ref|XP_003055654.1|  glycine cleavage system p-protein                  405   2e-128   Micromonas pusilla CCMP1545
gb|KDO80090.1|  hypothetical protein CISIN_1g001531mg                   403   1e-127   Citrus sinensis [apfelsine]
ref|WP_010472943.1|  glycine dehydrogenase                              400   3e-127   Acaryochloris sp. CCMEE 5410
ref|XP_002503477.1|  glycine cleavage system p-protein                  397   5e-126   Micromonas commoda
ref|WP_012166094.1|  glycine dehydrogenase                              396   1e-125   Acaryochloris marina
ref|WP_018342886.1|  glycine dehydrogenase                              395   3e-125   Cytophaga aurantiaca
ref|XP_001420206.1|  predicted protein                                  392   3e-124   Ostreococcus lucimarinus CCE9901
emb|CEF99477.1|  Pyridoxal phosphate-dependent transferase, major...    389   1e-122   Ostreococcus tauri
ref|WP_028981454.1|  glycine dehydrogenase                              387   3e-122   Sporocytophaga myxococcoides
ref|WP_011584413.1|  glycine dehydrogenase                              387   3e-122   Cytophaga hutchinsonii
ref|WP_027846740.1|  glycine dehydrogenase                              387   4e-122   Mastigocoleus testarum
ref|WP_016874717.1|  glycine dehydrogenase                              387   6e-122   Chlorogloeopsis fritschii
ref|WP_041036217.1|  glycine dehydrogenase                              386   1e-121   Tolypothrix campylonemoides
ref|WP_040765024.1|  glycine dehydrogenase                              366   2e-121   Rhodopirellula maiorica
gb|EMI20957.1|  glycine dehydrogenase                                   366   2e-121   Rhodopirellula maiorica SM1
ref|WP_045459859.1|  glycine dehydrogenase                              384   3e-121   Sporocytophaga myxococcoides
ref|WP_015209784.1|  glycine dehydrogenase, decarboxylating             384   5e-121   Cylindrospermum stagnale
ref|WP_022606719.1|  glycine dehydrogenase (decarboxylating)            384   6e-121   Rubidibacter lacunae
ref|WP_016861897.1|  glycine dehydrogenase                              383   8e-121   Fischerella muscicola
ref|WP_044197707.1|  glycine dehydrogenase                              383   8e-121   
ref|XP_010074869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   8e-121   Pterocles gutturalis
ref|WP_015182831.1|  glycine dehydrogenase, decarboxylating             384   8e-121   Microcoleus sp. PCC 7113
ref|WP_020531529.1|  glycine dehydrogenase                              383   9e-121   Flexithrix dorotheae
ref|WP_041226533.1|  glycine dehydrogenase                              383   9e-121   
ref|XP_009490955.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   1e-120   Pelecanus crispus
gb|AFZ12851.1|  Glycine dehydrogenase (decarboxylating)                 384   1e-120   Crinalium epipsammum PCC 9333
gb|AFY83915.1|  glycine dehydrogenase, decarboxylating                  383   2e-120   Oscillatoria acuminata PCC 6304
ref|WP_035999593.1|  glycine dehydrogenase                              383   2e-120   [Leptolyngbya] sp. JSC-1
ref|WP_008624248.1|  Glycine dehydrogenase                              382   3e-120   Mariniradius saccharolyticus
ref|XP_007510359.1|  glycine dehydrogenase                              383   4e-120   Bathycoccus prasinos
ref|WP_020402760.1|  glycine dehydrogenase                              381   4e-120   Gracilimonas tropica
ref|WP_015227846.1|  glycine dehydrogenase, decarboxylating             381   6e-120   Dactylococcopsis salina
ref|XP_005649750.1|  glycine dehydrogenase                              382   8e-120   Coccomyxa subellipsoidea C-169
ref|XP_009699383.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   8e-120   Cariama cristata
ref|XP_005702688.1|  glycine dehydrogenase                              376   8e-120   Galdieria sulphuraria
ref|WP_017712703.1|  glycine dehydrogenase                              380   8e-120   Prochlorothrix hollandica
ref|XP_008334138.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   9e-120   
ref|WP_009187084.1|  glycine dehydrogenase                              380   1e-119   Cecembia lonarensis
gb|KIJ83529.1|  glycine dehydrogenase                                   380   1e-119   Scytonema tolypothrichoides VB-61278
ref|WP_023065539.1|  glycine dehydrogenase                              380   1e-119   Lyngbya aestuarii
ref|WP_019596339.1|  glycine dehydrogenase                              380   2e-119   Rhodonellum
ref|WP_013939616.1|  glycine dehydrogenase                              380   2e-119   Myxococcus macrosporus
ref|WP_026736448.1|  glycine dehydrogenase                              380   2e-119   Fischerella sp. PCC 9605
ref|WP_007659102.1|  glycine dehydrogenase                              376   2e-119   
ref|XP_010129815.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   2e-119   Buceros rhinoceros silvestris
dbj|GAM17937.1|  hypothetical protein SAMD00019534_011120               380   3e-119   Acytostelium subglobosum LB1
ref|XP_009955956.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    361   3e-119   Leptosomus discolor
ref|WP_015349077.1|  glycine dehydrogenase                              379   4e-119   Myxococcus stipitatus
gb|EFA86802.1|  glycine dehydrogenase                                   380   4e-119   Heterostelium album PN500
ref|WP_044171749.1|  glycine dehydrogenase                              379   4e-119   
ref|WP_011553098.1|  glycine dehydrogenase                              379   4e-119   Myxococcus xanthus
ref|WP_019497275.1|  glycine dehydrogenase                              379   4e-119   Calothrix sp. PCC 7103
ref|WP_024285047.1|  glycine dehydrogenase                              379   4e-119   Algoriphagus marincola
dbj|BAD81531.1|  P protein-like                                         354   5e-119   Oryza sativa Japonica Group [Japonica rice]
ref|WP_018472039.1|  glycine dehydrogenase                              379   5e-119   Echinicola pacifica
ref|WP_008198699.1|  glycine dehydrogenase                              378   5e-119   Algoriphagus machipongonensis
ref|XP_007440133.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    376   6e-119   
ref|WP_026945428.1|  glycine dehydrogenase                              378   6e-119   Algoriphagus marincola
ref|WP_026951829.1|  glycine dehydrogenase                              378   6e-119   Algoriphagus mannitolivorans
ref|WP_015198875.1|  glycine dehydrogenase                              378   8e-119   Calothrix parietina
ref|WP_011614237.1|  glycine dehydrogenase                              378   1e-118   Trichodesmium erythraeum
ref|WP_017319421.1|  glycine dehydrogenase                              377   2e-118   
ref|WP_039128745.1|  glycine dehydrogenase                              377   2e-118   Flavihumibacter sp. ZG627
ref|WP_015212883.1|  Glycine dehydrogenase (decarboxylating)            377   2e-118   Anabaena cylindrica
gb|EPR71506.1|  Glycine dehydrogenase [decarboxylating] (glycine ...    374   3e-118   Cyclobacterium qasimii M12-11B
ref|WP_033335677.1|  glycine dehydrogenase                              377   3e-118   
ref|WP_015225454.1|  glycine dehydrogenase (decarboxylating) beta...    377   3e-118   Halothece sp. PCC 7418
ref|WP_015081132.1|  glycine dehydrogenase                              376   3e-118   Anabaena sp. 90
ref|WP_015264586.1|  glycine dehydrogenase, decarboxylating             376   4e-118   Echinicola vietnamensis
ref|XP_007902171.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    375   4e-118   Callorhinchus milii [Australian ghost shark]
ref|WP_009457628.1|  glycine dehydrogenase                              376   4e-118   Fischerella thermalis
ref|XP_009575710.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    361   4e-118   Fulmarus glacialis
ref|WP_016866657.1|  glycine dehydrogenase                              376   4e-118   Fischerella muscicola
ref|WP_016870901.1|  glycine dehydrogenase                              376   5e-118   Fischerella thermalis
ref|XP_003510272.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   5e-118   
gb|EMO24999.1|  glycine dehydrogenase-like protein                      363   5e-118   Leptospira interrogans serovar Bataviae str. HAI135
ref|WP_035401444.1|  glycine dehydrogenase                              376   6e-118   
ref|WP_039895601.1|  glycine dehydrogenase                              375   6e-118   
ref|XP_001507722.2|  PREDICTED: glycine dehydrogenase (decarboxyl...    369   7e-118   
ref|WP_026955360.1|  glycine dehydrogenase                              375   7e-118   Algoriphagus vanfongensis
ref|WP_043391215.1|  glycine dehydrogenase                              375   8e-118   Archangium violaceum
ref|WP_015130859.1|  glycine dehydrogenase                              375   9e-118   Calothrix sp. PCC 7507
ref|WP_012410110.1|  glycine dehydrogenase (decarboxylating)            375   1e-117   Nostoc punctiforme
ref|WP_017289075.1|  glycine dehydrogenase                              375   1e-117   Leptolyngbya boryana
ref|WP_009094772.1|  glycine dehydrogenase                              375   1e-117   Rhodopirellula sp. SWK7
ref|WP_008684764.1|  glycine dehydrogenase                              375   2e-117   Rhodopirellula sallentina
gb|EAW38056.1|  glycine dehydrogenase                                   375   2e-117   Lyngbya sp. PCC 8106
ref|WP_011319516.1|  glycine dehydrogenase (decarboxylating)            374   2e-117   Trichormus variabilis
ref|WP_015115551.1|  glycine dehydrogenase (decarboxylating) beta...    374   2e-117   Nostoc sp. PCC 7107
ref|WP_002639796.1|  glycine dehydrogenase                              374   2e-117   Myxococcus hansupus
ref|WP_002627258.1|  Glycine dehydrogenase [decarboxylating] (gly...    374   2e-117   Cystobacter fuscus
ref|XP_010204576.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   3e-117   Colius striatus
ref|WP_014397794.1|  glycine dehydrogenase                              374   3e-117   Corallococcus coralloides
ref|WP_028088591.1|  glycine dehydrogenase                              374   3e-117   Dolichospermum circinale
ref|WP_027255179.1|  glycine dehydrogenase                              373   4e-117   Planktothrix agardhii
gb|EOZ92310.1|  Glycine dehydrogenase [decarboxylating] (glycine ...    373   4e-117   Indibacter alkaliphilus LW1
ref|WP_039200768.1|  glycine dehydrogenase                              374   4e-117   Aphanizomenon flos-aquae
ref|WP_027401604.1|  glycine dehydrogenase                              374   4e-117   Aphanizomenon flos-aquae
ref|WP_037356834.1|  glycine dehydrogenase                              373   4e-117   Schleiferia thermophila
emb|CCI29698.1|  Glycine cleavage system P-protein (glycine dehyd...    356   5e-117   Microcystis aeruginosa PCC 9809
ref|WP_045056788.1|  glycine dehydrogenase                              373   5e-117   Aliterella atlantica
ref|XP_010723944.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    369   5e-117   
ref|WP_009032864.1|  glycine dehydrogenase                              373   5e-117   Indibacter alkaliphilus
ref|WP_006631620.1|  glycine dehydrogenase                              374   6e-117   Microcoleus vaginatus
ref|WP_027001579.1|  glycine dehydrogenase                              373   6e-117   Hugenholtzia roseola
ref|WP_033563801.1|  glycine dehydrogenase                              373   7e-117   Sphingobacteriaceae bacterium DW12
ref|XP_004072176.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    374   7e-117   Oryzias latipes [Japanese rice fish]
ref|WP_013193021.1|  glycine dehydrogenase                              373   7e-117   Trichormus azollae
ref|WP_038029267.1|  glycine dehydrogenase                              373   7e-117   Thermonema rossianum
ref|WP_026721410.1|  glycine dehydrogenase                              373   8e-117   Fischerella sp. PCC 9431
ref|XP_009816061.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    368   9e-117   Gavia stellata
ref|WP_044035200.1|  glycine dehydrogenase                              356   1e-116   
dbj|BAK62095.1|  glycine dehydrogenase [decarboxylating], mitocho...    356   1e-116   Pan troglodytes
gb|EYB23930.1|  hypothetical protein FG05_08352                         360   1e-116   Fusarium graminearum
ref|XP_002120534.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    373   1e-116   Ciona intestinalis [sea vase]
ref|WP_026796741.1|  glycine dehydrogenase                              372   2e-116   Planktothrix rubescens
ref|XP_007557910.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    374   2e-116   Poecilia formosa
ref|WP_043938103.1|  glycine dehydrogenase                              372   2e-116   
ref|XP_008416250.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    373   2e-116   Poecilia reticulata
ref|WP_027284971.1|  glycine dehydrogenase                              372   2e-116   Rubritepida flocculans
ref|WP_017320159.1|  glycine dehydrogenase                              372   2e-116   cyanobacterium PCC 7702
ref|XP_008944450.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    357   2e-116   Merops nubicus
ref|XP_008416249.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    374   2e-116   Poecilia reticulata
ref|XP_005716298.1|  glycine dehydrogenase (decarboxylating), mit...    373   2e-116   Chondrus crispus [carageen]
ref|WP_014560840.1|  glycine dehydrogenase                              371   2e-116   Ignavibacterium album
ref|WP_012627655.1|  glycine dehydrogenase                              372   2e-116   Cyanothece sp. PCC 7425
ref|WP_026966406.1|  glycine dehydrogenase                              371   3e-116   Algoriphagus terrigena
ref|WP_006972317.1|  glycine dehydrogenase                              372   3e-116   Plesiocystis pacifica
ref|WP_028083847.1|  glycine dehydrogenase                              371   3e-116   Dolichospermum circinale
ref|WP_009579218.1|  Glycine dehydrogenase                              371   3e-116   Fulvivirga imtechensis
ref|WP_026795376.1|  MULTISPECIES: glycine dehydrogenase                371   3e-116   Planktothrix
ref|WP_042157536.1|  glycine dehydrogenase                              371   4e-116   
ref|WP_029637128.1|  glycine dehydrogenase [                            371   4e-116   
ref|WP_045872920.1|  glycine dehydrogenase                              371   4e-116   Nostocales
gb|AHG90222.1|  Glycine dehydrogenase [decarboxylating]                 371   4e-116   Gemmatirosa kalamazoonesis
gb|KIE11464.1|  glycine dehydrogenase                                   371   5e-116   Tolypothrix bouteillei VB521301
ref|WP_035075932.1|  glycine dehydrogenase                              370   5e-116   Anditalea andensis
ref|WP_015175278.1|  Glycine dehydrogenase (decarboxylating)            371   6e-116   Oscillatoria nigro-viridis
ref|XP_005425639.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    368   6e-116   Geospiza fortis
ref|XP_006371884.1|  hypothetical protein POPTR_0018s05150g             366   6e-116   
ref|WP_011140250.1|  glycine dehydrogenase                              371   6e-116   Gloeobacter violaceus
ref|XP_006627116.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    372   6e-116   Lepisosteus oculatus
ref|XP_005425638.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    368   7e-116   Geospiza fortis
sp|Q8YNF9.1|GCSP_NOSS1  RecName: Full=Glycine dehydrogenase (deca...    370   7e-116   Nostoc sp. PCC 7120
ref|XP_005801071.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    372   8e-116   
ref|XP_005388808.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    370   8e-116   
ref|WP_018127909.1|  glycine dehydrogenase                              370   8e-116   Balneola vulgaris
ref|XP_637330.1|  glycine dehydrogenase                                 370   8e-116   Dictyostelium discoideum AX4
ref|WP_044523300.1|  glycine dehydrogenase                              370   9e-116   
ref|XP_005015417.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    368   1e-115   
ref|WP_012789622.1|  glycine dehydrogenase                              369   1e-115   Chitinophaga pinensis
ref|XP_004631791.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    370   1e-115   
ref|WP_035563762.1|  glycine dehydrogenase                              370   1e-115   Hymenobacter sp. IS2118
ref|XP_003762187.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    371   1e-115   Sarcophilus harrisii
ref|WP_002998394.1|  glycine dehydrogenase                              369   1e-115   
ref|XP_007533686.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    370   1e-115   
ref|WP_027250002.1|  glycine dehydrogenase                              369   1e-115   
ref|XP_006104082.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    369   1e-115   
ref|WP_016546738.1|  glycine dehydrogenase                              369   2e-115   
ref|WP_037497640.1|  glycine dehydrogenase                              369   2e-115   
ref|WP_003009531.1|  glycine dehydrogenase                              369   2e-115   
ref|WP_036795682.1|  glycine dehydrogenase                              369   2e-115   
ref|XP_009901190.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    368   2e-115   
ref|XP_010608993.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    369   2e-115   
ref|XP_010192403.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    354   2e-115   
ref|WP_026103942.1|  glycine dehydrogenase                              369   2e-115   
ref|XP_009502061.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   2e-115   
ref|WP_015171139.1|  glycine dehydrogenase subunit alpha/beta           369   3e-115   
ref|XP_011592988.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   3e-115   
ref|WP_019487125.1|  glycine dehydrogenase                              369   3e-115   
ref|XP_009636514.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   3e-115   
ref|XP_009077461.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    365   3e-115   
ref|XP_009272544.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   3e-115   
ref|XP_001371735.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    370   3e-115   
ref|XP_009888966.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   3e-115   
gb|AFZ32122.1|  Glycine dehydrogenase (decarboxylating)                 369   3e-115   
ref|WP_041919296.1|  glycine dehydrogenase                              369   3e-115   
ref|XP_005352188.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    370   3e-115   
ref|XP_010286980.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   3e-115   
emb|CCX08297.1|  Similar to Putative glycine dehydrogenase [decar...    370   3e-115   
ref|WP_020769690.1|  glycine dehydrogenase                              368   3e-115   
ref|XP_005443682.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    367   3e-115   
ref|XP_009924265.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   3e-115   
ref|XP_008494472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   4e-115   
ref|XP_008539868.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    359   4e-115   
ref|WP_016550019.1|  glycine dehydrogenase                              368   4e-115   
ref|XP_005443683.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   4e-115   
ref|XP_010286979.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   4e-115   
ref|XP_009569917.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   4e-115   
ref|WP_027000783.1|  glycine dehydrogenase                              368   4e-115   
ref|XP_010997554.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    356   4e-115   
ref|XP_006774904.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   4e-115   
ref|XP_009934335.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   4e-115   
ref|XP_006018433.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    368   5e-115   
ref|WP_039745501.1|  glycine dehydrogenase                              368   5e-115   
ref|XP_005241663.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   5e-115   
ref|WP_018618564.1|  glycine dehydrogenase                              368   5e-115   
ref|XP_003216615.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    369   5e-115   
ref|XP_005241664.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   6e-115   
ref|XP_010118639.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   6e-115   
ref|XP_011685818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    369   6e-115   
ref|XP_009473192.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   7e-115   
ref|XP_004457438.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    369   7e-115   
ref|WP_010572852.1|  glycine dehydrogenase                              367   7e-115   
ref|XP_005060945.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    367   8e-115   
ref|WP_010571257.1|  glycine dehydrogenase                              367   8e-115   
ref|WP_028071069.1|  glycine dehydrogenase                              367   9e-115   
ref|XP_009869925.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   9e-115   
ref|XP_006117910.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   9e-115   
gb|KFV58433.1|  hypothetical protein N328_02758                         363   1e-114   
gb|EON77815.1|  Glycine dehydrogenase [decarboxylating] (glycine ...    366   1e-114   
ref|XP_009869926.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   1e-114   
gb|EHL03483.1|  putative glycine dehydrogenase                          362   1e-114   
ref|XP_009326324.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   1e-114   
ref|XP_009097244.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   1e-114   
ref|XP_007626103.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   1e-114   
ref|WP_017652835.1|  glycine dehydrogenase                              367   1e-114   
ref|WP_039142781.1|  glycine dehydrogenase                              367   1e-114   
ref|WP_009631450.1|  glycine dehydrogenase, decarboxylating             367   1e-114   
ref|XP_009097243.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   1e-114   
ref|XP_006002770.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    365   1e-114   
gb|KFP33507.1|  hypothetical protein N325_07613                         359   1e-114   
ref|WP_039713483.1|  glycine dehydrogenase                              367   1e-114   
ref|XP_010729182.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    368   1e-114   
ref|XP_011980464.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   1e-114   
ref|XP_010157866.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   2e-114   
gb|KFP90011.1|  hypothetical protein N311_05525                         365   2e-114   
ref|WP_019989155.1|  glycine dehydrogenase                              366   2e-114   
ref|WP_009149788.1|  glycine dehydrogenase                              367   2e-114   
ref|WP_017731289.1|  glycine dehydrogenase                              366   2e-114   
ref|WP_015119530.1|  glycine dehydrogenase, decarboxylating             366   2e-114   
gb|AAD56281.1|AF137264_1  glycine decarboxylase p protein               367   2e-114   
ref|WP_008590214.1|  glycine dehydrogenase                              366   2e-114   
ref|XP_006268968.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    367   2e-114   
ref|WP_035805169.1|  glycine dehydrogenase                              366   2e-114   
ref|XP_003975164.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    368   2e-114   
ref|XP_010391188.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    364   2e-114   
ref|XP_007186065.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   2e-114   
gb|KIW81229.1|  glycine dehydrogenase                                   368   3e-114   
ref|XP_007253924.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   3e-114   
ref|XP_007944510.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   3e-114   
ref|XP_007062689.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   3e-114   
ref|XP_005063268.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   3e-114   
ref|XP_008143227.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   3e-114   
ref|XP_004838324.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    363   3e-114   
ref|WP_004503349.1|  glycine dehydrogenase                              365   4e-114   
ref|WP_004497226.1|  glycine dehydrogenase                              365   4e-114   
ref|WP_045754231.1|  glycine dehydrogenase                              365   4e-114   
ref|XP_010584356.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   4e-114   
ref|WP_020604050.1|  glycine dehydrogenase                              365   4e-114   
ref|WP_004501078.1|  glycine dehydrogenase                              365   4e-114   
ref|WP_004499426.1|  glycine dehydrogenase                              365   4e-114   
ref|WP_002616019.1|  glycine dehydrogenase                              365   4e-114   
ref|XP_011235361.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    364   4e-114   
ref|XP_008292370.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   4e-114   
ref|WP_020782916.1|  glycine dehydrogenase                              365   4e-114   
ref|WP_010415806.1|  glycine dehydrogenase                              365   4e-114   
ref|WP_004439320.1|  glycine dehydrogenase                              365   4e-114   
ref|XP_004778754.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    367   4e-114   
ref|XP_009998946.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   4e-114   
ref|XP_006975889.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   5e-114   
ref|XP_004279169.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    367   5e-114   
ref|WP_017304511.1|  glycine dehydrogenase                              366   5e-114   
ref|WP_015145532.1|  glycine dehydrogenase, decarboxylating             366   5e-114   
ref|WP_041431238.1|  glycine dehydrogenase                              365   5e-114   
ref|XP_005522738.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   5e-114   
ref|XP_005683813.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    365   5e-114   
emb|CCH65953.1|  Glycine dehydrogenase [decarboxylating] (glycine...    364   5e-114   
ref|WP_017309685.1|  glycine dehydrogenase                              365   6e-114   
gb|AFY60495.1|  glycine dehydrogenase, decarboxylating                  365   6e-114   
ref|XP_007451519.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   6e-114   
ref|XP_007746608.1|  glycine dehydrogenase                              367   6e-114   
ref|XP_008688103.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   6e-114   
ref|XP_005522737.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   7e-114   
gb|EFZ21248.1|  hypothetical protein SINV_03018                         364   7e-114   
ref|WP_017213857.1|  glycine dehydrogenase                              365   7e-114   
ref|WP_044260453.1|  glycine dehydrogenase                              365   7e-114   
ref|WP_002179931.1|  glycine dehydrogenase                              365   8e-114   
emb|CCH66233.1|  Glycine dehydrogenase [decarboxylating] (glycine...    365   8e-114   
ref|XP_007783132.1|  glycine dehydrogenase                              367   8e-114   
ref|WP_044304265.1|  glycine dehydrogenase                              365   8e-114   
ref|XP_005948263.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   8e-114   
ref|WP_001089334.1|  glycine dehydrogenase                              365   8e-114   
ref|XP_010769689.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    366   9e-114   
ref|XP_003455338.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   9e-114   
ref|WP_040944225.1|  glycine dehydrogenase                              365   9e-114   
ref|WP_026850038.1|  glycine dehydrogenase                              365   1e-113   
ref|XP_005499825.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    363   1e-113   
ref|XP_008919878.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   1e-113   
ref|XP_002842372.1|  hypothetical protein                               363   1e-113   
ref|XP_006863825.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   1e-113   
ref|XP_538655.2|  PREDICTED: glycine dehydrogenase [decarboxylati...    365   1e-113   
ref|WP_031528933.1|  glycine dehydrogenase                              364   1e-113   
ref|WP_042480369.1|  glycine dehydrogenase                              364   1e-113   
ref|XP_009965224.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    362   1e-113   
ref|XP_007098640.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    364   1e-113   
ref|XP_006208229.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   1e-113   
ref|XP_004373601.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    365   1e-113   
gb|KEF58987.1|  glycine dehydrogenase                                   367   1e-113   
ref|WP_003001920.1|  glycine dehydrogenase                              364   1e-113   
ref|NP_989653.1|  glycine dehydrogenase (decarboxylating), mitoch...    365   1e-113   
ref|XP_004359501.1|  glycine dehydrogenase                              365   1e-113   
ref|WP_042202353.1|  glycine dehydrogenase                              364   1e-113   
gb|AFD09436.1|  glycine dehydrogenase, decarboxylating                  364   1e-113   
ref|WP_007465486.1|  Glycine dehydrogenase                              364   1e-113   
ref|XP_005906969.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    365   1e-113   
ref|NP_001179880.1|  glycine dehydrogenase (decarboxylating), mit...    365   1e-113   
ref|XP_003782936.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    365   2e-113   
ref|XP_005973395.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    366   2e-113   
ref|XP_004838323.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    362   2e-113   
ref|XP_010806128.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   2e-113   
gb|EAW44901.1|  glycine dehydrogenase                                   365   2e-113   
ref|XP_005155052.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    363   2e-113   
ref|WP_044171929.1|  glycine dehydrogenase                              364   2e-113   
ref|WP_001089354.1|  glycine dehydrogenase (decarboxylating)            364   2e-113   
ref|WP_011057442.1|  glycine dehydrogenase (decarboxylating)            363   2e-113   
ref|XP_004004421.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   2e-113   
ref|WP_001089342.1|  glycine dehydrogenase (decarboxylating)            363   2e-113   
ref|XP_011175829.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    364   2e-113   
ref|XP_499922.1|  YALI0A09856p                                          364   2e-113   
ref|WP_001089336.1|  glycine dehydrogenase (decarboxylating)            363   2e-113   
ref|NP_613061.1|  glycine dehydrogenase (decarboxylating), mitoch...    365   2e-113   
ref|NP_001080141.1|  glycine dehydrogenase (decarboxylating)            365   2e-113   
ref|XP_010855278.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   2e-113   
gb|EFN88530.1|  Glycine dehydrogenase [decarboxylating], mitochon...    363   2e-113   
ref|WP_017008390.1|  glycine dehydrogenase                              363   2e-113   
gb|AFY75171.1|  glycine dehydrogenase, decarboxylating                  363   2e-113   
ref|XP_006790096.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    365   2e-113   
ref|WP_004419733.1|  glycine dehydrogenase                              363   2e-113   
ref|WP_004447455.1|  glycine dehydrogenase                              363   2e-113   
gb|KFP09381.1|  hypothetical protein Z169_05511                         362   2e-113   
ref|WP_041430269.1|  glycine dehydrogenase                              363   3e-113   
ref|XP_010958952.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   3e-113   
ref|XP_008539869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    353   3e-113   
gb|KIY00715.1|  hypothetical protein Z520_03380                         365   3e-113   
ref|WP_002538646.1|  Glycine dehydrogenase                              363   3e-113   
ref|WP_004452658.1|  glycine dehydrogenase                              363   3e-113   
ref|WP_015813524.1|  glycine dehydrogenase                              363   3e-113   
ref|WP_000663146.1|  glycine dehydrogenase                              362   3e-113   
ref|XP_012019714.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    364   3e-113   
gb|KGL97802.1|  hypothetical protein N301_04284                         362   3e-113   
ref|XP_002934225.2|  PREDICTED: glycine dehydrogenase [decarboxyl...    364   3e-113   
ref|XP_003390802.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    353   3e-113   
ref|WP_036093294.1|  glycine dehydrogenase                              363   3e-113   
ref|WP_017858293.1|  glycine dehydrogenase                              363   3e-113   
ref|WP_004451582.1|  glycine dehydrogenase                              363   3e-113   
ref|XP_009667360.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    361   3e-113   
ref|WP_022960455.1|  glycine dehydrogenase                              363   3e-113   
ref|XP_004600398.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    363   3e-113   
ref|XP_004653057.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    364   3e-113   
gb|KIW32718.1|  glycine dehydrogenase                                   365   3e-113   
ref|XP_008577050.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    362   3e-113   
gb|EDL41701.1|  glycine decarboxylase, isoform CRA_d                    365   3e-113   
ref|XP_006076510.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    364   3e-113   
ref|XP_004436867.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    364   3e-113   
gb|EMF81634.1|  glycine dehydrogenase                                   363   4e-113   
ref|XP_006176824.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    363   4e-113   
ref|XP_010017772.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    360   4e-113   
ref|WP_019941473.1|  glycine dehydrogenase                              363   4e-113   
ref|XP_011153697.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   4e-113   
ref|WP_010323338.1|  glycine dehydrogenase                              363   4e-113   
ref|WP_039465918.1|  glycine dehydrogenase                              363   4e-113   
ref|XP_010017773.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    360   4e-113   
gb|KIV89534.1|  glycine dehydrogenase                                   365   4e-113   
gb|KFO71692.1|  hypothetical protein N303_09668                         362   4e-113   
ref|XP_011068230.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   4e-113   
ref|XP_002194693.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    363   5e-113   
ref|WP_039743276.1|  glycine dehydrogenase                              364   5e-113   
ref|WP_001089352.1|  glycine dehydrogenase                              363   5e-113   
ref|WP_009285454.1|  glycine dehydrogenase                              363   5e-113   
ref|WP_001089359.1|  glycine dehydrogenase                              363   5e-113   
ref|WP_001089338.1|  glycine dehydrogenase (decarboxylating)            363   5e-113   
ref|WP_002121772.1|  glycine dehydrogenase                              363   5e-113   
gb|EMG23993.1|  glycine dehydrogenase                                   363   5e-113   
ref|WP_044206069.1|  glycine dehydrogenase                              363   5e-113   



>ref|XP_009620998.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana tomentosiformis]
Length=1043

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/292 (94%), Positives = 281/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  752   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  811

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPSPDKSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  812   TGGIPSPDKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  871

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  872   EKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  931

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNVLK APHPPS+LMADAW KPY
Sbjct  932   IEPTESESKAELDRFCDALISIREEIAQIEKGNADINNNVLKGAPHPPSMLMADAWVKPY  991

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTLLPVSQMVE+EAAA+A
Sbjct  992   SREYAAFPAPWLRNAKFWPTTARVDNVYGDRNLICTLLPVSQMVEEEAAANA  1043



>gb|KJB65560.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=1047

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/292 (94%), Positives = 283/292 (97%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  756   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KS PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  816   TGGIPAPEKSDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  876   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIA+IE GK DI+NNVLK APHPPSLLMADAWTKPY
Sbjct  936   IEPTESESKAELDRFCDTLISIREEIAEIENGKADIHNNVLKGAPHPPSLLMADAWTKPY  995

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLLPVSQMVE+ AAA+A
Sbjct  996   SREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLLPVSQMVEEAAAANA  1047



>gb|KHG00684.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1047

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/292 (94%), Positives = 283/292 (97%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  756   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KS PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  816   TGGIPAPEKSDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  876   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIA+IE GK DI+NNVLK APHPPSLLMADAWTKPY
Sbjct  936   IEPTESESKAELDRFCDTLISIREEIAEIENGKADIHNNVLKGAPHPPSLLMADAWTKPY  995

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLLPVSQMVE+ AAA+A
Sbjct  996   SREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLLPVSQMVEEAAAANA  1047



>ref|XP_009797115.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana sylvestris]
Length=1046

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/292 (93%), Positives = 281/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  755   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  814

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPSPDKS+PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  815   TGGIPSPDKSEPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  874

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGT AHEFIIDLRGFK+TAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  875   EKHYPVLFRGVNGTCAHEFIIDLRGFKSTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  934

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNVLK APHPPS+LMADAW KPY
Sbjct  935   IEPTESESKAELDRFCDALISIREEIAQIEKGNADINNNVLKGAPHPPSMLMADAWVKPY  994

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTLLPVSQMVE+EAAA+A
Sbjct  995   SREYAAFPAPWLRNAKFWPTTARVDNVYGDRNLICTLLPVSQMVEEEAAANA  1046



>gb|KJB54687.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1050

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/292 (93%), Positives = 281/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  759   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  818

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDKS PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  819   TGGIPAPDKSHPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  878

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  879   ENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  938

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  939   IEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDAWTKPY  998

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             +REYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE+EAAA+A
Sbjct  999   TREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEEEAAANA  1050



>sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Solanum 
tuberosum]
 emb|CAB16918.1| P-Protein precursor [Solanum tuberosum]
Length=1035

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/291 (92%), Positives = 282/291 (97%), Gaps = 0/291 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVVP
Sbjct  745   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVP  804

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPSPDKS+PLGAISAAPWGSALILPISYTYIAMMGS+GLTDASKIAIL+ANYMAKRL
Sbjct  805   TGGIPSPDKSEPLGAISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILSANYMAKRL  864

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  865   EKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  924

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNVLK APHPPS+LMADAWTKPY
Sbjct  925   IEPTESESKAELDRFCDALISIREEIAQIEKGNVDINNNVLKGAPHPPSMLMADAWTKPY  984

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLLPVS+M E++AA +
Sbjct  985   SREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLLPVSEMAEEKAATA  1035



>ref|XP_007012280.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
 gb|EOY29899.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
Length=1050

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/292 (92%), Positives = 280/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  759   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  818

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDKS PLG ISAAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  819   TGGIPAPDKSSPLGTISAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  878

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFI+DLR FKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  879   ENHYPVLFRGVNGTVAHEFIVDLRAFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  938

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  939   IEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDAWTKPY  998

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLLPV+QMVE+EAAA+A
Sbjct  999   SREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLLPVTQMVEEEAAANA  1050



>gb|KHG06307.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1028

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/292 (92%), Positives = 279/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  737   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  796

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+ DKS PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  797   TGGIPATDKSHPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  856

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  857   ENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  916

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  917   IEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDAWTKPY  976

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             +REYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE+EAAA+A
Sbjct  977   TREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEEEAAANA  1028



>ref|XP_011081684.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1037

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/283 (95%), Positives = 276/283 (98%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  746   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  805

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD+SQPLG ISAAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  806   TGGIPAPDQSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  865

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  866   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  925

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIA IEKGK DI+NNVLK APHPPSLLMAD WTKPY
Sbjct  926   IEPTESESKAELDRFCDTLISIREEIALIEKGKADIHNNVLKGAPHPPSLLMADVWTKPY  985

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM
Sbjct  986   SREYAAYPAAWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  1028



>ref|XP_010262151.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nelumbo nucifera]
Length=1043

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/292 (92%), Positives = 280/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  752   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  811

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDKSQPLG ISAAPWGSALILPISYTYIAMMGS GLT+ASKIAILNANYMAKRL
Sbjct  812   TGGIPAPDKSQPLGTISAAPWGSALILPISYTYIAMMGSGGLTEASKIAILNANYMAKRL  871

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  872   ENHYPILFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  931

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA IE GK DINNNVLK APHPPSLLMADAWTKPY
Sbjct  932   IEPTESESKAELDRFCDALISIRQEIALIENGKADINNNVLKGAPHPPSLLMADAWTKPY  991

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLP SQ+VE++AAA+A
Sbjct  992   SREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLLPASQVVEEQAAATA  1043



>ref|XP_004245101.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Solanum lycopersicum]
Length=1036

 Score =   540 bits (1391),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 267/291 (92%), Positives = 281/291 (97%), Gaps = 0/291 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVV 
Sbjct  746   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVS  805

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPSPD+S+PLGAISAAPWGSALILPISYTYIAMMGS+GLTDASKIAIL+ANYMAKRL
Sbjct  806   TGGIPSPDQSKPLGAISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILSANYMAKRL  865

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  866   EKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  925

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNVLK APHPPS+LMADAWTKPY
Sbjct  926   IEPTESESKAELDRFCDALISIREEIAQIEKGNVDINNNVLKGAPHPPSMLMADAWTKPY  985

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLLPVS+M E++AA +
Sbjct  986   SREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLLPVSEMAEEKAATA  1036



>ref|XP_006361002.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Solanum tuberosum]
Length=1092

 Score =   541 bits (1394),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 267/287 (93%), Positives = 279/287 (97%), Gaps = 0/287 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVVP
Sbjct  745   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVP  804

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPSPDKS+PLGAISAAPWGSALILPISYTYIAMMGS+GLTDASKIAIL+ANYMAKRL
Sbjct  805   TGGIPSPDKSEPLGAISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILSANYMAKRL  864

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  865   EKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  924

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNVLK APHPPS+LMADAWTKPY
Sbjct  925   IEPTESESKAELDRFCDALISIREEIAQIEKGNVDINNNVLKGAPHPPSMLMADAWTKPY  984

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             SREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLLPVS+M E++
Sbjct  985   SREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLLPVSEMAEEK  1031



>ref|XP_003544533.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1059

 Score =   540 bits (1390),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 268/292 (92%), Positives = 280/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  768   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIE  827

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK QPLG I+AAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  828   TGGIPAPDKPQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  887

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  888   ENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  947

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKGK DINNNVLK APHPPSLLMADAWTKPY
Sbjct  948   IEPTESESKAELDRFCDALISIRQEIAEIEKGKVDINNNVLKGAPHPPSLLMADAWTKPY  1007

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLP SQ VE++AAA+A
Sbjct  1008  SREYAAFPAPWLRTAKFWPTTGRVDNVYGDRNLICTLLPASQAVEEQAAATA  1059



>emb|CBI20667.3| unnamed protein product [Vitis vinifera]
Length=695

 Score =   528 bits (1360),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 264/292 (90%), Positives = 278/292 (95%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  405   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  464

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK QPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  465   TGGIPAPDKLQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  524

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRGFKNTAGIE ED+AKRLMDYGFHGPTMSWPVPGTLM
Sbjct  525   EKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIAKRLMDYGFHGPTMSWPVPGTLM  584

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIAQIE GK D++NNVLK APHPPSLLM D WTKPY
Sbjct  585   IEPTESESKAELDRFCDALISIRKEIAQIENGKADVHNNVLKGAPHPPSLLMGDTWTKPY  644

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ +E++AAA+A
Sbjct  645   SREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLLPASQ-IEEQAAATA  695



>ref|XP_011097886.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1071

 Score =   540 bits (1391),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 269/285 (94%), Positives = 277/285 (97%), Gaps = 0/285 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  748   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD+SQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  808   TGGIPAPDQSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  868   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDR+CD LISIREEIA IEKGK DI+NNVLK+APHPPSLLMAD W+KPY
Sbjct  928   IEPTESESKAELDRYCDALISIREEIAMIEKGKADIHNNVLKSAPHPPSLLMADVWSKPY  987

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM E
Sbjct  988   SREYAAYPAPWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMAE  1032



>emb|CDP08258.1| unnamed protein product [Coffea canephora]
Length=1031

 Score =   537 bits (1384),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 265/292 (91%), Positives = 283/292 (97%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  740   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  799

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P KSQPLG+ISAAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  800   TGGIPAPGKSQPLGSISAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  859

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFIIDLRGFK+TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  860   ENYYPVLFRGVNGTVAHEFIIDLRGFKHTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  919

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFCD LISIREEIAQIEKGKFD++NNVLK+APHPPSLLMA+ WTKPY
Sbjct  920   VEPTESESKAELDRFCDALISIREEIAQIEKGKFDLHNNVLKSAPHPPSLLMANVWTKPY  979

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+TAKFWPTT RVDNVYGDRNL+CTLLP +Q+VE+E AA+A
Sbjct  980   SREYAAFPAPWLRTAKFWPTTERVDNVYGDRNLVCTLLPAAQVVEEEKAATA  1031



>ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis]
 gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis]
Length=1057

 Score =   536 bits (1380),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 266/292 (91%), Positives = 276/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  766   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIS  825

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD +QPLG ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  826   TGGIPAPDNAQPLGTISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  885

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  886   ENYYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  945

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D++NNVLK APHPPSLLM DAWTKPY
Sbjct  946   IEPTESESKAELDRFCDALISIREEIAEIENGKADVHNNVLKGAPHPPSLLMGDAWTKPY  1005

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ VE++AAASA
Sbjct  1006  SREYAAFPASWLRGAKFWPTTGRVDNVYGDRNLICTLLPASQYVEEQAAASA  1057



>ref|XP_010047334.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Eucalyptus grandis]
 gb|KCW79221.1| hypothetical protein EUGRSUZ_C00646 [Eucalyptus grandis]
Length=1053

 Score =   535 bits (1379),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 282/292 (97%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  762   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVA  821

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG+P+P+KSQPLG ISAAPWGSALILPISY+YIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  822   TGGLPAPEKSQPLGTISAAPWGSALILPISYSYIAMMGSKGLTEASKIAILNANYMAKRL  881

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLR FKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  882   ENYYPILFRGVNGTVAHEFIVDLRAFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  941

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIAQIEKGK DI+NNVLK+APHPPSLLM D+WTKPY
Sbjct  942   IEPTESESKAELDRFCDTLISIREEIAQIEKGKADIHNNVLKSAPHPPSLLMGDSWTKPY  1001

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+TAKFWP+TGR+DNVYGDRNL+CTL P SQ+VE++AAA+A
Sbjct  1002  SREYAAFPASWLRTAKFWPSTGRIDNVYGDRNLVCTLQPTSQVVEEQAAATA  1053



>ref|XP_008220472.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Prunus mume]
Length=1054

 Score =   535 bits (1378),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 264/292 (90%), Positives = 280/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  763   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  822

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG+P+PDKSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  823   TGGLPAPDKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  882

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFK+TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  883   EDYYPILFRGVNGTVAHEFIVDLRGFKHTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  942

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IEKGK D++NNVLK APHPPSLLM D WTKPY
Sbjct  943   IEPTESESKAELDRFCDALISIREEIAEIEKGKADLHNNVLKGAPHPPSLLMGDTWTKPY  1002

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWPTTGRVDNVYGDRNLICTL P SQ VE++AAA+A
Sbjct  1003  SREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLICTLQPASQAVEEQAAATA  1054



>ref|XP_004498895.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004498896.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=1114

 Score =   536 bits (1382),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 267/292 (91%), Positives = 280/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  823   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  882

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+K QPLG+ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  883   TGGIPAPEKYQPLGSISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  942

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  943   ENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  1002

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA++EKG  DI+NNVLK APHPPSLLMADAWTKPY
Sbjct  1003  IEPTESESKAELDRFCDALISIRKEIAEVEKGNADIHNNVLKGAPHPPSLLMADAWTKPY  1062

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL P SQ VE++AAA+A
Sbjct  1063  SREYAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTLQPASQGVEEQAAATA  1114



>ref|XP_012077290.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Jatropha curcas]
 gb|KDP34101.1| hypothetical protein JCGZ_07672 [Jatropha curcas]
Length=1059

 Score =   535 bits (1378),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 263/292 (90%), Positives = 278/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  768   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  827

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+K+QPLG ISAAPWGSALILPISYTYIAMMGSQGLT+ASKIAILNANYMAKRL
Sbjct  828   TGGIPAPEKTQPLGTISAAPWGSALILPISYTYIAMMGSQGLTEASKIAILNANYMAKRL  887

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  888   ENYYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  947

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  DINNNVLK APHPPSLLM D WTKPY
Sbjct  948   IEPTESESKAELDRFCDALISIRQEIAEIEKGNADINNNVLKGAPHPPSLLMGDTWTKPY  1007

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             +REYAAFPA WL+T+KFWPTTGRVDNVYGDRNLICTLLP SQ VE++AAA+A
Sbjct  1008  TREYAAFPASWLRTSKFWPTTGRVDNVYGDRNLICTLLPASQYVEEQAAATA  1059



>ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
 gb|KHN37032.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1056

 Score =   534 bits (1376),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 265/292 (91%), Positives = 279/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  765   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIA  824

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK QPLG I+AAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  825   TGGIPAPDKPQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  884

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  885   ENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  944

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  DINNNVLK+APHPPSLLMADAWTKPY
Sbjct  945   IEPTESESKAELDRFCDALISIRQEIAEIEKGNADINNNVLKSAPHPPSLLMADAWTKPY  1004

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQ VE++AAA+A
Sbjct  1005  SREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLPASQAVEEQAAATA  1056



>ref|XP_011019466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Populus euphratica]
Length=1060

 Score =   533 bits (1374),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 263/292 (90%), Positives = 279/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVVP
Sbjct  769   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVP  828

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD+SQPLG ISAAPWGSALILPISYTY+AMMGS+GLTDASKIAILNANYMAKRL
Sbjct  829   TGGIPAPDQSQPLGTISAAPWGSALILPISYTYVAMMGSKGLTDASKIAILNANYMAKRL  888

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  889   ENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  948

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IEKGK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  949   IEPTESESKAELDRFCDALISIREEIAEIEKGKADIHNNVLKGAPHPPSLLMGDAWTKPY  1008

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ+VE++AAA+A
Sbjct  1009  SREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQVVEEQAAATA  1060



>gb|ABO61734.1| mitochondrial glycine decarboxylase complex P-protein [Populus 
tremuloides]
Length=1060

 Score =   533 bits (1373),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 264/292 (90%), Positives = 278/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVV 
Sbjct  769   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVS  828

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD+SQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  829   TGGIPAPDQSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  888

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  889   ENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  948

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIA+IEKGK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  949   IEPTESESKAELDRFCDTLISIREEIAEIEKGKADIHNNVLKGAPHPPSLLMGDAWTKPY  1008

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ VE++AAA+A
Sbjct  1009  SREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQTVEEQAAATA  1060



>ref|XP_002308562.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
 gb|EEE92085.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
Length=1060

 Score =   533 bits (1372),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 263/292 (90%), Positives = 279/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGV+KHLAP+LPSHPVVP
Sbjct  769   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVQKHLAPYLPSHPVVP  828

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD+SQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  829   TGGIPAPDQSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  888

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  889   ENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  948

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IEKGK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  949   IEPTESESKAELDRFCDALISIREEIAEIEKGKADIHNNVLKGAPHPPSLLMGDAWTKPY  1008

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ+VE++AAA+A
Sbjct  1009  SREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQVVEEQAAATA  1060



>ref|XP_010519851.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=1054

 Score =   533 bits (1372),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 263/292 (90%), Positives = 279/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  763   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  822

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KS+PLG+I+AAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYM KRL
Sbjct  823   TGGIPAPEKSEPLGSIAAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMVKRL  882

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKH+PVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  883   EKHFPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  942

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIAQIEKG  DI+NNVLK APHPPSLLM D+W+KPY
Sbjct  943   IEPTESESKAELDRFCDTLISIREEIAQIEKGNADIHNNVLKGAPHPPSLLMGDSWSKPY  1002

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTL P +Q  E++AAA+A
Sbjct  1003  SREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLQPAAQNGEEQAAATA  1054



>sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Pisum 
sativum]
 emb|CAA42443.1| P protein [Pisum sativum]
Length=1057

 Score =   532 bits (1370),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 264/292 (90%), Positives = 279/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  766   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  825

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+  QPLG+ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  826   TGGIPAPENPQPLGSISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  885

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPV GTLM
Sbjct  886   ESYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVAGTLM  945

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA++EKG  D++NNVLK APHPPSLLMADAWTKPY
Sbjct  946   IEPTESESKAELDRFCDALISIRKEIAEVEKGNADVHNNVLKGAPHPPSLLMADAWTKPY  1005

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNL+CTLLP SQ VE++AAA+A
Sbjct  1006  SREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLVCTLLPASQAVEEQAAATA  1057



>emb|CAN63089.1| hypothetical protein VITISV_032016 [Vitis vinifera]
Length=1036

 Score =   531 bits (1367),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 264/292 (90%), Positives = 278/292 (95%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  746   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  805

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK QPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  806   TGGIPAPDKLQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  865

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRGFKNTAGIE ED+AKRLMDYGFHGPTMSWPVPGTLM
Sbjct  866   EKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIAKRLMDYGFHGPTMSWPVPGTLM  925

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIAQIE GK D++NNVLK APHPPSLLM D WTKPY
Sbjct  926   IEPTESESKAELDRFCDALISIRKEIAQIENGKADVHNNVLKGAPHPPSLLMGDTWTKPY  985

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ +E++AAA+A
Sbjct  986   SREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLLPASQ-IEEQAAATA  1036



>ref|XP_007227061.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
 gb|EMJ28260.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
Length=1039

 Score =   531 bits (1367),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 263/292 (90%), Positives = 278/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  748   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P+PDKSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  808   TGGFPAPDKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFK+TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  868   EDYYPILFRGVNGTVAHEFIVDLRGFKHTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IEKGK D++NNVLK APHPPSLLM D WTKPY
Sbjct  928   IEPTESESKAELDRFCDALISIREEIAEIEKGKADLHNNVLKGAPHPPSLLMGDTWTKPY  987

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWPTTGRVDNVYGDRNLICTL P  Q VE++AAA+A
Sbjct  988   SREYAAFPALWLRSAKFWPTTGRVDNVYGDRNLICTLQPAPQAVEEQAAATA  1039



>ref|XP_003589000.1| Glycine dehydrogenase P protein [Medicago truncatula]
 gb|AES59251.1| glycine dehydrogenase [decarboxylating] protein [Medicago truncatula]
Length=1056

 Score =   531 bits (1367),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 264/292 (90%), Positives = 278/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  765   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  824

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+ +QPLG+ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  825   TGGIPAPENAQPLGSISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  884

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  885   ESYYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  944

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  D++NNVLK APHPPSLLMADAWTKPY
Sbjct  945   IEPTESESKAELDRFCDALISIRKEIAEIEKGNADVHNNVLKGAPHPPSLLMADAWTKPY  1004

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPT GRVDNVYGDRNLICTLLP SQ VE+ AAA+A
Sbjct  1005  SREYAAFPAPWLRVAKFWPTNGRVDNVYGDRNLICTLLPASQAVEEPAAATA  1056



>gb|ADM18296.1| mitochondrial glycine decarboxylase complex P-protein-like protein 
[Nicotiana benthamiana]
Length=350

 Score =   506 bits (1303),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 260/292 (89%), Positives = 270/292 (92%), Gaps = 10/292 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPF PSHPVVP
Sbjct  69    GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFXPSHPVVP  128

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPSPDKS+PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  129   TGGIPSPDKSEPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  188

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  189   EKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  248

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE          TLISIREEIA+IEKGK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  249   IEPTESE----------TLISIREEIAEIEKGKADIHNNVLKGAPHPPSLLMGDAWTKPY  298

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ VE++AAA+A
Sbjct  299   SREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQTVEEQAAATA  350



>ref|XP_010648358.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1053

 Score =   530 bits (1365),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 264/292 (90%), Positives = 278/292 (95%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  763   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  822

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK QPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  823   TGGIPAPDKLQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  882

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRGFKNTAGIE ED+AKRLMDYGFHGPTMSWPVPGTLM
Sbjct  883   EKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIAKRLMDYGFHGPTMSWPVPGTLM  942

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIAQIE GK D++NNVLK APHPPSLLM D WTKPY
Sbjct  943   IEPTESESKAELDRFCDALISIRKEIAQIENGKADVHNNVLKGAPHPPSLLMGDTWTKPY  1002

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ +E++AAA+A
Sbjct  1003  SREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLLPASQ-IEEQAAATA  1053



>ref|XP_003523643.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1031

 Score =   529 bits (1363),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 261/292 (89%), Positives = 279/292 (96%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  740   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  799

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P KSQPLG ISAAPWGSALILPISY+YIAMMGS+GLT+ASK AILNANYMAKRL
Sbjct  800   TGGIPAPGKSQPLGTISAAPWGSALILPISYSYIAMMGSKGLTEASKTAILNANYMAKRL  859

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  860   ENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHSPTMSFPVPGTLM  919

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKGK DINNNVLK APHPPS+LM DAWTKPY
Sbjct  920   IEPTESESKAELDRFCDALISIRQEIAEIEKGKADINNNVLKCAPHPPSVLMGDAWTKPY  979

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ+VE++AAA+A
Sbjct  980   SREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQVVEEQAAATA  1031



>ref|XP_008393646.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Malus domestica]
Length=1049

 Score =   530 bits (1364),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 279/292 (96%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  760   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  819

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG+P+PDKSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  820   TGGLPAPDKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  879

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFKNTAG+E EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  880   ENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVAKRLMDYGFHGPTMSWPVPGTLM  939

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNVLK APHPPSLLM DAWTKPY
Sbjct  940   IEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGAPHPPSLLMGDAWTKPY  999

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + VE++AAA+A
Sbjct  1000  SREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAVEEQAAATA  1049



>ref|XP_008444466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis melo]
Length=1047

 Score =   529 bits (1363),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 262/286 (92%), Positives = 273/286 (95%), Gaps = 0/286 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  756   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK+QPLG I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  816   TGGIPAPDKAQPLGTIAAAPWGSALILPISYTYIAMMGSEGLTNASKIAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  876   ENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK DINNNVLK APHPPSLLM DAWTKPY
Sbjct  936   IEPTESESKAELDRFCDALISIREEIAQIEKGKADINNNVLKGAPHPPSLLMGDAWTKPY  995

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVED  195
             SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTL P +Q+VE+
Sbjct  996   SREYAAFPASWLRASKFWPTTGRVDNVYGDRNLICTLQPANQVVEE  1041



>dbj|BAD81530.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82265.1| P protein-like [Oryza sativa Japonica Group]
Length=294

 Score =   503 bits (1295),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 254/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  3     GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIT  62

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  63    TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  122

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  123   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  182

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM+D+WTKPY
Sbjct  183   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSAPHPPQLLMSDSWTKPY  242

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  243   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  285



>ref|XP_010049196.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW81692.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=1053

 Score =   529 bits (1362),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 260/292 (89%), Positives = 277/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  762   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  821

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD++ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  822   TGGIPAPDQTNPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  881

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E ++PVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  882   ESYFPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  941

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAE+DRFCD +ISIREEIA+IEKGK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  942   IEPTESESKAEMDRFCDAMISIREEIAEIEKGKADIHNNVLKGAPHPPSLLMGDAWTKPY  1001

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SR+YAAFPA WL+T+KFWP+TGRVDNVYGDRNL CTLLP SQ  E+ AAA+A
Sbjct  1002  SRDYAAFPASWLRTSKFWPSTGRVDNVYGDRNLTCTLLPASQYTEEPAAATA  1053



>gb|EYU20359.1| hypothetical protein MIMGU_mgv1a000655mg [Erythranthe guttata]
Length=1030

 Score =   528 bits (1359),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 263/283 (93%), Positives = 270/283 (95%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLA FLPSHPVV 
Sbjct  739   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLASFLPSHPVVA  798

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDKSQPLG ISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  799   TGGIPAPDKSQPLGTISAAPWGSALILPISYTYIAMMGSNGLTDASKIAILNANYMAKRL  858

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  859   EDHYPILFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  918

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLI IREEI+ IEKGK DI+NNVLK APHPPSLLMAD WTKPY
Sbjct  919   IEPTESESKAELDRFCDTLILIREEISLIEKGKADIHNNVLKGAPHPPSLLMADEWTKPY  978

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAA+PA WL+TAKFWPTTGRVDNVYGDRNL+CTLL VSQM
Sbjct  979   SREYAAYPAAWLRTAKFWPTTGRVDNVYGDRNLVCTLLSVSQM  1021



>ref|XP_008797766.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   528 bits (1360),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 277/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHP+VP
Sbjct  749   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPLVP  808

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+QPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  809   TGGIPPPEKAQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LF GVNGTVAHEFI+DLRGFK TAGIE+EDVAKRL+DYGFH PTMSWPVPGTLM
Sbjct  869   ENHYPILFCGVNGTVAHEFIVDLRGFKATAGIESEDVAKRLIDYGFHAPTMSWPVPGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK APHPPSLLM DAWTKPY
Sbjct  929   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKGAPHPPSLLMGDAWTKPY  988

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLPVSQM E+ AAA+A
Sbjct  989   SREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLLPVSQMAEEPAAATA  1040



>gb|AAL24244.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
Length=694

 Score =   517 bits (1331),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 261/292 (89%), Positives = 270/292 (92%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPV+P
Sbjct  405   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKNHLAPFLPSHPVIP  464

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLGAISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAK L
Sbjct  465   TGGIPQPEKTAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKCL  524

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  525   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  584

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHPPSLLMAD W KPY
Sbjct  585   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPPSLLMADTWKKPY  644

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  645   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  694



>ref|XP_004142925.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis sativus]
 gb|KGN62389.1| hypothetical protein Csa_2G351700 [Cucumis sativus]
Length=1046

 Score =   528 bits (1359),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 261/286 (91%), Positives = 273/286 (95%), Gaps = 0/286 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  755   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  814

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK+QPLG I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  815   TGGIPAPDKAQPLGTIAAAPWGSALILPISYTYIAMMGSEGLTNASKIAILNANYMAKRL  874

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  875   ENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  934

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK DINNNVLK APHPPSLLM DAWTKPY
Sbjct  935   IEPTESESKAELDRFCDALISIREEIAQIEKGKADINNNVLKGAPHPPSLLMGDAWTKPY  994

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVED  195
             SREYAAFPA WL+ +KFWP+TGRVDNVYGDRNLICTL P +Q+VE+
Sbjct  995   SREYAAFPASWLRASKFWPSTGRVDNVYGDRNLICTLQPANQVVEE  1040



>gb|EYU29323.1| hypothetical protein MIMGU_mgv1a000648mg [Erythranthe guttata]
Length=1032

 Score =   527 bits (1358),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 263/283 (93%), Positives = 270/283 (95%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  741   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  800

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+ ++PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  801   TGGIPAPENAEPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  860

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLF GVNGT AHEFIIDLRGFK TAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  861   EKHYPVLFWGVNGTCAHEFIIDLRGFKTTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  920

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+ IE GK DINNNVLK APHPPSLLMADAWTKPY
Sbjct  921   IEPTESESKAELDRFCDALISIREEISLIENGKADINNNVLKGAPHPPSLLMADAWTKPY  980

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLL VSQM
Sbjct  981   SREYAAYPAAWLKTAKFWPTTGRVDNVYGDRNLICTLLSVSQM  1023



>ref|XP_009361863.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361876.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=1049

 Score =   527 bits (1358),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 261/292 (89%), Positives = 279/292 (96%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  760   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  819

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG+P+P+KSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  820   TGGLPAPNKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  879

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFKNTAG+E EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  880   ENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVAKRLMDYGFHGPTMSWPVPGTLM  939

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNVLK APHPPSLLM DAWTKPY
Sbjct  940   IEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGAPHPPSLLMGDAWTKPY  999

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + VE++AAA+A
Sbjct  1000  SREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAVEEQAAATA  1049



>gb|AEP95751.1| glycine decarboxylase complex subunit P [Cicer arietinum]
Length=274

 Score =   500 bits (1288),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 254/274 (93%), Positives = 264/274 (96%), Gaps = 0/274 (0%)
 Frame = -2

Query  1043  MNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVPTGG  864
             MNAQV LTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVPTGG
Sbjct  1     MNAQVELTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVPTGG  60

Query  863   IPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRLEKH  684
             IP+P+K QPLG+ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRLE +
Sbjct  61    IPAPEKYQPLGSISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRLENY  120

Query  683   YPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIEP  504
             YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLMIEP
Sbjct  121   YPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEP  180

Query  503   TESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPYSRE  324
             TESESKAELDRFCD LISIR+EIA++EKG  DI+NNVLK APHPPSLLMADAWTKPYSRE
Sbjct  181   TESESKAELDRFCDALISIRKEIAEVEKGNADIHNNVLKGAPHPPSLLMADAWTKPYSRE  240

Query  323   YAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  222
             YAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL
Sbjct  241   YAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTL  274



>ref|NP_001289247.1| glycine dehydrogenase (decarboxylating), mitochondrial [Pyrus 
x bretschneideri]
 gb|AHM26626.1| glycine dehydrogenase decarboxylating protein [Pyrus x bretschneideri]
Length=1049

 Score =   527 bits (1358),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 278/292 (95%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  760   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  819

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG+P PDKSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  820   TGGLPVPDKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  879

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFK+TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  880   ENYYPILFRGVNGTVAHEFIVDLRGFKSTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  939

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNVLK APHPPSLLM DAWTKPY
Sbjct  940   IEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGAPHPPSLLMGDAWTKPY  999

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + VE++AAA+A
Sbjct  1000  SREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAVEEQAAATA  1049



>gb|KHN29723.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1031

 Score =   526 bits (1356),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 260/292 (89%), Positives = 278/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  740   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  799

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             T GIP+P KSQPLG ISAAPWGSALILPISY+YIAMMGS+GLT+ASK AILNANYMAKRL
Sbjct  800   TCGIPAPGKSQPLGTISAAPWGSALILPISYSYIAMMGSKGLTEASKTAILNANYMAKRL  859

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  860   ENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHSPTMSFPVPGTLM  919

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKGK DINNNVLK APHPPS+LM DAWTKPY
Sbjct  920   IEPTESESKAELDRFCDALISIRQEIAEIEKGKADINNNVLKCAPHPPSVLMGDAWTKPY  979

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ+VE++AAA+A
Sbjct  980   SREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQVVEEQAAATA  1031



>ref|XP_009361869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=1049

 Score =   526 bits (1356),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 260/292 (89%), Positives = 279/292 (96%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  760   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  819

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG+P+P+KSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  820   TGGLPAPNKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  879

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFKNTAG+E EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  880   ENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVAKRLMDYGFHGPTMSWPVPGTLM  939

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNVLK APHPPSLLM DAWTKPY
Sbjct  940   IEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGAPHPPSLLMGDAWTKPY  999

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + VE+++AA+A
Sbjct  1000  SREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAVEEQSAATA  1049



>ref|XP_010526062.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Tarenaya hassleriana]
Length=1051

 Score =   526 bits (1354),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 276/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  760   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  819

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+KS PLG ISAAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  820   TGGIPKPEKSAPLGTISAAPWGSALILPISYTYIAMMGSEGLTNASKIAILNANYMAKRL  879

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  880   ENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  939

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+ IEKG  DI+NNVLK APHPPSLLMADAW KPY
Sbjct  940   IEPTESESKAELDRFCDALISIREEISLIEKGNADIHNNVLKGAPHPPSLLMADAWKKPY  999

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SRE AAFPA WL+++KFWP+TGRVDNVYGDRNL+CTLL VSQ+ E++AAASA
Sbjct  1000  SRECAAFPAPWLRSSKFWPSTGRVDNVYGDRNLVCTLLSVSQVAEEQAAASA  1051



>ref|XP_004291039.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Fragaria vesca subsp. vesca]
Length=1048

 Score =   525 bits (1353),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 260/292 (89%), Positives = 277/292 (95%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAP+LPSHPVVP
Sbjct  759   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPYLPSHPVVP  818

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KSQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  819   TGGIPAPEKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  878

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFKNTAGIEAED+AKRLMDYGFHGPTMSWPVPGTLM
Sbjct  879   ENYYPILFRGVNGTVAHEFIVDLRGFKNTAGIEAEDIAKRLMDYGFHGPTMSWPVPGTLM  938

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI QIEKGK DI+NNVLK APHPPSLLM D W+KPY
Sbjct  939   IEPTESESKAELDRFCDALISIREEIGQIEKGKADIHNNVLKGAPHPPSLLMGDTWSKPY  998

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICTL P  + VE+ AAA+A
Sbjct  999   SREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICTLQP--EPVEEAAAATA  1048



>dbj|BAD81529.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82264.1| P protein-like [Oryza sativa Japonica Group]
Length=493

 Score =   506 bits (1304),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 254/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  202   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIT  261

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  262   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  321

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  322   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  381

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM+D+WTKPY
Sbjct  382   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSAPHPPQLLMSDSWTKPY  441

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  442   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  484



>gb|AFW56072.1| hypothetical protein ZEAMMB73_271256 [Zea mays]
Length=495

 Score =   505 bits (1301),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 253/283 (89%), Positives = 262/283 (93%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  202   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  261

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  262   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  321

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLR FK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  322   EKHYPVLFRGVNGTVAHEFIIDLRAFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  381

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+ NNVLK APHPP LLM D W+KPY
Sbjct  382   IEPTESESKAELDRFCDALISIREEIAEIESGKADVLNNVLKGAPHPPQLLMGDTWSKPY  441

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL   +Q+
Sbjct  442   SREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQATQV  484



>ref|XP_007161011.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
 gb|ESW33005.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
Length=1062

 Score =   523 bits (1348),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 259/279 (93%), Positives = 269/279 (96%), Gaps = 0/279 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  771   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIS  830

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDKS+PLG ISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  831   TGGIPAPDKSEPLGTISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  890

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYG+H PTMSWPVPGTLM
Sbjct  891   ENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGYHAPTMSWPVPGTLM  950

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIR+EIA+IEKGK DINNNVLK APHPPSLLMADAWTKPY
Sbjct  951   IEPTESESKAELDRFCDTLISIRQEIAEIEKGKVDINNNVLKGAPHPPSLLMADAWTKPY  1010

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
             SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP
Sbjct  1011  SREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLP  1049



>ref|XP_002867212.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43471.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score =   522 bits (1345),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 271/292 (93%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPV+P
Sbjct  748   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKNHLAPFLPSHPVIP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLGAISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  808   TGGIPQPEKTAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  868   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHPPSLLMAD W KPY
Sbjct  928   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPPSLLMADTWKKPY  987

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  988   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1037



>gb|AAK68740.1| P-Protein - like protein [Arabidopsis thaliana]
 gb|AAM91322.1| P-protein-like protein [Arabidopsis thaliana]
Length=1037

 Score =   522 bits (1345),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 271/292 (93%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPV+P
Sbjct  748   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKNHLAPFLPSHPVIP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLGAISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  808   TGGIPQPEKTAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  868   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHPPSLLMAD W KPY
Sbjct  928   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPPSLLMADTWKKPY  987

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  988   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--TAAVSA  1037



>gb|KHN32209.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1023

 Score =   522 bits (1344),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 257/292 (88%), Positives = 276/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  732   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  791

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P KSQPLG ISAAPWGSALILPISY+YIAMMGS+GLT+ASK AILNANYMAKRL
Sbjct  792   TGGIPAPGKSQPLGTISAAPWGSALILPISYSYIAMMGSKGLTEASKTAILNANYMAKRL  851

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  852   ENHYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDYGFHSPTMSFPVPGTLM  911

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK+ELDRFCD LISIR+EIA+IEKGK DINNNVLK APHPP +LM DAWTKPY
Sbjct  912   IEPTESESKSELDRFCDALISIRQEIAEIEKGKADINNNVLKCAPHPPPVLMGDAWTKPY  971

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ VE++AAA+A
Sbjct  972   SREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQAVEEQAAATA  1023



>ref|XP_003526001.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1023

 Score =   522 bits (1344),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 257/292 (88%), Positives = 276/292 (95%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  732   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  791

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P KSQPLG ISAAPWGSALILPISY+YIAMMGS+GLT+ASK AILNANYMAKRL
Sbjct  792   TGGIPAPGKSQPLGTISAAPWGSALILPISYSYIAMMGSKGLTEASKTAILNANYMAKRL  851

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  852   ENHYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDYGFHSPTMSFPVPGTLM  911

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK+ELDRFCD LISIR+EIA+IEKGK DINNNVLK APHPP +LM DAWTKPY
Sbjct  912   IEPTESESKSELDRFCDALISIRQEIAEIEKGKADINNNVLKCAPHPPPVLMGDAWTKPY  971

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ VE++AAA+A
Sbjct  972   SREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQAVEEQAAATA  1023



>ref|NP_195027.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 sp|Q94B78.2|GCSP1_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 1, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 1; 
AltName: Full=Glycine decarboxylase 1; AltName: Full=Glycine 
decarboxylase P-protein 1; Short=AtGLDP1; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA21210.1| P-Protein-like protein [Arabidopsis thaliana]
 emb|CAB80018.1| P-Protein-like protein [Arabidopsis thaliana]
 gb|AAL36259.1| putative P-Protein [Arabidopsis thaliana]
 gb|AAM14125.1| putative P-protein [Arabidopsis thaliana]
 gb|AEE86159.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=1037

 Score =   522 bits (1345),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 271/292 (93%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPV+P
Sbjct  748   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKNHLAPFLPSHPVIP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLGAISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  808   TGGIPQPEKTAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  868   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHPPSLLMAD W KPY
Sbjct  928   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPPSLLMADTWKKPY  987

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  988   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1037



>ref|XP_009392931.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1038

 Score =   520 bits (1339),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 257/283 (91%), Positives = 268/283 (95%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  747   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  806

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K QPLG I+AAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  807   TGGIPPPEKVQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  866

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFK TAG+EAEDVAKRL+DYGFH PTMSWPVPGTLM
Sbjct  867   ENYYPILFRGVNGTVAHEFIVDLRGFKATAGLEAEDVAKRLIDYGFHAPTMSWPVPGTLM  926

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIE GK DIN NVLK APHPPSL+M D W+KPY
Sbjct  927   IEPTESESKAELDRFCDALISIREEIAQIENGKADININVLKGAPHPPSLIMGDTWSKPY  986

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLPVSQM
Sbjct  987   SREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLLPVSQM  1029



>gb|EMS46370.1| Glycine dehydrogenase [decarboxylating] B, mitochondrial [Triticum 
urartu]
Length=796

 Score =   512 bits (1319),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 255/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  505   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  564

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG+ISAAPWGSALILPISYTYIAMMGSQGLT+ASKIAILNANYMAKRL
Sbjct  565   TGGFPLPEKTDPLGSISAAPWGSALILPISYTYIAMMGSQGLTEASKIAILNANYMAKRL  624

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  625   EKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  684

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA++E GK D +NNVLK APHPP LLM DAWTKPY
Sbjct  685   IEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGAPHPPQLLMGDAWTKPY  744

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  745   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  787



>ref|XP_006644607.1| PREDICTED: glycine dehydrogenase [decarboxylating] 2, mitochondrial-like 
[Oryza brachyantha]
Length=946

 Score =   517 bits (1331),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 260/292 (89%), Positives = 271/292 (93%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  656   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  715

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P PDK+ PLG ISAAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  716   TGGFPLPDKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  775

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  776   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  835

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM D WTKPY
Sbjct  836   IEPTESESKAELDRFCDALISIREEIAEIENGKADVNNNVLKSAPHPPQLLMGDTWTKPY  895

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ VE+ AAA+A
Sbjct  896   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQ-VEEAAAATA  946



>gb|AAL57651.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
 gb|AAN64523.1| At4g33010/F26P21_130 [Arabidopsis thaliana]
Length=1037

 Score =   519 bits (1337),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 261/292 (89%), Positives = 270/292 (92%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPV+P
Sbjct  748   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKNHLAPFLPSHPVIP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLGAISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  808   TGGIPQPEKTAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVA EFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  868   EKHYPVLFRGVNGTVAREFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHPPSLLMAD W KPY
Sbjct  928   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPPSLLMADTWKKPY  987

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  988   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1037



>ref|XP_008808050.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   519 bits (1336),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 256/283 (90%), Positives = 269/283 (95%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVVP
Sbjct  749   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVP  808

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+QPLG ISAAPWGSALILPISYTY+AMMGS+GLTDASKIAILNANYMAKRL
Sbjct  809   TGGIPLPEKAQPLGTISAAPWGSALILPISYTYVAMMGSKGLTDASKIAILNANYMAKRL  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LF GVNGTVAHEFI+DLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  869   EKHYPILFCGVNGTVAHEFIVDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK DINNNV+K APHPPS+LM D WTKPY
Sbjct  929   IEPTESESKAELDRFCDALISIREEIAEIENGKADINNNVMKGAPHPPSMLMGDTWTKPY  988

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQM
Sbjct  989   SREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLLPASQM  1031



>ref|NP_180178.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
 sp|O80988.1|GCSP2_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 2, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 2; 
AltName: Full=Glycine decarboxylase 2; AltName: Full=Glycine 
decarboxylase P-protein 2; Short=AtGLDP2; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC31228.1| putative glycine dehydrogenase [Arabidopsis thaliana]
 gb|AEC07793.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
Length=1044

 Score =   518 bits (1335),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 258/291 (89%), Positives = 272/291 (93%), Gaps = 3/291 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  754   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  813

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+++ PLG ISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  814   TGGIPEPEQTSPLGTISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  873

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  874   ESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  933

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNVLK APHPPSLLMAD W KPY
Sbjct  934   IEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGAPHPPSLLMADTWKKPY  993

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P +   E++AAA+
Sbjct  994   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQPAN---EEQAAAA  1041



>dbj|BAE98954.1| putative glycine dehydrogenase [Arabidopsis thaliana]
Length=1044

 Score =   518 bits (1335),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 258/291 (89%), Positives = 272/291 (93%), Gaps = 3/291 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  754   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  813

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+++ PLG ISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  814   TGGIPEPEQTSPLGTISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  873

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  874   ESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  933

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNVLK APHPPSLLMAD W KPY
Sbjct  934   IEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGAPHPPSLLMADTWKKPY  993

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P +   E++AAA+
Sbjct  994   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQPAN---EEQAAAA  1041



>gb|KFK29912.1| hypothetical protein AALP_AA7G194500 [Arabis alpina]
Length=1042

 Score =   518 bits (1334),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 259/292 (89%), Positives = 272/292 (93%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAP+LPSHPV+P
Sbjct  753   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPYLPSHPVIP  812

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLGAISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  813   TGGIPQPEKTAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  872

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAG+E EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  873   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGVEPEDVAKRLMDYGFHGPTMSWPVPGTLM  932

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHPPSLLMAD+W KPY
Sbjct  933   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPPSLLMADSWKKPY  992

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  993   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPDEEQV--AAAVSA  1042



>gb|AAA63798.1| victorin binding protein [Avena sativa]
Length=1032

 Score =   517 bits (1332),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 257/283 (91%), Positives = 266/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  741   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  800

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG+ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  801   TGGFPLPEKTDPLGSISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  860

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  861   EKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  920

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQ+E G  D+NNNVLK APHPP LLM+DAWTKPY
Sbjct  921   IEPTESESKAELDRFCDALISIREEIAQVENGIADVNNNVLKGAPHPPQLLMSDAWTKPY  980

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  981   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1023



>gb|KDO80088.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=946

 Score =   513 bits (1322),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 253/279 (91%), Positives = 265/279 (95%), Gaps = 0/279 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  655   GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  714

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KSQPLG I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  715   TGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  774

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  775   EKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  834

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNVLK APHPPSLLM D WTKPY
Sbjct  835   IEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDTWTKPY  894

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
             SREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLLP
Sbjct  895   SREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLLP  933



>ref|XP_002880741.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57000.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
Length=1043

 Score =   516 bits (1329),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 256/291 (88%), Positives = 272/291 (93%), Gaps = 3/291 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  753   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  812

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+++ PLG ISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  813   TGGIPEPEQTSPLGTISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  872

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  873   ESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  932

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EI+QIEKG  D NNNVLK APHPPSLLMAD W KPY
Sbjct  933   IEPTESESKAELDRFCDALISIRDEISQIEKGNADPNNNVLKGAPHPPSLLMADTWKKPY  992

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAAFPA WL+++KFWP+TGRVDNVYGDRNL+CTL P +   E++AAA+
Sbjct  993   SREYAAFPAPWLRSSKFWPSTGRVDNVYGDRNLVCTLQPAN---EEQAAAA  1040



>ref|XP_010667776.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=1042

 Score =   516 bits (1328),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 255/291 (88%), Positives = 269/291 (92%), Gaps = 0/291 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  752   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  811

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+  +PLG ISAAPWGSALILPISYTYIAMMGS GLT+ASK AILNANYMAKRL
Sbjct  812   TGGIPAPENLEPLGTISAAPWGSALILPISYTYIAMMGSNGLTEASKQAILNANYMAKRL  871

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGT AHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  872   EDHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  931

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAE+DRFCD LISIREEIA+IE GK D NNNVLK APHPPS+LMAD+W KPY
Sbjct  932   IEPTESESKAEMDRFCDALISIREEIAEIENGKADANNNVLKGAPHPPSMLMADSWNKPY  991

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTLLP +   E++AA +
Sbjct  992   SREYAAYPADWLRAAKFWPTTARVDNVYGDRNLICTLLPANHYEEEKAATA  1042



>ref|XP_006412401.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
 gb|ESQ53854.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
Length=1146

 Score =   518 bits (1334),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 258/292 (88%), Positives = 271/292 (93%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  857   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  916

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLG I+AAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  917   TGGIPQPEKTTPLGTIAAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  976

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAG+E EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  977   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGVEPEDVAKRLMDYGFHGPTMSWPVPGTLM  1036

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ +NVLK APHPPSLLMAD W KPY
Sbjct  1037  IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQDNVLKGAPHPPSLLMADTWKKPY  1096

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  1097  SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1146



>ref|XP_006450834.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
 gb|ESR64074.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
Length=1058

 Score =   515 bits (1327),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 253/279 (91%), Positives = 265/279 (95%), Gaps = 0/279 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  767   GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  826

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KSQPLG I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  827   TGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  886

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  887   EKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  946

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNVLK APHPPSLLM D WTKPY
Sbjct  947   IEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDTWTKPY  1006

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
             SREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLLP
Sbjct  1007  SREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLLP  1045



>ref|XP_006475931.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Citrus sinensis]
 gb|KDO80086.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
 gb|KDO80087.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1058

 Score =   515 bits (1326),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 253/279 (91%), Positives = 265/279 (95%), Gaps = 0/279 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  767   GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  826

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KSQPLG I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  827   TGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  886

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  887   EKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  946

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNVLK APHPPSLLM D WTKPY
Sbjct  947   IEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDTWTKPY  1006

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
             SREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLLP
Sbjct  1007  SREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLLP  1045



>emb|CDM83805.1| unnamed protein product [Triticum aestivum]
Length=1031

 Score =   514 bits (1323),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 256/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  740   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  799

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG+ISAAPWGSALILPISYTYIAMMGSQGLT+ASKIAILNANYMAKRL
Sbjct  800   TGGFPLPEKTDPLGSISAAPWGSALILPISYTYIAMMGSQGLTEASKIAILNANYMAKRL  859

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  860   EKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  919

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQ+E GK D +NNVLK APHPP LLM DAWTKPY
Sbjct  920   IEPTESESKAELDRFCDALISIREEIAQVENGKADAHNNVLKGAPHPPQLLMGDAWTKPY  979

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  980   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1022



>ref|XP_003569669.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Brachypodium distachyon]
Length=1033

 Score =   514 bits (1323),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 255/283 (90%), Positives = 266/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  740   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  799

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG+ISAAPWGSALILPISYTYIAMMGSQGLT+ASKIAILNANYMAKRL
Sbjct  800   TGGFPLPEKTDPLGSISAAPWGSALILPISYTYIAMMGSQGLTEASKIAILNANYMAKRL  859

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  860   EKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  919

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA++E GK D +NNVLK APHPP LLM+DAWTKPY
Sbjct  920   IEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGAPHPPQLLMSDAWTKPY  979

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  980   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1022



>ref|XP_010942763.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Elaeis guineensis]
Length=1042

 Score =   514 bits (1323),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 255/283 (90%), Positives = 267/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  751   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  810

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+QPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYM KRL
Sbjct  811   TGGIPPPEKAQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMVKRL  870

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LF GVNGTVAHEFI+DLRG+K TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  871   ENHYPILFCGVNGTVAHEFIVDLRGYKATAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  930

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE G+ DI+NNVLK APHPPSLLM D WTKPY
Sbjct  931   IEPTESESKAELDRFCDALISIREEIAEIESGRADISNNVLKGAPHPPSLLMGDTWTKPY  990

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLPVSQM
Sbjct  991   SREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLLPVSQM  1033



>gb|EMT12369.1| Glycine dehydrogenase (decarboxylating), mitochondrial [Aegilops 
tauschii]
Length=1027

 Score =   513 bits (1322),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 255/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  736   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  795

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG+ISAAPWGSALILPISYTYIAMMGSQGLT+ASKIAILNANYMAKRL
Sbjct  796   TGGFPLPEKTDPLGSISAAPWGSALILPISYTYIAMMGSQGLTEASKIAILNANYMAKRL  855

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  856   EKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  915

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA++E GK D +NNVLK APHPP LLM DAWTKPY
Sbjct  916   IEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGAPHPPQLLMGDAWTKPY  975

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  976   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1018



>ref|XP_010925018.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Elaeis guineensis]
Length=1040

 Score =   513 bits (1322),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 256/292 (88%), Positives = 270/292 (92%), Gaps = 0/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  749   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  808

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K QP+G ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYM KRL
Sbjct  809   TGGIPPPEKVQPVGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMVKRL  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LF GVNGTVAHEFI+DLRGFK TAGIE EDVAKRL+DYGFH PTMSWPVPGTLM
Sbjct  869   ENHYPILFCGVNGTVAHEFIVDLRGFKATAGIEPEDVAKRLIDYGFHAPTMSWPVPGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK DINNNVLK APHPPS+LM D W KPY
Sbjct  929   IEPTESESKAELDRFCDALISIREEIAEIESGKADINNNVLKGAPHPPSMLMGDTWIKPY  988

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SR+ AAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQM E+ AAA+A
Sbjct  989   SRDIAAFPASWLQGSKFWPTTGRVDNVYGDRNLICTLLPASQMAEEPAAATA  1040



>ref|XP_010097067.1| Glycine cleavage system P protein 1 [Morus notabilis]
 gb|EXB66868.1| Glycine cleavage system P protein 1 [Morus notabilis]
Length=1059

 Score =   514 bits (1324),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 258/284 (91%), Positives = 269/284 (95%), Gaps = 5/284 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  763   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  822

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK+QPLG I+AAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  823   TGGIPAPDKAQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  882

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFK-----NTAGIEAEDVAKRLMDYGFHGPTMSWPV  528
             E +YPVLFRGVNGT AHEFI+DLRGFK     NTAGIE EDVAKRLMDYGFH PTMSWPV
Sbjct  883   ENYYPVLFRGVNGTCAHEFIVDLRGFKAGFLFNTAGIEPEDVAKRLMDYGFHAPTMSWPV  942

Query  527   PGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADA  348
             PGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DI+NNVLK+APHPPSLLMADA
Sbjct  943   PGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADIHNNVLKSAPHPPSLLMADA  1002

Query  347   WTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
             WTKPYSRE AAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP
Sbjct  1003  WTKPYSRESAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLP  1046



>ref|XP_006408846.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
 gb|ESQ50299.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
Length=1041

 Score =   513 bits (1322),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 253/279 (91%), Positives = 263/279 (94%), Gaps = 0/279 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+ 
Sbjct  749   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIR  808

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ + PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  809   TGGIPEPENTSPLGTISAAPWGSALILPISYTYIAMMGSEGLTDASKIAILNANYMAKRL  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  869   ENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNVLK APHPPSLLMAD W KPY
Sbjct  929   IEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGAPHPPSLLMADTWKKPY  988

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
             SREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P
Sbjct  989   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQP  1027



>gb|AAB82711.1| glycine decarboxylase P subunit [x Tritordeum sp.]
Length=1031

 Score =   512 bits (1319),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 255/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  740   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  799

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG+ISAAPWGSALILPISYTYIAMMGSQGLT+ASKIAILNANYMAKRL
Sbjct  800   TGGFPLPEKTDPLGSISAAPWGSALILPISYTYIAMMGSQGLTEASKIAILNANYMAKRL  859

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  860   EKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  919

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA++E GK D +NNVLK APHPP LLM DAWTKPY
Sbjct  920   IEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGAPHPPQLLMGDAWTKPY  979

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  980   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1022



>gb|KFK32542.1| hypothetical protein AALP_AA6G256500 [Arabis alpina]
Length=1041

 Score =   511 bits (1317),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 253/282 (90%), Positives = 264/282 (94%), Gaps = 0/282 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+ 
Sbjct  751   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIR  810

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ + PLG ISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  811   TGGIPEPETTSPLGTISAAPWGSALILPISYTYIAMMGSVGLTDASKIAILNANYMAKRL  870

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  871   ESHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  930

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNVLK APHPPSLLMADAW KPY
Sbjct  931   IEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGAPHPPSLLMADAWKKPY  990

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  207
             SREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P ++
Sbjct  991   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQPANE  1032



>ref|XP_002441849.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
 gb|EES15687.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
Length=1042

 Score =   511 bits (1317),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 254/283 (90%), Positives = 262/283 (93%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  750   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  809

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISY YIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  810   TGGFPLPEKTDPLGTISAAPWGSALILPISYAYIAMMGSQGLTDASKIAILNANYMAKRL  869

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  870   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHSPTMSWPVPGTLM  929

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+ NNVLK APHPP LLM D W+KPY
Sbjct  930   IEPTESESKAELDRFCDALISIREEIAEIENGKADVLNNVLKGAPHPPQLLMGDTWSKPY  989

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL   SQ+
Sbjct  990   SREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQASQV  1032



>ref|XP_004969722.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Setaria italica]
Length=1033

 Score =   511 bits (1316),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 254/283 (90%), Positives = 263/283 (93%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  742   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKEHLAPFLPSHPVIP  801

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  802   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  861

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  862   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  921

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D  NNVLK APHPP LLM+D+WTKPY
Sbjct  922   IEPTESESKAELDRFCDALISIREEIAEIENGKADALNNVLKGAPHPPQLLMSDSWTKPY  981

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL    Q+
Sbjct  982   SREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQAGQV  1024



>gb|EAZ13293.1| hypothetical protein OsJ_03218 [Oryza sativa Japonica Group]
Length=1035

 Score =   511 bits (1315),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 254/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  744   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIT  803

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  804   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  863

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  864   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  923

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM+D+WTKPY
Sbjct  924   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSAPHPPQLLMSDSWTKPY  983

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  984   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1026



>gb|EAY75571.1| hypothetical protein OsI_03474 [Oryza sativa Indica Group]
Length=1033

 Score =   510 bits (1314),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 254/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  742   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIT  801

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  802   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  861

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  862   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  921

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM+D+WTKPY
Sbjct  922   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSAPHPPQLLMSDSWTKPY  981

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  982   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1024



>gb|EAZ37623.1| hypothetical protein OsJ_21958 [Oryza sativa Japonica Group]
Length=1005

 Score =   509 bits (1312),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 253/283 (89%), Positives = 264/283 (93%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  714   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIT  773

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYM KRL
Sbjct  774   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMTKRL  833

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  834   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  893

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM+D+WTKPY
Sbjct  894   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSAPHPPQLLMSDSWTKPY  953

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  954   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  996



>ref|NP_001044046.1| Os01g0711400 [Oryza sativa Japonica Group]
 gb|AAQ24377.1| glycine dehydrogenase P protein [Oryza sativa Japonica Group]
 dbj|BAF05960.1| Os01g0711400 [Oryza sativa Japonica Group]
Length=1033

 Score =   510 bits (1313),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 254/283 (90%), Positives = 265/283 (94%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  742   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIT  801

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  802   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  861

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  862   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  921

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM+D+WTKPY
Sbjct  922   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSAPHPPQLLMSDSWTKPY  981

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  982   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1024



>emb|CBI27919.3| unnamed protein product [Vitis vinifera]
Length=1024

 Score =   509 bits (1312),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 253/278 (91%), Positives = 263/278 (95%), Gaps = 0/278 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLP+HPVVP
Sbjct  732   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPAHPVVP  791

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPS + +QPLG ISAAPWGSALILPISYTYIAMMGS+GLT+ASKIAIL ANYMAKRL
Sbjct  792   TGGIPSSENAQPLGTISAAPWGSALILPISYTYIAMMGSKGLTEASKIAILKANYMAKRL  851

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRG+NGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  852   EDHYPILFRGINGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  911

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK D NNNVLK APHP SLLM DAWTKPY
Sbjct  912   IEPTESESKAELDRFCDALISIREEIAQIEKGKADPNNNVLKGAPHPQSLLMQDAWTKPY  971

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  219
             SREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  972   SREYAAFPASWLRAAKFWPSTGRVDNVYGDRNLTCTLL  1009



>dbj|BAD35509.1| putative glycine dehydrogenase [Oryza sativa Japonica Group]
 gb|EAZ01651.1| hypothetical protein OsI_23687 [Oryza sativa Indica Group]
Length=1031

 Score =   509 bits (1312),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/283 (89%), Positives = 264/283 (93%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  740   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIT  799

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYM KRL
Sbjct  800   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMTKRL  859

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  860   EKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  919

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNVLK+APHPP LLM+D+WTKPY
Sbjct  920   IEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSAPHPPQLLMSDSWTKPY  979

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  980   SREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1022



>gb|AEP95746.1| glycine decarboxylase complex subunit P [Cicer arietinum]
Length=264

 Score =   483 bits (1242),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 245/264 (93%), Positives = 255/264 (97%), Gaps = 0/264 (0%)
 Frame = -2

Query  1010  FIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVPTGGIPSPDKSQPLG  831
             +IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVPTGGIP+P+K QPLG
Sbjct  1     WIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVPTGGIPAPEKYQPLG  60

Query  830   AISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGT  651
             +ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRLE +YPVLFRGVNGT
Sbjct  61    SISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRLENYYPVLFRGVNGT  120

Query  650   VAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDR  471
             VAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDR
Sbjct  121   VAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDR  180

Query  470   FCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKT  291
             FCD LISIR+EIA++EKG  DI+NNVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ 
Sbjct  181   FCDALISIRKEIAEVEKGNADIHNNVLKGAPHPPSLLMADAWTKPYSREYAAFPAAWLRV  240

Query  290   AKFWPTTGRVDNVYGDRNLICTLL  219
             AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  241   AKFWPTTGRVDNVYGDRNLICTLL  264



>ref|XP_002282271.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1046

 Score =   509 bits (1312),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/278 (91%), Positives = 263/278 (95%), Gaps = 0/278 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLP+HPVVP
Sbjct  754   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPAHPVVP  813

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIPS + +QPLG ISAAPWGSALILPISYTYIAMMGS+GLT+ASKIAIL ANYMAKRL
Sbjct  814   TGGIPSSENAQPLGTISAAPWGSALILPISYTYIAMMGSKGLTEASKIAILKANYMAKRL  873

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRG+NGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  874   EDHYPILFRGINGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  933

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKGK D NNNVLK APHP SLLM DAWTKPY
Sbjct  934   IEPTESESKAELDRFCDALISIREEIAQIEKGKADPNNNVLKGAPHPQSLLMQDAWTKPY  993

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  219
             SREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  994   SREYAAFPASWLRAAKFWPSTGRVDNVYGDRNLTCTLL  1031



>ref|NP_001292744.1| glycine dehydrogenase (decarboxylating), mitochondrial precursor 
[Zea mays]
 gb|AFW56070.1| glycine cleavage complex P-protein [Zea mays]
Length=1042

 Score =   509 bits (1312),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/283 (89%), Positives = 262/283 (93%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  749   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  808

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  809   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLR FK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  869   EKHYPVLFRGVNGTVAHEFIIDLRAFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+ NNVLK APHPP LLM D W+KPY
Sbjct  929   IEPTESESKAELDRFCDALISIREEIAEIESGKADVLNNVLKGAPHPPQLLMGDTWSKPY  988

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL   +Q+
Sbjct  989   SREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQATQV  1031



>ref|XP_006858311.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Amborella trichopoda]
 gb|ERN19778.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
Length=1044

 Score =   506 bits (1302),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 251/284 (88%), Positives = 265/284 (93%), Gaps = 0/284 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  753   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  812

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+KSQPLG ISAAPWGSALILPISYTYIAMMGS+GLT+ASKI+ILNANYMAKRL
Sbjct  813   TGGIPPPEKSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTEASKISILNANYMAKRL  872

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGT AHEFIIDLRGFK +AGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  873   ENHYPVLFRGVNGTCAHEFIIDLRGFKGSAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  932

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+KAELDRFCD LISIR+EIAQIE GK D+  NVLK APHPPSL+MAD W KPY
Sbjct  933   IEPTESETKAELDRFCDALISIRKEIAQIESGKADVLVNVLKGAPHPPSLIMADEWKKPY  992

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  201
             SREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL+CTLLPV+  V
Sbjct  993   SREYAAFPASWLRGAKFWPSTGRVDNVYGDRNLVCTLLPVTNGV  1036



>sp|O49852.1|GCSP_FLATR RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
trinervia]
 emb|CAB16916.1| P-Protein precursor [Flaveria trinervia]
Length=1034

 Score =   504 bits (1299),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/292 (86%), Positives = 270/292 (92%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVVP
Sbjct  744   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVP  803

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P++SQPLG I+AAPWGSALILPISYTYIAMMGSQG+T+ASKIAILNANYMAKRL
Sbjct  804   TGGIPAPEQSQPLGTIAAAPWGSALILPISYTYIAMMGSQGITNASKIAILNANYMAKRL  863

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  864   ENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  923

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  D NNNV+K APHPP LLMAD WTKPY
Sbjct  924   IEPTESESKAELDRFCDALISIRQEIAEIEKGTVDFNNNVIKGAPHPPQLLMADKWTKPY  983

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P  Q  E++A A+A
Sbjct  984   SREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP-PQEYEEKAEATA  1034



>emb|CDX75316.1| BnaA01g03860D [Brassica napus]
Length=1044

 Score =   504 bits (1299),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/292 (86%), Positives = 269/292 (92%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  755   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  814

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K++PLG I+AAPWGSALILPISY+YIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  815   TGGFPQPEKTEPLGPIAAAPWGSALILPISYSYIAMMGSRGLTEASKIAILNANYMAKRL  874

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKH+PVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH PTMS+PV GTLM
Sbjct  875   EKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHAPTMSFPVSGTLM  934

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ NNVLK APH P++LM+D W KPY
Sbjct  935   IEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQNNVLKGAPHSPAMLMSDTWKKPY  994

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  995   SREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1044



>sp|P49362.1|GCSPB_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) B, mitochondrial; 
AltName: Full=Glycine cleavage system P protein B; 
AltName: Full=Glycine decarboxylase B; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) B; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA91000.1| P-protein precursor of glycine cleavage system [Flaveria pringlei]
Length=1034

 Score =   504 bits (1298),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/292 (86%), Positives = 270/292 (92%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVVP
Sbjct  744   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVP  803

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P++SQPLG I+AAPWGSALILPISYTYIAMMGSQG+T+ASKIAILNANYMAKRL
Sbjct  804   TGGIPAPEQSQPLGTIAAAPWGSALILPISYTYIAMMGSQGITNASKIAILNANYMAKRL  863

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  864   ENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  923

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  D NNNV+K APHPP LLMAD WTKPY
Sbjct  924   IEPTESESKAELDRFCDALISIRQEIAEIEKGNVDFNNNVIKGAPHPPQLLMADKWTKPY  983

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P  Q  E++A A+A
Sbjct  984   SREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP-PQEYEEKAEATA  1034



>ref|XP_009125119.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Brassica rapa]
Length=1045

 Score =   504 bits (1299),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/292 (86%), Positives = 269/292 (92%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  756   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K++PLG I+AAPWGSALILPISY+YIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  816   TGGFPQPEKTEPLGPIAAAPWGSALILPISYSYIAMMGSRGLTEASKIAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKH+PVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH PTMS+PV GTLM
Sbjct  876   EKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHAPTMSFPVSGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ NNVLK APH P++LM+D W KPY
Sbjct  936   IEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQNNVLKGAPHSPAMLMSDTWKKPY  995

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  996   SREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1045



>sp|O49850.1|GCSP_FLAAN RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
anomala]
 emb|CAB16911.1| P-protein [Flaveria anomala]
Length=1034

 Score =   503 bits (1296),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 251/292 (86%), Positives = 270/292 (92%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVVP
Sbjct  744   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVP  803

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P++SQPLG I+AAPWGSALILPISYTYIAMMGSQG+T+ASKIAILNANYMAKRL
Sbjct  804   TGGIPAPEESQPLGTIAAAPWGSALILPISYTYIAMMGSQGITNASKIAILNANYMAKRL  863

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  864   ENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  923

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  D NNNV+K APHPP LLMAD WTKPY
Sbjct  924   IEPTESESKAELDRFCDALISIRQEIAEIEKGNVDFNNNVIKGAPHPPQLLMADKWTKPY  983

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P  Q  E++A A+A
Sbjct  984   SREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP-PQEYEEKAEATA  1034



>emb|CDX68930.1| BnaC01g05230D [Brassica napus]
Length=1045

 Score =   503 bits (1296),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 251/292 (86%), Positives = 268/292 (92%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  756   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K++PLG I+AAPWGSALILPISY+YIAMMGS GLT+ASKIAILNANYMAKRL
Sbjct  816   TGGFPQPEKTEPLGPIAAAPWGSALILPISYSYIAMMGSGGLTEASKIAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKH+PVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH PTMS+PV GTLM
Sbjct  876   EKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHAPTMSFPVSGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ NNVLK APH P++LM+D W KPY
Sbjct  936   IEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQNNVLKGAPHSPAMLMSDTWKKPY  995

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  996   SREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1045



>ref|XP_007136824.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
 gb|ESW08818.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
Length=1018

 Score =   502 bits (1293),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 247/279 (89%), Positives = 264/279 (95%), Gaps = 0/279 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  739   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  798

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDK+QP+G ISAAPWGSALILPISY+YIAMMGS+GLT+ASK AIL ANYMAKRL
Sbjct  799   TGGIPAPDKTQPVGTISAAPWGSALILPISYSYIAMMGSKGLTEASKTAILKANYMAKRL  858

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRG NGTVAHEFIIDLRGFKN+ GIE EDVAKRL+DYGFHGPTMS+PVPGTLM
Sbjct  859   ETHYPVLFRGANGTVAHEFIIDLRGFKNSTGIEPEDVAKRLIDYGFHGPTMSFPVPGTLM  918

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IE GK DINNNVLK APHPPSLLM DAWTKPY
Sbjct  919   IEPTESESKAELDRFCDALISIRQEIAEIENGKADINNNVLKGAPHPPSLLMGDAWTKPY  978

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
             SREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTL P
Sbjct  979   SREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLPP  1017



>ref|XP_010432628.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Camelina sativa]
Length=1045

 Score =   503 bits (1294),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 250/292 (86%), Positives = 267/292 (91%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  756   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIS  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ ++P+G I+AAPWGSALILPISY+YIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  816   TGGIPQPENTEPMGTIAAAPWGSALILPISYSYIAMMGSGGLTDASKIAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRG NGTVAHEFIIDLRGFKNTAG+EAEDVAKRLMDYGFH PTMS+PV GTLM
Sbjct  876   EKHYPVLFRGANGTVAHEFIIDLRGFKNTAGLEAEDVAKRLMDYGFHAPTMSFPVSGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHPPS+LM+D W KPY
Sbjct  936   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPPSMLMSDTWKKPY  995

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWP+T RVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  996   SREYAAFPAPWLRSAKFWPSTSRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1045



>emb|CAA81076.1| P protein [Flaveria pringlei]
Length=1037

 Score =   502 bits (1292),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/292 (86%), Positives = 270/292 (92%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVV 
Sbjct  747   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVA  806

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P++SQPLG I+AAPWGSALILPISYTYIAMMGSQG+T+ASKIAILNANYMAKRL
Sbjct  807   TGGIPAPEQSQPLGTIAAAPWGSALILPISYTYIAMMGSQGITNASKIAILNANYMAKRL  866

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  867   ENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  926

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  D+NNNV+K APHPP LLMAD WTKPY
Sbjct  927   IEPTESESKAELDRFCDALISIRQEIAEIEKGNVDLNNNVIKGAPHPPQLLMADKWTKPY  986

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P  Q  E++A A+A
Sbjct  987   SREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP-PQEYEEKAEATA  1037



>sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) A, mitochondrial; 
AltName: Full=Glycine cleavage system P protein A; 
AltName: Full=Glycine decarboxylase A; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) A; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei]
Length=1037

 Score =   502 bits (1292),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/292 (86%), Positives = 270/292 (92%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPVV 
Sbjct  747   GANMNAQVGLTSPGWIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVVA  806

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P++SQPLG I+AAPWGSALILPISYTYIAMMGSQG+T+ASKIAILNANYMAKRL
Sbjct  807   TGGIPAPEQSQPLGTIAAAPWGSALILPISYTYIAMMGSQGITNASKIAILNANYMAKRL  866

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DYGFHGPTMSWPVPGTLM
Sbjct  867   ENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDYGFHGPTMSWPVPGTLM  926

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR+EIA+IEKG  D+NNNV+K APHPP LLMAD WTKPY
Sbjct  927   IEPTESESKAELDRFCDALISIRQEIAEIEKGNVDLNNNVIKGAPHPPQLLMADKWTKPY  986

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P  Q  E++A A+A
Sbjct  987   SREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP-PQEYEEKAEATA  1037



>ref|XP_009401914.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1033

 Score =   501 bits (1290),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/283 (88%), Positives = 260/283 (92%), Gaps = 0/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  742   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVA  801

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ +QPLG ISAAPWGSALIL ISYTYIAMMGS+GLT+ASK AILNANYMAKRL
Sbjct  802   TGGIPPPENAQPLGTISAAPWGSALILTISYTYIAMMGSKGLTNASKTAILNANYMAKRL  861

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+LFRGVNGTVAHEFI+DLRGFK TAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  862   ENYYPILFRGVNGTVAHEFIVDLRGFKATAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  921

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI QIE GK DINNNVLK APHP S+LM D+W KPY
Sbjct  922   IEPTESESKAELDRFCDALISIREEITQIESGKADINNNVLKGAPHPLSMLMGDSWNKPY  981

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             SRE AAFP  WL+ AKFWPT GR+DNVYGDRNLICTL PVSQM
Sbjct  982   SRECAAFPVSWLRDAKFWPTAGRIDNVYGDRNLICTLPPVSQM  1024



>ref|XP_010437818.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Camelina sativa]
Length=1040

 Score =   501 bits (1290),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 249/292 (85%), Positives = 266/292 (91%), Gaps = 2/292 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  751   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIS  810

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ ++P+G I+AAPWGSALILPISY+YIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  811   TGGIPQPENTEPMGTIAAAPWGSALILPISYSYIAMMGSGGLTDASKIAILNANYMAKRL  870

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRG NGTVAHEFIIDLRGFKNTAG+EAEDVAKRLMDYGFH PTMS+PV GTLM
Sbjct  871   EKHYPVLFRGANGTVAHEFIIDLRGFKNTAGLEAEDVAKRLMDYGFHAPTMSFPVSGTLM  930

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D+ NNVLK APHPP LLM+D W KPY
Sbjct  931   IEPTESESKAELDRFCDALISIREEISQIEKGNADVQNNVLKGAPHPPQLLMSDTWKKPY  990

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL++AKFWP+T RVDNVYGDR L+CTLLP  + V   AA SA
Sbjct  991   SREYAAFPAPWLRSAKFWPSTSRVDNVYGDRKLVCTLLPEEEQV--AAAVSA  1040



>ref|XP_010417387.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1041

 Score =   499 bits (1286),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 269/291 (92%), Gaps = 3/291 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  751   GANLNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  810

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ + PLG I+AAPWGSALILPISY+YIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  811   TGGIPEPEHTSPLGTIAAAPWGSALILPISYSYIAMMGSGGLTDASKIAILNANYMAKRL  870

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  871   ESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHAPTMSFPVPGTLM  930

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNVLK APHP S LMAD W KPY
Sbjct  931   IEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGAPHPLSSLMADTWKKPY  990

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL P +   E++AAA+
Sbjct  991   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQPAN---EEQAAAA  1038



>ref|XP_010429623.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial 
[Camelina sativa]
Length=1044

 Score =   499 bits (1285),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 269/291 (92%), Gaps = 3/291 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  754   GANLNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  813

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ + P+G I+AAPWGSALILPISY+YIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  814   TGGIPEPEHTSPMGTIAAAPWGSALILPISYSYIAMMGSGGLTDASKIAILNANYMAKRL  873

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  874   ESHYPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHAPTMSFPVPGTLM  933

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNVLK APHP S LMADAW KPY
Sbjct  934   IEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGAPHPLSSLMADAWKKPY  993

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL P +   E++AAA+
Sbjct  994   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQPAN---EEQAAAA  1041



>ref|XP_006283054.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
 gb|EOA15952.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
Length=1038

 Score =   499 bits (1284),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 250/292 (86%), Positives = 263/292 (90%), Gaps = 5/292 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+ 
Sbjct  749   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIS  808

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K++PLG I+AAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  809   TGGFPQPEKTEPLGTIAAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRG NGTVAHEFIIDLR FKNTAGIEAEDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  869   EKHYPVLFRGANGTVAHEFIIDLRAFKNTAGIEAEDVAKRLMDYGFHAPTMSWPVPGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK APHP S+LMAD W KPY
Sbjct  929   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGAPHPQSVLMADTWNKPY  988

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SREYAAFPA WL+++KFWP T RVDNVYGDR L+ TLL      E+E  A+A
Sbjct  989   SREYAAFPAPWLRSSKFWPITSRVDNVYGDRKLVSTLL-----AEEEQVAAA  1035



>ref|XP_010472637.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1046

 Score =   498 bits (1282),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 268/291 (92%), Gaps = 3/291 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  756   GANLNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+ + PLG I+AAPWGSALILPISY+YIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  816   TGGIPEPEHTSPLGTIAAAPWGSALILPISYSYIAMMGSGGLTDASKIAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  876   ESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHAPTMSFPVPGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNVLK APHP S LMAD W KPY
Sbjct  936   IEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGAPHPLSSLMADTWKKPY  995

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL P +   E++ AA+
Sbjct  996   SREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQPAN---EEQVAAA  1043



>ref|XP_006296473.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
 gb|EOA29371.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
Length=1040

 Score =   491 bits (1265),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/277 (87%), Positives = 258/277 (93%), Gaps = 0/277 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLPSHPV+P
Sbjct  750   GANLNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPSHPVIP  809

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+++ PLG I+AAPWGSALILPISY+YIAMMGS GLT ASKIAILNANYMAKRL
Sbjct  810   TGGIPEPEQTSPLGTIAAAPWGSALILPISYSYIAMMGSGGLTAASKIAILNANYMAKRL  869

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVL+RGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  870   ESHYPVLYRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHSPTMSFPVPGTLM  929

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNVLK APHP SLLM+D W KPY
Sbjct  930   IEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGAPHPLSLLMSDTWKKPY  989

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  222
             SREYAAFP  WL+ +KFWP TGRVDNVYGDRNL+CTL
Sbjct  990   SREYAAFPTPWLRASKFWPVTGRVDNVYGDRNLVCTL  1026



>gb|KJB54688.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1053

 Score =   491 bits (1264),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 246/268 (92%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  759   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  818

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PDKS PLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  819   TGGIPAPDKSHPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  878

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  879   ENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  938

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNVLK APHPPSLLM DAWTKPY
Sbjct  939   IEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDAWTKPY  998

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVY  249
             +REYAAFPA WL+TAKFWPTTG V  +Y
Sbjct  999   TREYAAFPASWLRTAKFWPTTGDVLTMY  1026



>gb|ACN39938.1| unknown [Picea sitchensis]
Length=780

 Score =   482 bits (1241),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 241/292 (83%), Positives = 263/292 (90%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP
Sbjct  487   GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVP  546

Query  872   TGGIPSP-DKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
             TGGIP+P DK QPLG ISAAPWGSALILPISY YIAMMGSQGLT+ASK+AILNANYMAKR
Sbjct  547   TGGIPAPEDKLQPLGTISAAPWGSALILPISYAYIAMMGSQGLTEASKLAILNANYMAKR  606

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LE +YPVLFRG NGT AHEFIIDLR FK +AGIE EDVAKRLMDYGFH PTMSWPVPGTL
Sbjct  607   LEDYYPVLFRGENGTCAHEFIIDLRHFKVSAGIEPEDVAKRLMDYGFHAPTMSWPVPGTL  666

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESESKAELDRFC+ LISIR+EI  IE GK D ++NVLK APHP S++MAD W +P
Sbjct  667   MIEPTESESKAELDRFCNALISIRKEIMAIETGKMDSHHNVLKGAPHPASVVMADEWNRP  726

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             YSRE AAFPA W++ +KFWP+TGRVDNVYGDRNL+CTLL    +VE++A A+
Sbjct  727   YSREVAAFPASWVRASKFWPSTGRVDNVYGDRNLVCTLLQAGDVVEEQAVAA  778



>gb|KDO80089.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1050

 Score =   476 bits (1225),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/262 (90%), Positives = 248/262 (95%), Gaps = 0/262 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  767   GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  826

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KSQPLG I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  827   TGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  886

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  887   EKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  946

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNVLK APHPPSLLM D WTKPY
Sbjct  947   IEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGAPHPPSLLMGDTWTKPY  1006

Query  332   SREYAAFPAQWLKTAKFWPTTG  267
             SREYAA+PA WL+ AKFWP TG
Sbjct  1007  SREYAAYPASWLRFAKFWPATG  1028



>ref|XP_001755004.1| predicted protein [Physcomitrella patens]
 gb|EDQ80458.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   470 bits (1210),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 237/292 (81%), Positives = 260/292 (89%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  656   GANMNAQVGLTSPGHIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVG  715

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P  +QPLG ISAAP+GSALILPISY+YIAMMG++GLTDASK+AILNANYMAKRL
Sbjct  716   TGGFPRPANTQPLGPISAAPYGSALILPISYSYIAMMGNKGLTDASKLAILNANYMAKRL  775

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGT AHEFIIDLR FK TAGIEAEDVAKRLMDYG+H PTMSWPV GTLM
Sbjct  776   ENHYPVLFRGVNGTCAHEFIIDLRKFKETAGIEAEDVAKRLMDYGYHAPTMSWPVSGTLM  835

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA IE G+    +NVLK APHP S++MAD WTK Y
Sbjct  836   IEPTESESKAELDRFCDALISIREEIAAIENGEASREDNVLKGAPHPASVVMADDWTKSY  895

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT  P +++++++ AA+A
Sbjct  896   SREVAAFPASWVRASKFWPTTSRVDNVYGDRNLMCT-NPSAEVIDEKIAAAA  946



>ref|XP_001754864.1| predicted protein [Physcomitrella patens]
 gb|EDQ80318.1| predicted protein [Physcomitrella patens]
Length=1038

 Score =   471 bits (1213),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 237/292 (81%), Positives = 260/292 (89%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  748   GANMNAQVGLTSPGHIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVG  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P  +QPLG ISAAP+GSALILPISY+YIAMMG++GLTDASK+AILNANYMAKRL
Sbjct  808   TGGFPRPANTQPLGPISAAPYGSALILPISYSYIAMMGNKGLTDASKLAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLFRGVNGT AHEFIIDLR FK TAGIEAEDVAKRLMDYG+H PTMSWPV GTLM
Sbjct  868   ENHYPVLFRGVNGTCAHEFIIDLRKFKETAGIEAEDVAKRLMDYGYHAPTMSWPVSGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIREEIA IE G+    +NVLK APHP S++MAD WTK Y
Sbjct  928   IEPTESESKAELDRFCDALISIREEIAAIENGEASREDNVLKGAPHPASVVMADDWTKSY  987

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT  P +++++++ AA+A
Sbjct  988   SREVAAFPASWVRASKFWPTTSRVDNVYGDRNLMCT-NPSAEVIDEKIAAAA  1038



>ref|XP_001780310.1| predicted protein [Physcomitrella patens]
 gb|EDQ54869.1| predicted protein [Physcomitrella patens]
Length=995

 Score =   468 bits (1205),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 236/292 (81%), Positives = 259/292 (89%), Gaps = 1/292 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  705   GANMNAQVGLTSPGHIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVG  764

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P  +QPLG ISAAP+GSALILPISY YIAMMG++GLTDASK+AILNANYMAKRL
Sbjct  765   TGGFPRPANTQPLGPISAAPYGSALILPISYIYIAMMGNKGLTDASKLAILNANYMAKRL  824

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+LFRGVNGT AHEFIIDLR FK+TAGIEAEDVAKRLMDYG+H PTMSWPV GTLM
Sbjct  825   ENHYPILFRGVNGTCAHEFIIDLRKFKDTAGIEAEDVAKRLMDYGYHAPTMSWPVSGTLM  884

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LISIR EIA IE G+    +NVLK +PHP S++MAD WTK Y
Sbjct  885   IEPTESESKAELDRFCDALISIRGEIAAIENGEASREDNVLKGSPHPASVVMADNWTKSY  944

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT  P +++VE++ AA+A
Sbjct  945   SREVAAFPASWVRASKFWPTTSRVDNVYGDRNLVCT-NPPAELVEEKIAAAA  995



>ref|XP_002979861.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
 gb|EFJ19263.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
Length=946

 Score =   454 bits (1169),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 228/293 (78%), Positives = 253/293 (86%), Gaps = 1/293 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHL PFLPSHPVV 
Sbjct  654   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLTPFLPSHPVVS  713

Query  872   TGGIP-SPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
             TGGIP S +K+QPLG ISAAPWGSALILPISYTYIAMMGS+GLT ASK+AILNANYMAKR
Sbjct  714   TGGIPPSSEKAQPLGTISAAPWGSALILPISYTYIAMMGSEGLTSASKLAILNANYMAKR  773

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LE HY +LFRG NGT AHEFI+DLR FK TA IE EDVAKRL+DYGFH PTMSWPV GTL
Sbjct  774   LENHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVAKRLIDYGFHAPTMSWPVHGTL  833

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESESKAELDRFCD +ISIREEI  IE G  +  +NVLK APH  S++++D W KP
Sbjct  834   MIEPTESESKAELDRFCDAMISIREEIRAIENGTCNAADNVLKGAPHSASMVLSDKWNKP  893

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             YSR+ AA+PA W++++KFWP+TGRVDNVYGDRNL+CTL+       +E  A+A
Sbjct  894   YSRKLAAYPATWVESSKFWPSTGRVDNVYGDRNLVCTLINGDATPAEERVATA  946



>ref|XP_002988429.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
 gb|EFJ10519.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
Length=946

 Score =   454 bits (1168),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 228/293 (78%), Positives = 253/293 (86%), Gaps = 1/293 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHL PFLPSHPVV 
Sbjct  654   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLTPFLPSHPVVS  713

Query  872   TGGIP-SPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
             TGGIP S +K+QPLG ISAAPWGSALILPISYTYIAMMGS+GLT ASK+AILNANYMAKR
Sbjct  714   TGGIPPSSEKAQPLGTISAAPWGSALILPISYTYIAMMGSEGLTSASKLAILNANYMAKR  773

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LE HY +LFRG NGT AHEFI+DLR FK TA IE EDVAKRL+DYGFH PTMSWPV GTL
Sbjct  774   LEDHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVAKRLIDYGFHAPTMSWPVHGTL  833

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESESKAELDRFCD +ISIREEI  IE G  +  +NVLK APH  S++++D W KP
Sbjct  834   MIEPTESESKAELDRFCDAMISIREEIRAIENGTCNAADNVLKGAPHSASMVLSDKWNKP  893

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             YSR+ AA+PA W++++KFWP+TGRVDNVYGDRNL+CTL+       +E  A+A
Sbjct  894   YSRKLAAYPATWVESSKFWPSTGRVDNVYGDRNLVCTLINGDAAPAEERVATA  946



>gb|AFW56071.1| glycine cleavage complex P-protein [Zea mays]
Length=1097

 Score =   438 bits (1127),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 237/338 (70%), Positives = 252/338 (75%), Gaps = 55/338 (16%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPV+P
Sbjct  749   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVIP  808

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG P P+K+ PLG ISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL
Sbjct  809   TGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLR FK TAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  869   EKHYPVLFRGVNGTVAHEFIIDLRAFKTTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLK------------------  387
             IEPTESESKAELDRFCD LISIREEIA+IE GK D+ NNVLK                  
Sbjct  929   IEPTESESKAELDRFCDALISIREEIAEIESGKADVLNNVLKVINISLTAKSMCVLARYV  988

Query  386   ----------NAPHPPSLLMADAWTKPYSREYAAF-------------------------  312
                       +   P + L    + + ++  +A F                         
Sbjct  989   LHSDTGDGSAHKQEPRTSLGLHVYRERFTGVFALFVQGAPHPPQLLMGDTWSKPYSREYA  1048

Query  311   --PAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
               PA WL+ AKFWPTTGRVDNVYGDRNLICTL   +Q+
Sbjct  1049  AFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQATQV  1086



>ref|XP_001692993.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
 gb|EDP03562.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
Length=1039

 Score =   425 bits (1093),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 214/275 (78%), Positives = 237/275 (86%), Gaps = 1/275 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLT+PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLP+HPVVP
Sbjct  749   GANMNAQVGLTAPGLIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPTHPVVP  808

Query  872   TGGIPS-PDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
             TG +PS P   +P G ++AAP+GS+LILPISY YI+MMGS GLT ASK+AIL ANYMAKR
Sbjct  809   TGALPSRPADPKPFGTMAAAPFGSSLILPISYAYISMMGSAGLTMASKLAILKANYMAKR  868

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             L  HYPVLF G NGT AHEFI+DLR  K TAGIEAEDVAKRLMDYGFH PTMSWPVPGTL
Sbjct  869   LAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVAKRLMDYGFHAPTMSWPVPGTL  928

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESESK ELDRFC+ +ISIREEI +IE GK D  NN+LK+APH P +++AD W +P
Sbjct  929   MIEPTESESKEELDRFCEAMISIREEIREIESGKADKANNILKHAPHAPGVVLADKWERP  988

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLI  231
             YSRE AAFPA W++ AKFWPT  RVDNVYGDR+LI
Sbjct  989   YSRERAAFPAPWVRQAKFWPTVSRVDNVYGDRHLI  1023



>gb|EPS69441.1| glycine dehydrogenase [decarboxylating], mitochondrial, partial 
[Genlisea aurea]
Length=564

 Score =   405 bits (1042),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 208/222 (94%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  343   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVA  402

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+PD+SQPLG ISAAPWGSALILPISYTYIAMMGS+GLTDASKIAILNANYMAKRL
Sbjct  403   TGGIPAPDQSQPLGTISAAPWGSALILPISYTYIAMMGSKGLTDASKIAILNANYMAKRL  462

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKH+PVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  463   EKHFPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  522

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLK  387
             IEPTESESKAELDRFCD LISIREEI+ IE GK D NNNVLK
Sbjct  523   IEPTESESKAELDRFCDALISIREEISLIENGKADFNNNVLK  564



>ref|XP_002956892.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
 gb|EFJ42017.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
Length=978

 Score =   417 bits (1072),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 209/275 (76%), Positives = 236/275 (86%), Gaps = 1/275 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLT+PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAP+LP+HPV+P
Sbjct  688   GANMNAQVGLTAPGIIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPYLPTHPVIP  747

Query  872   TGGIP-SPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
             TG +P  P   QP G ++AAP+GS+LILPIS+ YI+MMGS GLT ASK+AIL ANYMAKR
Sbjct  748   TGALPVRPAAPQPFGTMAAAPYGSSLILPISFAYISMMGSGGLTMASKLAILKANYMAKR  807

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             L  HYPVLF G NGT AHEFI+DLR  K TAGIEAEDVAKRLMDYGFH PTMSWPVPGTL
Sbjct  808   LAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVAKRLMDYGFHAPTMSWPVPGTL  867

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESESK ELDRFC+ +ISIREEI +IE+G+ D  NNVLK+APH PS+++ D W +P
Sbjct  868   MIEPTESESKDELDRFCEAMISIREEIREIEQGRADRENNVLKHAPHAPSVVLVDTWDRP  927

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLI  231
             Y+RE AA+PA W+  AKFWPT  RVDNVYGDRNL+
Sbjct  928   YTRERAAYPAPWVWQAKFWPTVSRVDNVYGDRNLV  962



>ref|XP_008347531.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase (decarboxylating), 
mitochondrial-like [Malus domestica]
Length=235

 Score =   386 bits (991),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 188/224 (84%), Positives = 201/224 (90%), Gaps = 2/224 (1%)
 Frame = -2

Query  881  VVPTGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKI--AILNANY  708
            +V TGG P+  KSQPL  ISAAPW SALILPISYTYIAMMGS+GLTDASKI  AILNAN 
Sbjct  1    MVSTGGPPALHKSQPLETISAAPWXSALILPISYTYIAMMGSKGLTDASKIIIAILNANC  60

Query  707  MAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPV  528
            MAKRLE +YP+LF GVNGTVAHEFI+DL+GFKNTAGIE EDV KRLMDYGFHGPTMSWPV
Sbjct  61   MAKRLENYYPILFXGVNGTVAHEFIVDLKGFKNTAGIEPEDVPKRLMDYGFHGPTMSWPV  120

Query  527  PGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADA  348
            PGT MI+PTESESKAELDRFCD LISIREEIA I+KGK DI NNVLK APHPPSLL+ DA
Sbjct  121  PGTRMIDPTESESKAELDRFCDALISIREEIALIQKGKADILNNVLKGAPHPPSLLIGDA  180

Query  347  WTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  216
            WTKPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICTL P
Sbjct  181  WTKPYSREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICTLQP  224



>ref|NP_001119106.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 gb|AEE86160.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=976

 Score =   409 bits (1052),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 211/227 (93%), Positives = 216/227 (95%), Gaps = 1/227 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPV+P
Sbjct  748   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKNHLAPFLPSHPVIP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP P+K+ PLGAISAAPWGSALILPISYTYIAMMGS GLTDASKIAILNANYMAKRL
Sbjct  808   TGGIPQPEKTAPLGAISAAPWGSALILPISYTYIAMMGSGGLTDASKIAILNANYMAKRL  867

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  868   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  927

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLK-NAPH  375
             IEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNVLK + PH
Sbjct  928   IEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKLHIPH  974



>ref|XP_011398598.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25702.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
Length=1211

 Score =   413 bits (1061),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 208/278 (75%), Positives = 238/278 (86%), Gaps = 1/278 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLT+PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPS+PVVP
Sbjct  916   GANMNAQVGLTAPGLIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSNPVVP  975

Query  872   TGGIPS-PDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
             TG +P+     Q  GAISAAP+GSALILPISY YI +MG + L +ASK+AILNANYMAKR
Sbjct  976   TGALPNFKSDEQACGAISAAPFGSALILPISYAYITLMGGKALANASKLAILNANYMAKR  1035

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LEKHY VLF G NGT AHEFI+D+R   +++GIEAED+AKRL+DYGFHGPTMSWPV GTL
Sbjct  1036  LEKHYNVLFHGPNGTCAHEFILDIRPLTSSSGIEAEDIAKRLIDYGFHGPTMSWPVSGTL  1095

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESESKAELDRF + +I IREEIA+IE GK D  NNVLK+APHP  ++MAD W +P
Sbjct  1096  MIEPTESESKAELDRFVEAMIGIREEIAEIESGKADRANNVLKHAPHPAHVVMADEWDRP  1155

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  222
             YSR+ AA+PA W++ +KFWPTT RVDNVYGDRNL+  +
Sbjct  1156  YSRDKAAYPAPWVRQSKFWPTTCRVDNVYGDRNLVVRM  1193



>ref|XP_003055654.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
 gb|EEH60906.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
Length=1045

 Score =   405 bits (1040),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 231/288 (80%), Gaps = 0/288 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKK L PF+P+HP   
Sbjct  758   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKQLMPFMPNHPSAE  817

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G        P G +SAAP+GSALILPIS+ YIAMMGS+GLT+ASK AILNANYMAKRL
Sbjct  818   LDGAIVAGGETPFGVVSAAPYGSALILPISFGYIAMMGSKGLTNASKRAILNANYMAKRL  877

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLF+G NGT AHEFI+DLR   +++G+  EDVAKRLMDYG+H PTMSWPV GTLM
Sbjct  878   EDHYPVLFKGKNGTCAHEFILDLRPLGDSSGVVVEDVAKRLMDYGYHSPTMSWPVSGTLM  937

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFC+ +I+IREEI  IE G  D  NN LK+APH  S++M D W +PY
Sbjct  938   IEPTESESKAELDRFCNAMIAIREEIRDIENGAMDRENNPLKHAPHTASVVMGDEWDRPY  997

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SRE AAFPA W++ +KFWPT  RVDNVYGDRNL+ T   V    E+ A
Sbjct  998   SRETAAFPAPWVRASKFWPTNSRVDNVYGDRNLVTTHASVEVSAEETA  1045



>gb|KDO80090.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1049

 Score =   403 bits (1035),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 204/222 (92%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVV 
Sbjct  767   GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPVVS  826

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGGIP+P+KSQPLG I+AAPWGSALILPISYTYIAMMGS+GLT+ASKIAILNANYMAKRL
Sbjct  827   TGGIPAPEKSQPLGTIAAAPWGSALILPISYTYIAMMGSKGLTEASKIAILNANYMAKRL  886

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLM
Sbjct  887   EKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLM  946

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLK  387
             IEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNVLK
Sbjct  947   IEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLK  988



>ref|WP_010472943.1| glycine dehydrogenase [Acaryochloris sp. CCMEE 5410]
Length=984

 Score =   400 bits (1028),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 235/285 (82%), Gaps = 6/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HLAPF+P HPV+ 
Sbjct  705   GANLNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLAPFIPQHPVIS  764

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG         +GA++AAPWGSA ILPIS+ YIA+MG++GLT A+K+AILNANY+AKRL
Sbjct  765   MGG------EAGIGAVAAAPWGSASILPISWVYIALMGARGLTQATKVAILNANYIAKRL  818

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G +G VAHE I+DLRG K TAGIE ED+AKRLMDYG+H PT+SWPVPGT+M
Sbjct  819   EAYYPVLYKGKSGLVAHECILDLRGVKKTAGIEVEDIAKRLMDYGYHAPTVSWPVPGTIM  878

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFC+ +I+IR EIA+IE G+ D  NNVLKNAPHP  +++AD+W +PY
Sbjct  879   IEPTESESKAELDRFCEAMIAIRAEIAEIEAGQADAQNNVLKNAPHPADVVIADSWDRPY  938

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE AA+PA W + +KFWP   R++N YGDRNL+C+  P+S   E
Sbjct  939   SREKAAYPAPWTRESKFWPAVSRINNAYGDRNLVCSCAPLSDYAE  983



>ref|XP_002503477.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
 gb|ACO64735.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
Length=988

 Score =   397 bits (1021),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 228/288 (79%), Gaps = 0/288 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLT+PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPF+P HP   
Sbjct  701   GANMNAQVGLTAPGIIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFMPDHPSAE  760

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G        P G +SAAP+GSALILPIS+ YI+MMGS+GLT+ASK AILNANYM KRL
Sbjct  761   LDGATPAGGETPFGVVSAAPYGSALILPISFAYISMMGSEGLTNASKRAILNANYMKKRL  820

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E H+P+LF G NGT AHEFIIDLR   +  GI  EDVAKRL DYG+H PTMSWPV GTLM
Sbjct  821   EDHFPILFTGKNGTCAHEFIIDLRPMTDKTGIGPEDVAKRLQDYGYHAPTMSWPVSGTLM  880

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFC+ +I+IREEI  IE G  D  NN LK+APH  +++++D W +PY
Sbjct  881   IEPTESESKQELDRFCNAMIAIREEIRDIENGAIDKENNPLKHAPHTAAVVLSDKWDRPY  940

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SRE AAFPA+W++ +KFWPTT R+DNVYGDRNL+ T   V    E+ A
Sbjct  941   SRETAAFPAEWVRQSKFWPTTSRIDNVYGDRNLVTTHAQVEVAAEETA  988



>ref|WP_012166094.1| glycine dehydrogenase [Acaryochloris marina]
 gb|ABW30892.1| glycine dehydrogenase [Acaryochloris marina MBIC11017]
Length=984

 Score =   396 bits (1017),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 233/285 (82%), Gaps = 6/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HLAPF+P HPVV 
Sbjct  705   GANLNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLAPFIPQHPVVS  764

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG         +GA++AAPWGSA ILPIS+ YIA+MG++GLT A+K+AILNANY+AKRL
Sbjct  765   MGG------EAGIGAVAAAPWGSASILPISWVYIALMGAKGLTQATKVAILNANYIAKRL  818

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G +G VAHE I+DLRG K TA IE ED+AKRLMDYG+H PT+SWPVPGT+M
Sbjct  819   EAYYPVLYKGKSGLVAHECILDLRGVKKTAEIEVEDIAKRLMDYGYHAPTVSWPVPGTIM  878

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFC+ +I+IR EIA+IE G+ D  NNVLKNAPHP  +++AD+W +PY
Sbjct  879   IEPTESESKAELDRFCEAMIAIRAEIAEIEAGQADAQNNVLKNAPHPADVVIADSWDRPY  938

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE AA+PA W +  KFWP   R++N YGDRNL+C+  P+S   E
Sbjct  939   SREKAAYPAPWTREFKFWPAVSRINNAYGDRNLVCSCAPLSDYAE  983



>ref|WP_018342886.1| glycine dehydrogenase [Cytophaga aurantiaca]
Length=966

 Score =   395 bits (1015),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/289 (69%), Positives = 231/289 (80%), Gaps = 6/289 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPG+GPIGV  HL PFLP H VV 
Sbjct  683   GANMNAQVGLTSPGSIGADVCHLNLHKTFCIPHGGGGPGVGPIGVAAHLKPFLPGHAVVK  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      ++ + A+SAAPWGSA ILPISY YIAMMGS+GLT+A+K AILNANY+  RL
Sbjct  743   TGG------AKAIHAVSAAPWGSASILPISYAYIAMMGSEGLTNATKNAILNANYIKARL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYP+L+ G NG  AHEFI+D R FK T GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  797   EKHYPILYTGTNGHCAHEFILDCRAFKTTIGIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESES  ELDRFCD +ISIR EIA+IE GK D  +NVLK+APH  S++ ADAWT+ Y
Sbjct  857   IEPTESESMHELDRFCDAMISIRAEIAEIENGKADKLDNVLKHAPHTASVITADAWTRSY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAA  186
             SR+ AA+P  +LKT KFWP+  R+D+ YGDRNL C+ +P  +  E E A
Sbjct  917   SRQKAAYPLPYLKTTKFWPSVSRIDSAYGDRNLFCSCIPTEEFAEAEMA  965



>ref|XP_001420206.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98499.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=976

 Score =   392 bits (1007),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 227/288 (79%), Gaps = 1/288 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPF+P HP + 
Sbjct  690   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFMPDHPSMK  749

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G + +    +P G ++AAP+GSALILPIS++YIAMMGS+GL +ASK AILNANYM+KRL
Sbjct  750   DGAV-AVGGDKPFGVVAAAPYGSALILPISFSYIAMMGSEGLANASKRAILNANYMSKRL  808

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLF G N T AHEFI+D+R  K+  G+E  D+AKRLMDYGFH PTMSWPV GTLM
Sbjct  809   EDYYPVLFSGKNDTCAHEFILDMRPIKDATGVEVADIAKRLMDYGFHSPTMSWPVAGTLM  868

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LI+IR EI  IE GK D  NNVLKNAPH   ++ A  W +PY
Sbjct  869   IEPTESESKAELDRFCDALIAIRGEIRDIEDGKVDRENNVLKNAPHTAEVVTAKEWNRPY  928

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
              R+  AFP +W ++ KFWP T R+D+VYGDRNL+ +   V   V   A
Sbjct  929   PRDLGAFPVEWTRSHKFWPQTSRIDDVYGDRNLVASRAAVEVAVAQTA  976



>emb|CEF99477.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
1 [Ostreococcus tauri]
Length=1019

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 225/288 (78%), Gaps = 1/288 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPF+P HP + 
Sbjct  733   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFMPDHPTMK  792

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G I +    +P G +SAAP+GSALILPISY YI+MMGS+GLT+ASK AILNANYM+KRL
Sbjct  793   DGAI-AVGGDKPFGTVSAAPYGSALILPISYAYISMMGSEGLTNASKRAILNANYMSKRL  851

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVLF G N T AHEFI+D+R  K+  G+E  D+AKRLMDYGFH PTMSWPV GTLM
Sbjct  852   EDYYPVLFTGKNNTCAHEFILDMRPIKDATGVEVADIAKRLMDYGFHSPTMSWPVAGTLM  911

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LI+IR EI  IE+GK    NN+LK+APH  S +    W +PY
Sbjct  912   IEPTESESKAELDRFCDALIAIRGEIRDIEEGKMSKENNMLKHAPHTASAVTGKEWDRPY  971

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
              R+  AFPA W +  KFWP T R+D+VYGDRNL+ +   V   V   A
Sbjct  972   PRDLGAFPAPWTRAHKFWPQTSRIDDVYGDRNLVASRAAVEVAVAQTA  1019



>ref|WP_028981454.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   387 bits (994),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/287 (68%), Positives = 226/287 (79%), Gaps = 6/287 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSP  IGADVCHLNLHKTFCIPHGGGGPG+GPIGV  HL PFLP +PVV 
Sbjct  681   GANMNAQVGLTSPANIGADVCHLNLHKTFCIPHGGGGPGVGPIGVAAHLKPFLPGNPVVK  740

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       + + A+SAAPWGSA ILPISY YIAMMG++GL  +++ AILNANY+  RL
Sbjct  741   TGG------EKAIHAVSAAPWGSASILPISYAYIAMMGAEGLKSSTQHAILNANYIKARL  794

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EK +P+L+    G  AHEFI+D R FK+T G+E ED+AKRLMDYGFH PT+S+PVPGTLM
Sbjct  795   EKFFPILYTNTKGRCAHEFILDCREFKHTVGVEVEDIAKRLMDYGFHAPTVSFPVPGTLM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFC+ +I IREEI +IE GK D  NNVLK+APH   ++MAD WT+PY
Sbjct  855   IEPTESESKEELDRFCEAMIQIREEIREIENGKADKANNVLKHAPHTAEVIMADNWTRPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             SRE AAFP +W++  KFWP+  RVDN YGDRNL+CT LPV      E
Sbjct  915   SREKAAFPIEWIRLRKFWPSVSRVDNAYGDRNLVCTCLPVEDYASHE  961



>ref|WP_011584413.1| glycine dehydrogenase [Cytophaga hutchinsonii]
 gb|ABG58298.1| glycine dehydrogenase (decarboxylating) alpha subunit / glycine 
dehydrogenase (decarboxylating) beta subunit [Cytophaga hutchinsonii 
ATCC 33406]
Length=966

 Score =   387 bits (993),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/289 (68%), Positives = 228/289 (79%), Gaps = 6/289 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPG+GPIGV  HL PFLP H VV 
Sbjct  683   GANMNAQVGLTSPGSIGADVCHLNLHKTFCIPHGGGGPGVGPIGVAAHLTPFLPGHAVVK  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       + + A+SAAPWGSA ILPISY YIAMMGS+GLT+A+K AILNANY+  RL
Sbjct  743   AGG------EKAISAVSAAPWGSASILPISYAYIAMMGSEGLTNATKNAILNANYIKSRL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EK YP+L+ G +G  AHEFI+D R FK T GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  797   EKFYPILYTGTHGHCAHEFILDCRAFKTTIGIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFCD +I+IR EIA+IE G  D  +NVLK+APH  S++ ADAWT+ Y
Sbjct  857   IEPTESESKHELDRFCDAMIAIRAEIAEIENGTADKLDNVLKHAPHTASVITADAWTRSY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAA  186
             SR+ AA+P  +LKT KFWP+  R+D+ YGDRNL C+ +P  +  E E A
Sbjct  917   SRQKAAYPLPYLKTTKFWPSVSRIDSAYGDRNLFCSCIPTEEFAEAELA  965



>ref|WP_027846740.1| glycine dehydrogenase [Mastigocoleus testarum]
Length=977

 Score =   387 bits (994),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 223/280 (80%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL SPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP HPVV 
Sbjct  699   GANMNAQVGLCSPGNIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHPVVE  758

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       Q +GA+SAAPWGSA IL IS+ YIAMMG  GLT A+K+AILNANY+AK+L
Sbjct  759   MGG------EQGMGAVSAAPWGSASILVISWMYIAMMGGTGLTQATKVAILNANYIAKKL  812

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             ++HYPVL++G NG VAHE I+DLR  K +AGIE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  813   QEHYPVLYKGKNGLVAHECILDLRSLKKSAGIEIDDIAKRLMDYGFHAPTVSWPVAGTIM  872

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK E+DRFCD +I+IR+E+A+IE GK D  NNVLKNAPH    L+   W  PY
Sbjct  873   VEPTESESKQEIDRFCDAMIAIRQEVAEIEAGKVDTENNVLKNAPHTAESLIIGEWNHPY  932

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W K  KFWP+  R+D  +GDRN +C+ LP+
Sbjct  933   SREQAAYPAPWTKDNKFWPSVSRIDAAFGDRNFVCSCLPM  972



>ref|WP_016874717.1| glycine dehydrogenase [Chlorogloeopsis fritschii]
Length=987

 Score =   387 bits (993),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 231/293 (79%), Gaps = 13/293 (4%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV KHL PF+P +PV+ 
Sbjct  690   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAKHLVPFVPGNPVIG  749

Query  872   TGG---------IPSPDK----SQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASK  732
             TG          +P+P      +Q +GA+SAAPWGSA IL IS+ YIAMMG+ GLT+A+K
Sbjct  750   TGDWGLGTRKEEVPNPQSLIPSTQHIGAVSAAPWGSASILVISWMYIAMMGATGLTEATK  809

Query  731   IAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH  552
             +AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +AGIE +DVAKRLMDYGFH
Sbjct  810   VAILNANYIAKRLETYYPVLYKGKNGFVAHECILDLRSLKKSAGIEIDDVAKRLMDYGFH  869

Query  551   GPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHP  372
              PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK DI +NVLKNAPH 
Sbjct  870   APTVSWPVAGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKADIQDNVLKNAPHT  929

Query  371   PSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
                L+ D W  PYSR+ AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  930   AESLIVDEWNHPYSRQQAAYPASWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  982



>ref|WP_041036217.1| glycine dehydrogenase [Tolypothrix campylonemoides]
 gb|KIJ75906.1| glycine dehydrogenase [Tolypothrix campylonemoides VB511288]
Length=990

 Score =   386 bits (991),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 222/280 (79%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  714   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHAVVE  773

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       Q +GAI+AAPWGSA IL IS+ YIAMMG+ GLT+A+K+AILNANY+AKRL
Sbjct  774   IGG------EQNIGAIAAAPWGSASILVISWMYIAMMGADGLTEATKVAILNANYIAKRL  827

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  828   EPYYPVLYKGKNGLVAHECILDLRSLKKSASIEIDDVAKRLMDYGFHAPTVSWPVAGTIM  887

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NVLKNAPH    L+   W  PY
Sbjct  888   VEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQDNVLKNAPHTAQSLIVGEWNHPY  947

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W +  KFWP  GR+DN YGDRN +C+ LP+
Sbjct  948   SREQAAYPAPWTREHKFWPVVGRIDNAYGDRNFVCSCLPM  987



>ref|WP_040765024.1| glycine dehydrogenase, partial [Rhodopirellula maiorica]
Length=347

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 220/284 (77%), Gaps = 8/284 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV   LAPFLP HPV  
Sbjct  68    GANMNAQVGLTSPGKIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAPQLAPFLPEHPV--  125

Query  872   TGGIPSPDKSQP--LGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAK  699
                   PD +    +G +SAAP+GS  IL ISY YIA+MG+ GL  A+++AILNANYMAK
Sbjct  126   ----ERPDTAGEFAIGPVSAAPYGSPSILTISYVYIALMGASGLKKATQVAILNANYMAK  181

Query  698   RLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGT  519
             RL  HY +L+   +G VAHEFI+D R F+ +AG++ ED+AKRLMDYGFHGPTMSWPVPGT
Sbjct  182   RLSDHYDILYTDSDGFVAHEFIVDCRKFEKSAGVKIEDIAKRLMDYGFHGPTMSWPVPGT  241

Query  518   LMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTK  339
             LMIEPTESESK ELDRFCD LISIR EI  IE GK D N+N LK+APH    + +D W  
Sbjct  242   LMIEPTESESKDELDRFCDALISIRAEIQSIEDGKMDANDNPLKHAPHTMGAIGSDDWQH  301

Query  338   PYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  207
             PY+RE AA+P  WL+ AKFWPT GR+D+ YGDRNL+C+  P+  
Sbjct  302   PYTREQAAWPMAWLRDAKFWPTVGRIDSAYGDRNLVCSCPPMDD  345



>gb|EMI20957.1| glycine dehydrogenase [Rhodopirellula maiorica SM1]
Length=345

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 220/284 (77%), Gaps = 8/284 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV   LAPFLP HPV  
Sbjct  66    GANMNAQVGLTSPGKIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAPQLAPFLPEHPV--  123

Query  872   TGGIPSPDKSQP--LGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAK  699
                   PD +    +G +SAAP+GS  IL ISY YIA+MG+ GL  A+++AILNANYMAK
Sbjct  124   ----ERPDTAGEFAIGPVSAAPYGSPSILTISYVYIALMGASGLKKATQVAILNANYMAK  179

Query  698   RLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGT  519
             RL  HY +L+   +G VAHEFI+D R F+ +AG++ ED+AKRLMDYGFHGPTMSWPVPGT
Sbjct  180   RLSDHYDILYTDSDGFVAHEFIVDCRKFEKSAGVKIEDIAKRLMDYGFHGPTMSWPVPGT  239

Query  518   LMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTK  339
             LMIEPTESESK ELDRFCD LISIR EI  IE GK D N+N LK+APH    + +D W  
Sbjct  240   LMIEPTESESKDELDRFCDALISIRAEIQSIEDGKMDANDNPLKHAPHTMGAIGSDDWQH  299

Query  338   PYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  207
             PY+RE AA+P  WL+ AKFWPT GR+D+ YGDRNL+C+  P+  
Sbjct  300   PYTREQAAWPMAWLRDAKFWPTVGRIDSAYGDRNLVCSCPPMDD  343



>ref|WP_045459859.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
 dbj|GAL84002.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   384 bits (987),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/287 (67%), Positives = 226/287 (79%), Gaps = 6/287 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSP  IGADVCHLNLHKTFCIPHGGGGPG+GPIGV  HL PFLP +P+V 
Sbjct  681   GANMNAQVGLTSPASIGADVCHLNLHKTFCIPHGGGGPGVGPIGVAAHLKPFLPGNPLVK  740

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       + + A+SAAPWGSA ILPISY YIAMMG++GL  +++ AILNANY+  RL
Sbjct  741   TGG------EKAIHAVSAAPWGSASILPISYAYIAMMGAEGLKSSTQHAILNANYIKARL  794

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EK YP+L+    G  AHEFI+D R FK++ G+E ED+AKRLMDYGFH PT+S+PVPGTLM
Sbjct  795   EKFYPILYTNTKGRCAHEFILDCREFKHSVGVEVEDIAKRLMDYGFHAPTVSFPVPGTLM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFC+ +I IREEI +IE GK D  NNVLK+APH   ++MAD WT+PY
Sbjct  855   IEPTESESKEELDRFCEAMIQIREEIREIENGKADKVNNVLKHAPHTAEVIMADNWTRPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             +RE AAFP +W++  KFWP+  R+DN YGDRNL+CT LPV      E
Sbjct  915   TREKAAFPIEWIRQRKFWPSVSRIDNAYGDRNLVCTCLPVEDYASHE  961



>ref|WP_015209784.1| glycine dehydrogenase, decarboxylating [Cylindrospermum stagnale]
 gb|AFZ26542.1| glycine dehydrogenase, decarboxylating [Cylindrospermum stagnale 
PCC 7417]
Length=966

 Score =   384 bits (985),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/281 (68%), Positives = 225/281 (80%), Gaps = 6/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP HPVV 
Sbjct  688   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHPVVK  747

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G      +Q +GA++AAPWGSA IL IS+ YIAMMG+ GLTDA+K+AILNANY+AKRL
Sbjct  748   ITG------TQGIGAVAAAPWGSASILVISWMYIAMMGADGLTDATKVAILNANYIAKRL  801

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRL+DYGFH PT+SWPV GT+M
Sbjct  802   ESYYPVLYQGKNGLVAHECILDLRDLKKSASIEIDDVAKRLIDYGFHAPTVSWPVGGTIM  861

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD LI+IR+EIA IE GK DI +N+LKNAPH    L+A  W  PY
Sbjct  862   VEPTESESKQELDRFCDALIAIRQEIAAIESGKADIQDNLLKNAPHTAESLIAGEWLHPY  921

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AA+PA W + +KFWP  GR+D  +GDRN +C+ LP++
Sbjct  922   SREQAAYPASWTRESKFWPNVGRIDAAFGDRNFVCSCLPMA  962



>ref|WP_022606719.1| glycine dehydrogenase (decarboxylating) [Rubidibacter lacunae]
 gb|ERN41620.1| glycine dehydrogenase (decarboxylating) [Rubidibacter lacunae 
KORDI 51-2]
Length=978

 Score =   384 bits (986),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 189/286 (66%), Positives = 233/286 (81%), Gaps = 6/286 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN NAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL P+LP H VV 
Sbjct  699   GANTNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLVPYLPGHGVVG  758

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TG   S      +GAISAAPWGSA ILPIS+ YIAMMG++GLT A+K+AIL+ANY+A+RL
Sbjct  759   TGSADS------IGAISAAPWGSASILPISWMYIAMMGAEGLTQATKVAILSANYVARRL  812

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + +YPVLFRG  G VAHE ++DLR  K  AGIE +DVAKRLMD+G+H PT+SWPVPGT+M
Sbjct  813   DTYYPVLFRGDKGLVAHECVVDLRPLKKRAGIEVDDVAKRLMDFGYHAPTVSWPVPGTMM  872

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESE+KAELDRFC+ +I+IR+E+  IE G+ D N+NVLK+APHP ++++ADAW +PY
Sbjct  873   VEPTESETKAELDRFCEAMIAIRKEVEAIENGRADPNDNVLKHAPHPAAVVVADAWERPY  932

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVED  195
             +RE AA+PA+W++  KFWP+ GRVDN YGDRNLIC+ + +    +D
Sbjct  933   TREQAAYPAEWVRDRKFWPSVGRVDNAYGDRNLICSCIGMDAYKDD  978



>ref|WP_016861897.1| glycine dehydrogenase [Fischerella muscicola]
Length=962

 Score =   383 bits (984),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 192/280 (69%), Positives = 223/280 (80%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV KHL PFLPS+PVV 
Sbjct  685   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAKHLMPFLPSNPVVT  744

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       Q +GA+SAAPWGSA IL IS+ YIAMMG+ GLTDA+K+AILNANY+AK L
Sbjct  745   MGG------EQSIGAVSAAPWGSASILVISWMYIAMMGAGGLTDATKVAILNANYIAKCL  798

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+L++G NG VAHE I+DLR  K +A IE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  799   EAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKRLMDYGFHAPTVSWPVAGTIM  858

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +ISIR+EIA+IE GK D+ +NVLKNAPH    L+   W   Y
Sbjct  859   VEPTESESKQELDRFCDAMISIRQEIAEIEAGKADLQDNVLKNAPHTAESLIIGEWNHSY  918

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  919   SREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  958



>ref|WP_044197707.1| glycine dehydrogenase [Oscillatoria acuminata]
Length=952

 Score =   383 bits (983),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 222/280 (79%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  673   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVMPHLVPFLPGHSVVK  732

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       + +GA+SAAPWGSA ILPIS+ Y+AMMG+ GLT A+++AILNANY+AKRL
Sbjct  733   VGG------DEAIGAVSAAPWGSASILPISWMYMAMMGAAGLTAATQVAILNANYIAKRL  786

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G  G VAHE I+DLR  K +AGIE ED+AKRLMDYGFH PT+SWPV GT+M
Sbjct  787   EPYYPVLYKGKTGLVAHECILDLRSLKKSAGIEVEDIAKRLMDYGFHAPTVSWPVAGTIM  846

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFC+ +I+IREEI  IE G  D  NN+LKNAPHP ++ +A  W +PY
Sbjct  847   VEPTESESKEELDRFCEAMIAIREEIRAIEAGTMDGENNLLKNAPHPATVAIASEWNRPY  906

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE A FPA W +  KFWP+ GR+DN YGDRNL+C  LP+
Sbjct  907   SREQAVFPAPWTREHKFWPSVGRIDNAYGDRNLVCACLPM  946



>ref|XP_010074869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Pterocles gutturalis]
Length=361

 Score =   365 bits (937),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 223/283 (79%), Gaps = 6/283 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  69    GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVIK  128

Query  872   TGGIPSPDKSQ-PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                   PDK   PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKR
Sbjct  129   I----QPDKDACPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKR  184

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LEKHY VLFRG  G VAHEFI+D R FK TA IEA D+AKRL DYGFH PTMSWPV GTL
Sbjct  185   LEKHYKVLFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTL  244

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESE KAELDRFCD +ISIR+EIA +E+G+ D   N LK +PH  + + +  W +P
Sbjct  245   MIEPTESEDKAELDRFCDAMISIRQEIADVEEGRMDPQINPLKMSPHTLNCVTSSKWDRP  304

Query  335   YSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             YSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  PV 
Sbjct  305   YSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPVE  347



>ref|WP_015182831.1| glycine dehydrogenase, decarboxylating [Microcoleus sp. PCC 7113]
 gb|AFZ18682.1| glycine dehydrogenase, decarboxylating [Microcoleus sp. PCC 7113]
Length=988

 Score =   384 bits (985),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 190/278 (68%), Positives = 224/278 (81%), Gaps = 6/278 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  709   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVMAHLLPFLPGHSVVE  768

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       Q +GAISAAPWGSA ILPIS+ Y+AMMG++GLT A+K+AILNANY+A+RL
Sbjct  769   IGG------KQRIGAISAAPWGSASILPISWMYVAMMGAEGLTAATKVAILNANYIARRL  822

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G +G VAHE I+DLR  K +AGIE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  823   EAYYPVLYKGKSGLVAHECILDLRQLKKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGTMM  882

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFC+ +I+IR+EI +IE GK D  +NVLKNAPH    LM+  W  PY
Sbjct  883   VEPTESESKEELDRFCEAMIAIRKEIEEIETGKVDDQDNVLKNAPHTAEFLMSSEWIHPY  942

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  219
             SRE AA+PA W +  KFWPT GR+DN +GDRNL+C+ +
Sbjct  943   SREQAAYPAPWTREHKFWPTVGRIDNAFGDRNLVCSCV  980



>ref|WP_020531529.1| glycine dehydrogenase [Flexithrix dorotheae]
Length=966

 Score =   383 bits (984),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 225/288 (78%), Gaps = 7/288 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLT+P  IGADVCHLNLHKTFCIPHGGGGPGMGPIGV + L PFLP H  V 
Sbjct  686   GANMNAQVGLTNPANIGADVCHLNLHKTFCIPHGGGGPGMGPIGVVEDLVPFLPGHVEVK  745

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       Q + A+SAAPWGSA ILPISY YIAMMG+QGL +A+K AILNANYM  RL
Sbjct  746   TGG------EQAIHAVSAAPWGSASILPISYAYIAMMGTQGLENATKHAILNANYMKSRL  799

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLF G NG VAHE IID R FK   GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  800   ESHYPVLFTGKNGRVAHEMIIDCRAFK-AFGIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  858

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+K+ELDRFCD +I+IREE+ ++E G  D   NVLKNAPH  +++M+D W KPY
Sbjct  859   IEPTESETKSELDRFCDAMIAIREEVNEVENGTADKLENVLKNAPHTANMVMSDNWEKPY  918

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SRE AAFP  +L   KFWP+  R+DN +GDRNLIC+ LPV   +E+ A
Sbjct  919   SREKAAFPLPYLSQNKFWPSVRRIDNAFGDRNLICSCLPVEDFIEEPA  966



>ref|WP_041226533.1| glycine dehydrogenase [Crinalium epipsammum]
Length=969

 Score =   383 bits (984),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 224/280 (80%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP+HPVVP
Sbjct  691   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLVPFLPNHPVVP  750

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G        Q +GAI++APW SA ILPIS+ YIA+MGS GLT A+++AILNANY+AKRL
Sbjct  751   VG------TEQGIGAIASAPWSSASILPISWMYIALMGSAGLTKATEVAILNANYIAKRL  804

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR FK TA IE +D+AKRL+DYGFH PT+SWPVPGT+M
Sbjct  805   EAYYPVLYQGKNGLVAHECILDLRQFKKTAEIEVDDIAKRLIDYGFHPPTVSWPVPGTIM  864

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IREEIA+IE GK +  NNVLKNAPH  + L A  W +PY
Sbjct  865   VEPTESESKQELDRFCDAMIAIREEIAEIESGKVERKNNVLKNAPHTAADLTASEWNRPY  924

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE A +P   ++  KFWP  GR+D  YGDRNL+C+ LP+
Sbjct  925   SREQAVYPVNGVREHKFWPAVGRIDQAYGDRNLVCSCLPM  964



>ref|XP_009490955.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Pelecanus crispus]
Length=361

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 191/283 (67%), Positives = 224/283 (79%), Gaps = 6/283 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  69    GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVIK  128

Query  872   TGGIPSPDKSQ-PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                   PDK   PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKR
Sbjct  129   I----QPDKDACPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKR  184

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LEKHY +LFRG  G VAHEFI+D R FK TA IEA D+AKRL DYGFH PTMSWPV GTL
Sbjct  185   LEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTL  244

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N LK +PH  + + +  W +P
Sbjct  245   MIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMSPHTLNCVTSSKWDRP  304

Query  335   YSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             YSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  305   YSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  347



>gb|AFZ12851.1| Glycine dehydrogenase (decarboxylating) [Crinalium epipsammum 
PCC 9333]
Length=1015

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 224/280 (80%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP+HPVVP
Sbjct  737   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLVPFLPNHPVVP  796

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G        Q +GAI++APW SA ILPIS+ YIA+MGS GLT A+++AILNANY+AKRL
Sbjct  797   VG------TEQGIGAIASAPWSSASILPISWMYIALMGSAGLTKATEVAILNANYIAKRL  850

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR FK TA IE +D+AKRL+DYGFH PT+SWPVPGT+M
Sbjct  851   EAYYPVLYQGKNGLVAHECILDLRQFKKTAEIEVDDIAKRLIDYGFHPPTVSWPVPGTIM  910

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IREEIA+IE GK +  NNVLKNAPH  + L A  W +PY
Sbjct  911   VEPTESESKQELDRFCDAMIAIREEIAEIESGKVERKNNVLKNAPHTAADLTASEWNRPY  970

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE A +P   ++  KFWP  GR+D  YGDRNL+C+ LP+
Sbjct  971   SREQAVYPVNGVREHKFWPAVGRIDQAYGDRNLVCSCLPM  1010



>gb|AFY83915.1| glycine dehydrogenase, decarboxylating [Oscillatoria acuminata 
PCC 6304]
Length=978

 Score =   383 bits (983),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 222/280 (79%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  699   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVMPHLVPFLPGHSVVK  758

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       + +GA+SAAPWGSA ILPIS+ Y+AMMG+ GLT A+++AILNANY+AKRL
Sbjct  759   VGG------DEAIGAVSAAPWGSASILPISWMYMAMMGAAGLTAATQVAILNANYIAKRL  812

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G  G VAHE I+DLR  K +AGIE ED+AKRLMDYGFH PT+SWPV GT+M
Sbjct  813   EPYYPVLYKGKTGLVAHECILDLRSLKKSAGIEVEDIAKRLMDYGFHAPTVSWPVAGTIM  872

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFC+ +I+IREEI  IE G  D  NN+LKNAPHP ++ +A  W +PY
Sbjct  873   VEPTESESKEELDRFCEAMIAIREEIRAIEAGTMDGENNLLKNAPHPATVAIASEWNRPY  932

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE A FPA W +  KFWP+ GR+DN YGDRNL+C  LP+
Sbjct  933   SREQAVFPAPWTREHKFWPSVGRIDNAYGDRNLVCACLPM  972



>ref|WP_035999593.1| glycine dehydrogenase [Leptolyngbya sp. JSC-1]
Length=1011

 Score =   383 bits (984),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/285 (66%), Positives = 222/285 (78%), Gaps = 5/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP H VV 
Sbjct  732   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLVPFLPGHAVVD  791

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G     +    +GA+SAAPWGS  ILPIS+ YIA+MG +GLT+A+KIAILNANY+AKRL
Sbjct  792   MG-----ESGDQIGAVSAAPWGSGAILPISWMYIALMGGEGLTEATKIAILNANYIAKRL  846

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVL++G NG VAHE I+DLR FK TA IE +D+AKRL+DYGFH PT+SWPV GT+M
Sbjct  847   EGHYPVLYKGKNGLVAHECILDLRQFKKTAAIEVDDIAKRLIDYGFHPPTVSWPVAGTIM  906

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IR EI +IE  + D  NN+LKNAPH  + L++D W +PY
Sbjct  907   VEPTESESKQELDRFCDAMIAIRAEIREIEADQVDRQNNLLKNAPHSAASLLSDQWDRPY  966

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE AA+P QW + +KFW    R+DN YGDRNL+C  LP+    E
Sbjct  967   SRERAAYPTQWTRDSKFWAAVDRIDNAYGDRNLVCACLPMDAYQE  1011



>ref|WP_008624248.1| Glycine dehydrogenase [Mariniradius saccharolyticus]
 gb|EMS34672.1| Glycine dehydrogenase [Mariniradius saccharolyticus AK6]
Length=963

 Score =   382 bits (980),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 192/288 (67%), Positives = 226/288 (78%), Gaps = 7/288 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V KHL PFLP +P+V 
Sbjct  683   GANMNAQVGLTSPGIIGADVCHLNLHKTFCIPHGGGGPGMGPICVAKHLVPFLPGNPLVQ  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +Q + AISAAP+GSA ILPISY YIAMMG  GLT+A+KIAILNANY+  RL
Sbjct  743   TGG------TQAITAISAAPFGSASILPISYAYIAMMGGDGLTNATKIAILNANYIKARL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+L+ G  G  AHE I+D R FK   GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  797   ESHYPILYTGTQGRAAHEMILDCRAFKEV-GIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  855

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+ AELDRFCD +I+IR EI ++  G+ D  NNVLKNAPH   L ++DAW+ PY
Sbjct  856   IEPTESETMAELDRFCDAMIAIRAEIQEVYDGQADRENNVLKNAPHTAVLALSDAWSLPY  915

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SRE A +P  ++K  KFWP+  R+D+ YGDRNL+C+ +PV + V+ EA
Sbjct  916   SREKAVYPLSYVKANKFWPSVRRIDSAYGDRNLVCSCIPVEEYVQAEA  963



>ref|XP_007510359.1| glycine dehydrogenase [Bathycoccus prasinos]
 emb|CCO18704.1| glycine dehydrogenase [Bathycoccus prasinos]
Length=1040

 Score =   383 bits (983),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 193/283 (68%), Positives = 226/283 (80%), Gaps = 1/283 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIG+K HL PF+P+HP   
Sbjct  756   GANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMGPIGIKAHLMPFMPNHPSEK  815

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G       +P G +SAAP+GSALILPISY YI+MMG++GL  AS+ AILNANYMAKRL
Sbjct  816   DFGALPVGGDKPFGTVSAAPYGSALILPISYAYISMMGAEGLKVASERAILNANYMAKRL  875

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVLF+G NGT AHEFI+D+R  K+TAG+E ED+AKRLMDYG+H PTMSWPV GTLM
Sbjct  876   ENHYPVLFKGKNGTCAHEFILDMRPLKDTAGVEVEDIAKRLMDYGYHSPTMSWPVSGTLM  935

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFC+ +I+IR+EIA IE G  D  NN+L  APH  + + A  W +PY
Sbjct  936   IEPTESESKQELDRFCNAMIAIRKEIADIESGAADKENNLLTRAPHTAASI-AGEWDRPY  994

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  204
             S++ A FPA W+  +KFWPT  RVDNVYGDRNL+ T   + ++
Sbjct  995   SKQDAVFPADWVSQSKFWPTNARVDNVYGDRNLVTTHAAIEEV  1037



>ref|WP_020402760.1| glycine dehydrogenase [Gracilimonas tropica]
Length=964

 Score =   381 bits (979),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 195/285 (68%), Positives = 223/285 (78%), Gaps = 6/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV +HL PFLPSH VV 
Sbjct  681   GANMNAQVGLTSPGEIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAEHLVPFLPSHSVVK  740

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG       + + AISAAPWGSA IL ISY YI MMG  GLTDA+K AILNANY+  RL
Sbjct  741   MGG------EKGVTAISAAPWGSASILTISYAYIRMMGGNGLTDATKYAILNANYLKDRL  794

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HY +L+ G  G  AHEFI+DLR FK +AGIE+ DVAKRLMDYGFH PTMS+PVPGTLM
Sbjct  795   KDHYEILYTGKTGRSAHEFIVDLRPFKQSAGIESVDVAKRLMDYGFHAPTMSFPVPGTLM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESES  ELDRFC+ +ISIR+EI +IE GK D  +NVLKNAPH   +++AD WT+ Y
Sbjct  855   IEPTESESIEELDRFCEAMISIRKEIQEIEDGKADKEDNVLKNAPHTQRVMVADEWTRSY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE  AFP + LK  KFWP+  RVD+ YGDRNL+C+ +P+    E
Sbjct  915   SREKGAFPLEDLKFNKFWPSVSRVDDAYGDRNLVCSCIPMEAYEE  959



>ref|WP_015227846.1| glycine dehydrogenase, decarboxylating [Dactylococcopsis salina]
 gb|AFZ48833.1| glycine dehydrogenase, decarboxylating [Dactylococcopsis salina 
PCC 8305]
Length=973

 Score =   381 bits (978),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 189/278 (68%), Positives = 223/278 (80%), Gaps = 6/278 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV++HL PFLPSHPV+ 
Sbjct  695   GANMNAQVGLCRPGDYGADVCHLNLHKTFCIPHGGGGPGMGPIGVREHLVPFLPSHPVIE  754

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       Q +GA+SAAPWGS  ILPIS+ +IAMMG++GLT ASK+AILNANY+A RL
Sbjct  755   TGG------EQAIGAVSAAPWGSPSILPISWMFIAMMGAKGLTHASKVAILNANYIAHRL  808

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HYPVL++G +G VAHE IIDLR  K +A I  +D+AKRLMD+GFH PT+SWPV GT+M
Sbjct  809   DDHYPVLYKGNSGLVAHECIIDLRLVKKSANIGVDDIAKRLMDFGFHAPTVSWPVAGTMM  868

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IREEI  IE G+ D  +N LKNAPH   +L+ D W   Y
Sbjct  869   VEPTESESKEELDRFCDAMIAIREEIRAIESGEVDAEDNPLKNAPHTHEMLIGDGWQHSY  928

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  219
             SRE AA+PAQWL+  KFWP  GR+DN YGDRNL+C+ +
Sbjct  929   SRETAAYPAQWLRDYKFWPAVGRIDNAYGDRNLVCSCV  966



>ref|XP_005649750.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
 gb|EIE25206.1| glycine dehydrogenase [Coccomyxa subellipsoidea C-169]
Length=1041

 Score =   382 bits (982),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 203/278 (73%), Positives = 235/278 (85%), Gaps = 1/278 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLP+HP+VP
Sbjct  743   GANMNAQVGLTSPGHIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPTHPLVP  802

Query  872   TGGIPS-PDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
             TGG+P     +Q  G ++AAP+GS+LILPISY YI+MMGS+GLT+AS+ AILNANYMA R
Sbjct  803   TGGLPGFKSDAQSFGTMAAAPFGSSLILPISYAYISMMGSEGLTEASRRAILNANYMATR  862

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             L+  Y VL+ G NGT AHEFIIDLR  K+TA IE EDVAKRL+DYGFH PTMSWPV GTL
Sbjct  863   LKDSYKVLYTGDNGTCAHEFIIDLRPLKDTADIEPEDVAKRLIDYGFHAPTMSWPVAGTL  922

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESESKAELDRF + LI+IREE+ +IE+GK D  +NVLK++PH   ++MA  WT+P
Sbjct  923   MIEPTESESKAELDRFVNALIAIREEVREIEEGKADKADNVLKHSPHTADVVMAGEWTRP  982

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  222
             YSRE AAFPA W++ AKFWP+  RVDNV+GDR+LI  L
Sbjct  983   YSREKAAFPATWVRQAKFWPSASRVDNVHGDRHLIAKL  1020



>ref|XP_009699383.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Cariama cristata]
Length=451

 Score =   365 bits (938),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 224/283 (79%), Gaps = 6/283 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPV+ 
Sbjct  159   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVIK  218

Query  872   TGGIPSPDKSQ-PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                   PDK   PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKR
Sbjct  219   I----QPDKDACPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKR  274

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LEKHY +LFRG  G VAHEFI+D R FK TA IEA D+AKRL DYGFH PTMSWPV GTL
Sbjct  275   LEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTL  334

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N LK +PH  + + +  W +P
Sbjct  335   MIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMSPHTLNCVTSSKWDRP  394

Query  335   YSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             YSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  395   YSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  437



>ref|XP_005702688.1| glycine dehydrogenase, partial [Galdieria sulphuraria]
 gb|EME26168.1| glycine dehydrogenase, partial [Galdieria sulphuraria]
Length=801

 Score =   376 bits (966),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 223/287 (78%), Gaps = 3/287 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+ SPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V  HLAPFLPSHPV+P
Sbjct  514   GANMNAQVGICSPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIAVASHLAPFLPSHPVIP  573

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                +   D    LGA++AAP+GS+ ILPISY YI MMG +GLT A+K+AILNANYMA+RL
Sbjct  574   PLHV---DPKHCLGAVAAAPYGSSSILPISYMYIKMMGDEGLTRATKVAILNANYMAQRL  630

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
                YP+L+RG +G VAHEFIIDLR  K T+G+   DVAKRL DYGFH PTMS+PV GTLM
Sbjct  631   SASYPILYRGKHGRVAHEFIIDLRPLKATSGVTEADVAKRLQDYGFHSPTMSFPVAGTLM  690

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDR CD L+ IREEI  IE GK D  +N LKNAPH   ++ +D W + Y
Sbjct  691   VEPTESESKAELDRLCDALLMIREEIRDIENGKMDKEDNPLKNAPHTADVVSSDNWNRSY  750

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             SR+ AA+PA+W +T K WP+  R+D+ YGD+NL+CT  P+   VE E
Sbjct  751   SRQLAAYPAEWTRTFKLWPSVSRIDDAYGDKNLVCTCPPLESYVEAE  797



>ref|WP_017712703.1| glycine dehydrogenase [Prochlorothrix hollandica]
Length=970

 Score =   380 bits (977),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 222/281 (79%), Gaps = 3/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HLAPFLP H V+ 
Sbjct  688   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLAPFLPGHGVLS  747

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                      S P+GA+SAAPWGSA ILPIS+ YI MMG+ GLT+A+++AILNANYMA RL
Sbjct  748   NQNTLG---SHPIGAVSAAPWGSASILPISWMYIKMMGAAGLTEATQLAILNANYMAHRL  804

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               HYP+L++G+ G VAHE I+DLR  K TAGIE EDVAKRLMDYGFH PT+SWPV GT+M
Sbjct  805   APHYPILYKGIGGLVAHECILDLRDLKRTAGIEVEDVAKRLMDYGFHAPTVSWPVAGTMM  864

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IR+E+  IE+G+ D  NN LK+APH   +L+AD W +PY
Sbjct  865   VEPTESESKEELDRFCDAMIAIRQEVRAIEQGQIDPLNNPLKHAPHTAEVLLADDWDRPY  924

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AA+P  WL+  KFWP  GRVDN YGDRNL+C+  P+ 
Sbjct  925   SREQAAYPLPWLRQFKFWPVVGRVDNAYGDRNLVCSCAPME  965



>ref|XP_008334138.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Cynoglossus semilaevis]
Length=468

 Score =   366 bits (940),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 191/281 (68%), Positives = 221/281 (79%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPVV 
Sbjct  177   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPSHPVVA  236

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                + S   S  LG ISAAPWGS+ ILPIS+ YI MMGS+GL  A+++AILNANYMAKRL
Sbjct  237   MASVNS---SSSLGTISAAPWGSSAILPISWAYIKMMGSKGLRHATEVAILNANYMAKRL  293

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E  Y +LFRG NG VAHEFI+D+R FK TA IEA DVAKRL DYGFH PTMSWPV GTLM
Sbjct  294   ENSYKILFRGSNGFVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVAGTLM  353

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD L+ IR+EIA IE+G+ D   N LK APH  + + +  W +PY
Sbjct  354   IEPTESEDKAELDRFCDALLGIRQEIADIEEGRMDTRINPLKMAPHSLACISSSNWDRPY  413

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE+AAFP  +++   KFWP+  R+D++YGD+NL+CT  P+
Sbjct  414   SREFAAFPLPFIRPETKFWPSISRIDDIYGDQNLMCTCPPM  454



>ref|WP_009187084.1| glycine dehydrogenase [Cecembia lonarensis]
 gb|EKB47336.1| Glycine dehydrogenase [Cecembia lonarensis LW9]
Length=965

 Score =   380 bits (976),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 227/285 (80%), Gaps = 7/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V KHLAPFLP +P+V 
Sbjct  683   GANMNAQVGLTSPGKIGADVCHLNLHKTFCIPHGGGGPGMGPICVAKHLAPFLPGNPLVQ  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +Q + +ISAAP+GSA ILPISY YIAMMG  GLT+A+KIAILNANY+  RL
Sbjct  743   TGG------TQAINSISAAPFGSASILPISYAYIAMMGPDGLTNATKIAILNANYIKFRL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E+HYP+L+ G NG  AHE I+D RGFK   GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  797   EQHYPILYAGANGRAAHEMILDCRGFKEV-GIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  855

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+ +ELDRFCD +I IR EI +I+ GK + +NNVLKNAPH  +L +AD W  PY
Sbjct  856   IEPTESETLSELDRFCDAMIGIRAEIQEIQDGKAEKDNNVLKNAPHTANLALADNWDFPY  915

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE A +P  ++K  KFWPT  R+D+ YGDRNLIC+ +PV +  E
Sbjct  916   SREKAVYPLPYVKGNKFWPTVRRIDSAYGDRNLICSCIPVEEYAE  960



>gb|KIJ83529.1| glycine dehydrogenase [Scytonema tolypothrichoides VB-61278]
Length=967

 Score =   380 bits (976),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 220/280 (79%), Gaps = 3/280 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P  IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  688   GANMNAQVGLCRPRDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHAVVE  747

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G   S    Q +GA+SAAPWGSA IL IS+ YIAMMG+ GLT A+K+AILNANY+AKRL
Sbjct  748   MG---SEQNKQNIGAVSAAPWGSASILVISWMYIAMMGADGLTQATKVAILNANYIAKRL  804

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  805   ESYYPVLYKGKNGLVAHECILDLRSLKKSANIEIDDIAKRLMDYGFHAPTVSWPVAGTIM  864

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NVLKNAPH    L+   W  PY
Sbjct  865   VEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQDNVLKNAPHTAESLIVGEWNHPY  924

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W +  KFWP+ GR+D  YGDRN +C+ LP+
Sbjct  925   SREQAAYPAPWTREHKFWPSVGRIDAAYGDRNFVCSCLPM  964



>ref|WP_023065539.1| glycine dehydrogenase [Lyngbya aestuarii]
 gb|ERT08292.1| glycine dehydrogenase [Lyngbya aestuarii BL J]
Length=992

 Score =   380 bits (977),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/286 (67%), Positives = 222/286 (78%), Gaps = 4/286 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP H VV 
Sbjct  711   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLIPFLPGHSVVT  770

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                    D  Q LGAISAAPWGS  IL IS+ YIAMMG++GLT+A+K+AILNANYMA RL
Sbjct  771   M----QDDNPQSLGAISAAPWGSPSILVISWMYIAMMGAEGLTEATKVAILNANYMAHRL  826

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             ++ YP+L++G NG +AHE I+DLRG K +A IE +D+AKRLMDYGFH PT+SWPVPGT+M
Sbjct  827   KESYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIAKRLMDYGFHAPTVSWPVPGTVM  886

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFCD +I+IR EI+ IE G  D  NN LKNAPH    L+   W  PY
Sbjct  887   VEPTESESKAELDRFCDAMIAIRREISAIESGDIDGENNPLKNAPHTAESLIVGEWNHPY  946

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVED  195
             SRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ LP+    E+
Sbjct  947   SREQAAYPAPWLRDHKFWPSVGRIDNAYGDRNFVCSCLPMEAYSEN  992



>ref|WP_019596339.1| glycine dehydrogenase [Rhodonellum psychrophilum]
 gb|ERM81253.1| glycine dehydrogenase [Rhodonellum psychrophilum GCM71 = DSM 
17998]
Length=965

 Score =   380 bits (975),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 223/285 (78%), Gaps = 7/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPG+GPI V KHL PFLP +P+V 
Sbjct  683   GANMNAQVGLTSPGIIGADVCHLNLHKTFCIPHGGGGPGVGPICVAKHLVPFLPGNPLVK  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       Q + AISAAP+GSA IL ISY YI+MMG  GLT+A+KIAILNANYM  RL
Sbjct  743   TGG------KQAITAISAAPFGSASILAISYAYISMMGGDGLTNATKIAILNANYMKARL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E+HYP+L+ G +G  AHE I+D R FK+  GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  797   EEHYPILYTGTHGRAAHEMILDCRAFKDF-GIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  855

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+ +ELDRFCD +ISIREEI  +E G  D +NNVLKNAPH   L +AD W  PY
Sbjct  856   IEPTESETLSELDRFCDAMISIREEIRDVESGAADRDNNVLKNAPHTAGLALADHWNFPY  915

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE A FP  ++K  KFWPT  R+D+ YGDRNL+C+ +PV +  E
Sbjct  916   SREKAVFPLPYVKGNKFWPTVRRIDSAYGDRNLVCSCIPVEEYAE  960



>ref|WP_013939616.1| glycine dehydrogenase [Myxococcus fulvus]
 gb|AEI66487.1| glycine dehydrogenase [Myxococcus fulvus HW-1]
Length=969

 Score =   380 bits (975),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 191/291 (66%), Positives = 230/291 (79%), Gaps = 6/291 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLT+PG IGADVCH+NLHKTFCIPHGGGGPGMGPI V  HL  FLP HPV+ 
Sbjct  683   GANLNAQVGLTAPGLIGADVCHINLHKTFCIPHGGGGPGMGPICVASHLVKFLPGHPVIQ  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      S+ +GAISAAPWGSA IL IS+ YIAMMG++GLT A+K+AIL+ANY+A RL
Sbjct  743   TGG------SEAIGAISAAPWGSASILLISWMYIAMMGAEGLTQATKLAILSANYVAARL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HYPVL+RG  G VAHE I+DLR  K TAG+E EDVAKRLMDYGFH PT+S+PV GTLM
Sbjct  797   DAHYPVLYRGKRGKVAHECIVDLRPLKKTAGVEVEDVAKRLMDYGFHAPTVSFPVAGTLM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD +ISIR+EI  IE+G+   +NN+LKNAPH   ++ A  W +PY
Sbjct  857   IEPTESESKAELDRFCDAMISIRQEIRDIEEGRAPRDNNLLKNAPHTARVVTAPEWNRPY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SRE A FPA W++  KFWP+ GR+++V GDR L+C+  P+   +  E  A+
Sbjct  917   SREQAVFPAPWVRDNKFWPSVGRLNSVLGDRKLVCSCPPIEDYMTTEPKAA  967



>ref|WP_026736448.1| glycine dehydrogenase [Fischerella sp. PCC 9605]
Length=973

 Score =   380 bits (975),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 222/280 (79%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV KHL PFLP  PVV 
Sbjct  695   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAKHLVPFLPGSPVVK  754

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG  S      +GA+SAAPWGSA IL IS+ YIAMMG+ GLTDA+K+AILNANY+AKRL
Sbjct  755   MGGELS------IGAVSAAPWGSACILVISWMYIAMMGAAGLTDATKVAILNANYIAKRL  808

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  809   EGYYPVLYQGKNGLVAHECILDLRSLKKSASIEIDDVAKRLMDYGFHAPTVSWPVAGTIM  868

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD LI+IR+EIA IE GK D+ +NVLKNAP+    L+   W  PY
Sbjct  869   VEPTESESKEELDRFCDALIAIRQEIAAIESGKADLQDNVLKNAPYTAESLIVGEWNHPY  928

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  929   SREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  968



>ref|WP_007659102.1| glycine dehydrogenase [Pontibacter sp. BAB1700]
 gb|EJF08758.1| glycine dehydrogenase [Pontibacter sp. BAB1700]
Length=816

 Score =   376 bits (965),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 192/287 (67%), Positives = 222/287 (77%), Gaps = 7/287 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSP  IGADVCHLNLHKTFCIPHGGGGPGMGPIGV K LAPFLP H VV 
Sbjct  530   GANMNAQVGLTSPAHIGADVCHLNLHKTFCIPHGGGGPGMGPIGVVKDLAPFLPGHAVVD  589

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G      + + + AISAAPWGSA ILPISY YIAMMG +GLT+A+K+AILNANY+  RL
Sbjct  590   LG------RPEAINAISAAPWGSASILPISYAYIAMMGGEGLTEATKVAILNANYIKARL  643

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHYPVL+ G NG  AHE I+D R FK   G+E ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  644   EKHYPVLYVGKNGRCAHEMILDCREFKKY-GVEVEDIAKRLMDYGFHAPTVSFPVAGTLM  702

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESE++ ELDRFCD +ISIREEI +IE GK D  NNVLKNAPH   + M + W +PY
Sbjct  703   VEPTESEAQEELDRFCDVMISIREEIREIEAGKADQKNNVLKNAPHTLKVAMVENWERPY  762

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             SRE A FP  +L+  K WPT  R+D+ YGDRNL+C+  P+    E+E
Sbjct  763   SREKAVFPMAYLRDNKVWPTVSRIDSAYGDRNLVCSCAPIEAYNENE  809



>ref|XP_010129815.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Buceros rhinoceros silvestris]
Length=405

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 223/281 (79%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  113   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVI-  171

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I     + PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKRL
Sbjct  172   --KIHLDKDACPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKRL  229

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHY +LFRG  G VAHEFI+D R FK TA IEA D+AKRL DYGFH PTMSWPV GTLM
Sbjct  230   EKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTLM  289

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N LK +PH  + + +  W +PY
Sbjct  290   IEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMSPHTLNCVTSSKWDRPY  349

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  PV
Sbjct  350   SREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPV  390



>dbj|GAM17937.1| hypothetical protein SAMD00019534_011120, partial [Acytostelium 
subglobosum LB1]
Length=1024

 Score =   380 bits (977),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 193/281 (69%), Positives = 220/281 (78%), Gaps = 5/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPI V KHL PFLP H VVP
Sbjct  746   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPICVAKHLIPFLPGHSVVP  805

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                 P     Q +GAISAAPWGS+ ILPI+Y YI +MG  GL  A+++AILNANYMA RL
Sbjct  806   DVSTP-----QAIGAISAAPWGSSSILPITYIYINLMGGVGLKRATQVAILNANYMAARL  860

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HY +L+ G +G VAHEFIIDLR FK T GIEAEDVAKRL DYGFHGPTMSWPV  TLM
Sbjct  861   KDHYKILYTGSHGLVAHEFIIDLRSFKETTGIEAEDVAKRLQDYGFHGPTMSWPVVNTLM  920

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDR CD LISIR EIA+IE GK   +NN+L NAPH   ++ +D W +PY
Sbjct  921   IEPTESESKYELDRLCDALISIRGEIAEIESGKASRDNNLLVNAPHTEHVITSDKWDRPY  980

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             +RE AA+P+   + +KFWP+ GRVDNV+GDRNL+C   P+S
Sbjct  981   TRERAAYPSVATRESKFWPSVGRVDNVFGDRNLVCACPPLS  1021



>ref|XP_009955956.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Leptosomus discolor]
Length=361

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 188/282 (67%), Positives = 222/282 (79%), Gaps = 4/282 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  69    GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVI-  127

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I     + PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKRL
Sbjct  128   --KIQLDKDACPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKRL  185

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHY +LFRG  G VAHEFI+D R FK TA IE  D+AKRL DYGFH PTMSWPV GTLM
Sbjct  186   EKHYKILFRGTRGYVAHEFILDTRPFKKTANIEVVDLAKRLQDYGFHAPTMSWPVAGTLM  245

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N LK +PH  + + +  W +PY
Sbjct  246   IEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMSPHTLNCVTSSKWDRPY  305

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  306   SRELAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  347



>ref|WP_015349077.1| glycine dehydrogenase [Myxococcus stipitatus]
 gb|AGC44816.1| glycine dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=968

 Score =   379 bits (973),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 228/287 (79%), Gaps = 6/287 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLT+PG +GADVCH+NLHKTFCIPHGGGGPGMGPI V  HL  +LP HPV+ 
Sbjct  682   GANLNAQVGLTAPGLVGADVCHINLHKTFCIPHGGGGPGMGPICVASHLVKYLPGHPVIQ  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      S  +GAISAAPWGSA IL IS+ YIAMMG +GLT A+K+AILNANY+A+RL
Sbjct  742   TGG------SDGIGAISAAPWGSASILLISWMYIAMMGGEGLTQATKLAILNANYIAERL  795

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HYPVL+RG  G VAHE I+DLR  K T+G+E EDVAKRLMDYGFH PT+S+PV GTLM
Sbjct  796   QPHYPVLYRGKRGRVAHECIVDLRPLKKTSGVEVEDVAKRLMDYGFHAPTVSFPVAGTLM  855

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESES+AELDRFCD +I+IR+EI ++E+G+   +NNVLKNAPH   ++ A  W +PY
Sbjct  856   IEPTESESRAELDRFCDAMIAIRQEIREVEEGRMPKDNNVLKNAPHTSRVISAPEWNRPY  915

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             SRE A FPA W++  KFWP+ GR++NV GDR L+C+  P+   +  E
Sbjct  916   SREVAVFPAPWVRDNKFWPSVGRLNNVLGDRKLVCSCPPIEDYMTPE  962



>gb|EFA86802.1| glycine dehydrogenase [Polysphondylium pallidum PN500]
Length=1014

 Score =   380 bits (975),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 221/281 (79%), Gaps = 5/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPI V  HL PFLP H VVP
Sbjct  736   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPICVASHLLPFLPGHSVVP  795

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G         +GAISA PWGS+ ILPI+Y Y+ +MG  GL  A+++AILNANYMA RL
Sbjct  796   NVG-----GQHAIGAISATPWGSSSILPITYVYLQLMGGVGLKRATQVAILNANYMASRL  850

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HY +L+ G +G VAHEFIIDLR FK T GI+AEDVAKRL DYGFHGPTMSWPVP TLM
Sbjct  851   KDHYKILYTGSHGLVAHEFIIDLRDFKETTGIQAEDVAKRLQDYGFHGPTMSWPVPNTLM  910

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDR CD LISIR EIA+IE+GK D NNN+L N+PH  +++ AD W +PY
Sbjct  911   IEPTESESKYELDRLCDALISIRAEIAEIEQGKADRNNNLLVNSPHTEAVITADTWDRPY  970

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             +R  AA+P+   + +KFWP+ GRVDNV+GDRNL+C+  P++
Sbjct  971   TRARAAYPSPSTRESKFWPSVGRVDNVFGDRNLVCSCPPLT  1011



>ref|WP_044171749.1| glycine dehydrogenase [Oscillatoria sp. PCC 10802]
Length=977

 Score =   379 bits (973),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 225/281 (80%), Gaps = 6/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H V  
Sbjct  698   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVAPHLLPFLPGHSVAG  757

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      ++ +GA+SAAPWGSA IL IS+ YIAMMG  GL +A+K+AILNANY+A+RL
Sbjct  758   TGG------AESIGAVSAAPWGSASILTISWMYIAMMGGAGLAEATKVAILNANYIARRL  811

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G +G VAHE I+DLRG K +AGIE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  812   EPYYPVLYKGKDGFVAHECILDLRGLKKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGTVM  871

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IR+EI +IE GK D +NNVLKNAPH    L+A  W +PY
Sbjct  872   VEPTESESKQELDRFCDAMIAIRKEIEEIELGKADPSNNVLKNAPHTAESLIAGEWDRPY  931

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AA+PA W + +KFWP  GR+DN YGDR+ +C+ LPV 
Sbjct  932   SRERAAYPAPWTRESKFWPAVGRIDNAYGDRHFVCSCLPVE  972



>ref|WP_011553098.1| glycine dehydrogenase [Myxococcus xanthus]
 gb|ABF89308.1| glycine dehydrogenase [Myxococcus xanthus DK 1622]
Length=971

 Score =   379 bits (972),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 228/291 (78%), Gaps = 6/291 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLTSPG +GADVCH+NLHKTFCIPHGGGGPGMGPI V  HL  FLP HPV+ 
Sbjct  685   GANLNAQVGLTSPGLVGADVCHINLHKTFCIPHGGGGPGMGPICVASHLVKFLPGHPVIQ  744

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      S+ +GAISAAPWGSA IL IS+ YIAMMG +GLT A+K+AILNANY+A+RL
Sbjct  745   TGG------SEAIGAISAAPWGSASILLISWMYIAMMGGEGLTQATKLAILNANYVAERL  798

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               HYPVL+RG  G VAHE I+DLR  K TAG+E EDVAKRLMDYGFH PT+S+PV GTLM
Sbjct  799   NAHYPVLYRGKRGKVAHECIVDLRPLKKTAGVEVEDVAKRLMDYGFHAPTVSFPVAGTLM  858

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD +I+IR+EI  IE+G+   +NNVLK+APH   ++ A  W +PY
Sbjct  859   IEPTESESKAELDRFCDAMIAIRQEIRDIEEGRMPKDNNVLKHAPHTARVVAAPEWNRPY  918

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SRE A FP  W++  KFWP+ GR+++V GDR L+C+  P+   +  E  A+
Sbjct  919   SREQAVFPTPWVRDNKFWPSVGRLNSVLGDRKLVCSCPPIEDYMTPEPKAA  969



>ref|WP_019497275.1| glycine dehydrogenase [Calothrix sp. PCC 7103]
Length=959

 Score =   379 bits (972),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 222/285 (78%), Gaps = 4/285 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  679   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHAVVD  738

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                  SP +   +GA+SAAPWGSA IL IS+ YI MMG+ GLT+A+KIAILNANY+AKRL
Sbjct  739   I----SPTQHSKIGAVSAAPWGSASILVISWMYIVMMGASGLTEATKIAILNANYIAKRL  794

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVL++G NG VAHE I+DLR  K +A I+ +DVAKRLMDYG+H PT+SWPV GT+M
Sbjct  795   ENHYPVLYKGSNGYVAHECILDLRALKKSANIDIDDVAKRLMDYGYHAPTVSWPVAGTIM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD LISIR+EIA+IE GK DI +N+LKNAPH    L+A  W  PY
Sbjct  855   VEPTESESKEELDRFCDALISIRQEIAEIESGKMDIQDNLLKNAPHTAESLIAGDWKHPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             +RE AA+PA W +  KFW +  R+D  +GDRN +C+ LP+    E
Sbjct  915   TREQAAYPAPWTRDNKFWVSVSRIDAAFGDRNFVCSCLPMEAYSE  959



>ref|WP_024285047.1| glycine dehydrogenase [Algoriphagus marincola]
Length=964

 Score =   379 bits (972),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 225/287 (78%), Gaps = 7/287 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V  HLAPFLP +P++ 
Sbjct  682   GANMNAQVGLTSPGRIGADVCHLNLHKTFCIPHGGGGPGMGPICVAAHLAPFLPGNPIIK  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +Q + +ISAAP+GSA ILPISY YI MMG  GLT+A+K+AILNANY+ +RL
Sbjct  742   TGG------TQAVSSISAAPYGSASILPISYAYIEMMGGDGLTNATKMAILNANYIKERL  795

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+L+ G NG  AHE IID RGFK   G+E ED+AKRLMDYGFH PT+S+PV GT+M
Sbjct  796   EGHYPILYIGANGRAAHEMIIDCRGFKEI-GVEVEDIAKRLMDYGFHAPTVSFPVAGTMM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+K ELDRFCD LI IREEI +IE G  D  NNVLKNAPH  ++++   W  PY
Sbjct  855   IEPTESETKVELDRFCDALIGIREEIREIENGSADKENNVLKNAPHTANMVLIGGWDLPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             SRE A +P  ++K  KFWPT  R+D+ YGDRNL+C+ +PV +  +++
Sbjct  915   SREKAVYPLAYVKDNKFWPTVRRIDSAYGDRNLMCSCIPVEEYAQEQ  961



>dbj|BAD81531.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82266.1| P protein-like [Oryza sativa Japonica Group]
Length=197

 Score =   354 bits (909),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  767  MMGSQGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAE  588
            MMGS+GLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE E
Sbjct  1    MMGSKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPE  60

Query  587  DVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFD  408
            DVAKRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D
Sbjct  61   DVAKRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKAD  120

Query  407  INNNVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLIC  228
            +NNNVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLIC
Sbjct  121  VNNNVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLIC  180

Query  227  TLLPVSQM  204
            TL   SQ+
Sbjct  181  TLQQGSQV  188



>ref|WP_018472039.1| glycine dehydrogenase [Echinicola pacifica]
Length=965

 Score =   379 bits (972),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 191/290 (66%), Positives = 227/290 (78%), Gaps = 8/290 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V KHLAPFLP +P+V 
Sbjct  684   GANMNAQVGLTSPGVIGADVCHLNLHKTFCIPHGGGGPGMGPICVAKHLAPFLPGNPIVK  743

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG        P+ AISAAP+GSA ILPISY YIAMMG  GL +A+++AILNANY+  RL
Sbjct  744   TGG------QTPISAISAAPFGSASILPISYAYIAMMGRDGLKNATQMAILNANYIKARL  797

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E+++P+L+ G  G  AHE I+D R FK    IE ED+AKRL+DYGFH PT+S+PV GTLM
Sbjct  798   EEYFPILYTGTQGRAAHEMIVDFRAFK-AVEIEVEDIAKRLIDYGFHSPTVSFPVAGTLM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+KAELDRFCD LISIR EI +IE GK D  NNVLKNAPH  +++M D W  PY
Sbjct  857   IEPTESETKAELDRFCDALISIRAEIKEIEDGKADPENNVLKNAPHTANMVMQDEWDFPY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAA  183
             SRE A +P  +++ +KFWPT  R+D+ YGDRNL+C+ +P  +  EDE A+
Sbjct  917   SREKAIYPLDYVRNSKFWPTVRRIDSAYGDRNLVCSCIPTEE-YEDEVAS  965



>ref|WP_008198699.1| glycine dehydrogenase [Algoriphagus machipongonensis]
 gb|EAZ79488.1| glycine dehydrogenase [Algoriphagus machipongonensis]
Length=962

 Score =   378 bits (971),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 190/288 (66%), Positives = 223/288 (77%), Gaps = 7/288 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V  HL PFLP +P+V 
Sbjct  682   GANMNAQVGLTSPGNIGADVCHLNLHKTFCIPHGGGGPGMGPICVASHLVPFLPGNPLVK  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG        P+ +ISAAP+GSA ILPISY YIAMMG +GL +A+K+AILNANY+ +RL
Sbjct  742   TGG------KNPVSSISAAPYGSASILPISYAYIAMMGGEGLKNATKMAILNANYIKERL  795

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               +YP+L+ G  G  AHE I+D RGFK   G+E ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  796   SGYYPILYTGTQGRAAHEMIVDCRGFKEV-GVEVEDIAKRLMDYGFHAPTVSFPVAGTLM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+KAELDRFCD LISIR EI +IE GK D   NVLKNAPH  S+++   WT PY
Sbjct  855   IEPTESETKAELDRFCDALISIRAEIQEIEDGKVDKELNVLKNAPHTASMVLEGEWTMPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SRE A FP  ++K  KFWP+  R+D+ YGDRNL+C+ +PV     +EA
Sbjct  915   SREKAVFPIDYVKENKFWPSVRRIDSAYGDRNLVCSCIPVEDYASEEA  962



>ref|XP_007440133.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Python bivittatus]
Length=863

 Score =   376 bits (965),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 198/281 (70%), Positives = 220/281 (78%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHL PFLPSHPVV 
Sbjct  571   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLVPFLPSHPVV-  629

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                +P    S PLG ISAAPWGS+ ILPIS+ YI MMG +GL  AS+IAILNANYMAKRL
Sbjct  630   --ALPHDTHSSPLGTISAAPWGSSAILPISWAYIKMMGGKGLKHASEIAILNANYMAKRL  687

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HY +LFRG  G VAHEFI+D R FK TA IEA DVAKRL DYGFH PTMSWPV GTLM
Sbjct  688   ENHYKILFRGTKGYVAHEFILDTRPFKKTANIEAADVAKRLQDYGFHAPTMSWPVAGTLM  747

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N LK APH  + L A  W +PY
Sbjct  748   IEPTESEDKAELDRFCDAMISIRQEIADIEEGRMDARVNPLKMAPHTLTCLAAPNWDRPY  807

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AAFP  ++K   KFWPT  R+D++YGD++LICT  P+
Sbjct  808   SREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLICTCPPM  848



>ref|WP_026945428.1| glycine dehydrogenase [Algoriphagus marincola]
Length=964

 Score =   378 bits (971),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 226/287 (79%), Gaps = 7/287 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V  HLAPFLP +P++ 
Sbjct  682   GANMNAQVGLTSPGRIGADVCHLNLHKTFCIPHGGGGPGMGPICVAAHLAPFLPGNPIIK  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +Q + +ISAAP+GSA ILPISY YI MMG  GLT+A+K+AILNANY+ +RL
Sbjct  742   TGG------TQAVSSISAAPYGSASILPISYAYIEMMGGDGLTNATKMAILNANYIKERL  795

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HYP+L+ G NG  AHE IID RGFK   G+E ED+AKRLMDYGFH PT+S+PV GT+M
Sbjct  796   DGHYPILYTGANGRAAHEMIIDCRGFKEF-GVEVEDIAKRLMDYGFHAPTVSFPVAGTMM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+KAELDRFCD LI IREEI +IE G  D  NNVLKNAPH  ++++   W  PY
Sbjct  855   IEPTESETKAELDRFCDALIGIREEIREIENGSADKENNVLKNAPHTANMVLIGEWELPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
             SRE A +P  ++K  KFWPT  R+D+ YGDRNL+C+ +PV +  +++
Sbjct  915   SREKAVYPLAYVKDNKFWPTVRRIDSAYGDRNLMCSCIPVEEYAQEQ  961



>ref|WP_026951829.1| glycine dehydrogenase [Algoriphagus mannitolivorans]
Length=964

 Score =   378 bits (971),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 191/290 (66%), Positives = 222/290 (77%), Gaps = 7/290 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG+IGADVCHLNLHKTFCIPHGGGGPGMGPI V  HLAPFLP +P+V 
Sbjct  682   GANMNAQVGLTSPGYIGADVCHLNLHKTFCIPHGGGGPGMGPICVAAHLAPFLPGNPIVK  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       Q + +ISAAP+GSA ILPISY YIAMMG  GLT+A+KIAILNANY+ +RL
Sbjct  742   TGG------EQAVSSISAAPYGSASILPISYAYIAMMGGDGLTNATKIAILNANYIKERL  795

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               HYP+L+ G  G  AHE I+D R FK   G+E ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  796   SGHYPILYTGSKGRAAHEMIVDCRSFKEV-GVEVEDIAKRLMDYGFHAPTVSFPVAGTLM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+KAELD+FCD LISIREEI +IE GK D   NVLKNAPH   +++   W  PY
Sbjct  855   IEPTESETKAELDKFCDALISIREEIREIETGKADKEQNVLKNAPHTADMVLVGEWNLPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAA  183
             SRE A FP   +K  KFWP+  R+D+ YGDRNL+C+ +PV +    E  A
Sbjct  915   SREKAVFPLASVKENKFWPSVRRIDSAYGDRNLVCSCIPVEEYAGQEEMA  964



>ref|WP_015198875.1| glycine dehydrogenase [Calothrix parietina]
 gb|AFZ02247.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 6303]
Length=961

 Score =   378 bits (970),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 222/285 (78%), Gaps = 6/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP HPV+ 
Sbjct  683   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHPVIE  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G        + +GA+SAAPWGSA IL IS+ YI MMG+ GLT+A+KIAILNANY+AKRL
Sbjct  743   IG------SEKSIGAVSAAPWGSASILVISWMYIVMMGASGLTEATKIAILNANYIAKRL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVL++G NG VAHE I+DLR  K +A I+ +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  797   EGHYPVLYKGSNGYVAHECILDLRALKKSANIDIDDVAKRLMDYGFHAPTVSWPVAGTIM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFCD LI+IR EIA IE GK DI +N+LKNAPH    L++  WT PY
Sbjct  857   VEPTESESKAELDRFCDALIAIRAEIALIEAGKMDIQDNLLKNAPHTAESLISGEWTHPY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             +RE AA+PA W +  KFW +  R+D  +GDRN +C+ LP+    E
Sbjct  917   TREEAAYPAPWTRDNKFWVSVSRIDAAFGDRNFVCSCLPMDAYSE  961



>ref|WP_011614237.1| glycine dehydrogenase [Trichodesmium erythraeum]
 gb|ABG53943.1| glycine dehydrogenase (decarboxylating) beta subunit / glycine 
dehydrogenase (decarboxylating) alpha subunit [Trichodesmium 
erythraeum IMS101]
Length=974

 Score =   378 bits (970),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 220/280 (79%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P  IGADVCHLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLP H V+ 
Sbjct  697   GANMNAQVGLCRPAEIGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPGHSVIN  756

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG  S       GA+SAAPWGSA ILPIS+ YIAMMG+ GLT+A+KIAILNANY+A+RL
Sbjct  757   LGGENSS------GAVSAAPWGSASILPISWMYIAMMGTDGLTEATKIAILNANYIAQRL  810

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               +Y VL++G  G +AHE I+DLR  K  AGIE ED+AKRLMDYGFH PT+SWPV GT+M
Sbjct  811   GSYYSVLYKGKYGFIAHECILDLRPLKKLAGIEVEDIAKRLMDYGFHAPTVSWPVAGTIM  870

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +ISIR+EI +IE GK D N+N+LKNAPH    LM D W   Y
Sbjct  871   VEPTESESKDELDRFCDAMISIRQEIEEIETGKADKNDNLLKNAPHTAESLMVDEWKHGY  930

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SR+ AA+PA W +  KFWP  GRVDN +GDRN +C+ LP+
Sbjct  931   SRQRAAYPAPWTREHKFWPAVGRVDNAFGDRNFVCSCLPI  970



>ref|WP_017319421.1| glycine dehydrogenase [Mastigocladopsis repens]
Length=981

 Score =   377 bits (969),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 220/280 (79%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P  IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  705   GANMNAQVGLCRPEDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLMPFLPGHSVVK  764

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G       Q +GA+SAAPWGSA IL IS+ YIAMMG+ GLT+A+K+AILNANY+AK+L
Sbjct  765   MDG------EQRIGAVSAAPWGSASILVISWMYIAMMGADGLTEATKVAILNANYIAKKL  818

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  819   EPYYPVLYKGKNGLVAHECILDLRSLKKSALIEIDDVAKRLMDYGFHAPTVSWPVSGTIM  878

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NVLKNAPH    L+   W  PY
Sbjct  879   VEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQDNVLKNAPHTAESLIVGEWNHPY  938

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W +  KFWP  GR+DN YGDRN +C+ LP+
Sbjct  939   SREQAAYPAPWTREHKFWPAVGRIDNAYGDRNFVCSCLPM  978



>ref|WP_039128745.1| glycine dehydrogenase [Flavihumibacter sp. ZG627]
 gb|KIC91589.1| glycine dehydrogenase [Flavihumibacter sp. ZG627]
Length=960

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 219/288 (76%), Gaps = 7/288 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTF IPHGGGGPGMGPI VK HL P LP H    
Sbjct  680   GANMNAQVGLTSPGLIGADVCHLNLHKTFAIPHGGGGPGMGPICVKAHLEPHLPGHWATG  739

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G           GA+SAAP+GSA IL ISY Y  M+GS+GL  A++ AILNANYM  RL
Sbjct  740   NG-------ENEYGAVSAAPYGSASILLISYAYCRMLGSEGLRMATEYAILNANYMKSRL  792

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             +K Y VL+ G NGT AHEFI+DLR FK +AGIEAEDVAKRLMDYGFH PTMS+PVPGT+M
Sbjct  793   DKAYSVLYNGRNGTCAHEFIVDLRPFKTSAGIEAEDVAKRLMDYGFHAPTMSFPVPGTIM  852

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD ++SIREEIA IE G  D  NN LKNAPH   L+ AD W KPY
Sbjct  853   IEPTESEDKAELDRFCDAMLSIREEIAAIENGLADKGNNALKNAPHTQFLITADQWDKPY  912

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SR+ AAFP  ++K  KFWP+  RV+N +GDRNLICT  PVS   E+EA
Sbjct  913   SRQKAAFPLPYVKENKFWPSVSRVNNTFGDRNLICTCEPVSSYAEEEA  960



>ref|WP_015212883.1| Glycine dehydrogenase (decarboxylating) [Anabaena cylindrica]
 gb|AFZ56230.1| Glycine dehydrogenase (decarboxylating) [Anabaena cylindrica 
PCC 7122]
Length=963

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/281 (68%), Positives = 220/281 (78%), Gaps = 8/281 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  688   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHSVVK  747

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG         LGA+SAAPWGSA IL IS+ YIAMMG+ GLT A+K+AILNANY+AKRL
Sbjct  748   MGG--------ELGAVSAAPWGSASILVISWMYIAMMGADGLTQATKVAILNANYIAKRL  799

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  800   ESYYPVLYQGKNGLVAHECILDLRSLKKSAHIEIDDVAKRLMDYGFHAPTVSWPVAGTIM  859

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFC+ LI+IREE+A IE GK DI +N+LKNAPH    L+   W  PY
Sbjct  860   VEPTESESKQELDRFCNALIAIREEVAAIESGKMDIQDNLLKNAPHTAESLIIGEWNHPY  919

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+ 
Sbjct  920   SREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCLPME  960



>gb|EPR71506.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Cyclobacterium qasimii M12-11B]
Length=879

 Score =   374 bits (961),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 226/288 (78%), Gaps = 7/288 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V KHL PFLP +P V 
Sbjct  599   GANMNAQVGLTSPGMIGADVCHLNLHKTFCIPHGGGGPGMGPICVAKHLVPFLPGNPYVK  658

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG+ +      +  IS+AP+GSA ILPI Y YIAMMG +GL+ A++IAILN NY+  RL
Sbjct  659   TGGVAA------ITPISSAPYGSASILPIPYAYIAMMGEEGLSKATRIAILNTNYIKSRL  712

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E  YP+L+ G NG  AHE I+D R FK  A +E ED+AKRLMDYGFH PT+S+PVPGTLM
Sbjct  713   ESDYPILYTGTNGRAAHEMILDCRAFKE-ASVEVEDIAKRLMDYGFHAPTVSFPVPGTLM  771

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD +ISIR+EI ++E+GK D  +NVLKNAPH  +++++D W  PY
Sbjct  772   VEPTESESKEELDRFCDAMISIRQEIREVEEGKADKVSNVLKNAPHTAAVVISDTWELPY  831

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SRE AA+P  +++  KFWP+ GR+D  YGDRNL+C+ +P S+   +EA
Sbjct  832   SREKAAYPLPFVRERKFWPSVGRIDAAYGDRNLMCSCIPTSEFATEEA  879



>ref|WP_033335677.1| glycine dehydrogenase [Scytonema hofmanni]
Length=983

 Score =   377 bits (967),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 225/289 (78%), Gaps = 9/289 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  692   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHVVVG  751

Query  872   TGG-----IPSPD----KSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAIL  720
              G      +PS       SQ +GA+SAAPWGSA IL IS+ YIAMMG+ GLT+A+K+AIL
Sbjct  752   HGKENQYLVPSAQFSVPNSQRVGAVSAAPWGSASILVISWMYIAMMGTVGLTEATKVAIL  811

Query  719   NANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTM  540
             NANY+A+RLE +YPVL++G N  VAHE I+DLR  K +A IE +D+AKRLMDYGFH PT+
Sbjct  812   NANYIARRLESYYPVLYKGKNNLVAHECILDLRSLKKSASIEIDDIAKRLMDYGFHAPTV  871

Query  539   SWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLL  360
             SWPV GT+M+EPTESES+ ELDRFCD LI+IR+EIA+IE GK DI +NVLKNAPH    L
Sbjct  872   SWPVAGTIMVEPTESESQEELDRFCDALIAIRQEIAEIESGKMDIQDNVLKNAPHTAESL  931

Query  359   MADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             +   W  PYSRE AA+PA W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  932   IVGEWKHPYSREQAAYPAPWTREHKFWPSVGRIDAAFGDRNFVCSCLPM  980



>ref|WP_015225454.1| glycine dehydrogenase (decarboxylating) beta subunit [Halothece 
sp. PCC 7418]
 gb|AFZ43578.1| glycine dehydrogenase (decarboxylating) beta subunit [Halothece 
sp. PCC 7418]
Length=977

 Score =   377 bits (967),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 226/285 (79%), Gaps = 6/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQ+GL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV+ HL PFLP HPV+ 
Sbjct  699   GANMNAQLGLCRPGDYGADVCHLNLHKTFCIPHGGGGPGMGPIGVQDHLKPFLPRHPVIE  758

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       Q +GA++AAPWGS  ILPIS+ +IAMMG++GLT ASK+AILNANYMA RL
Sbjct  759   TGG------EQAIGAVAAAPWGSPSILPISWMFIAMMGAKGLTHASKVAILNANYMAHRL  812

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             ++HYPVL++G    VAHE IIDLR  K +A I  +D+AKRLMD+GFH PT+SWPV GT+M
Sbjct  813   DEHYPVLYKGNADLVAHECIIDLRLVKKSANIGVDDIAKRLMDFGFHAPTVSWPVAGTMM  872

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFCD +I+IR+EI+ IE G+ D  NNVLKNAPH   +++ D W +PY
Sbjct  873   IEPTESESKEELDRFCDAMIAIRKEISAIEMGEVDPENNVLKNAPHTHEMVIGDDWQRPY  932

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE AA+P+ WL+  KFWP+ GR+DN +GDRNL+C+ + +    E
Sbjct  933   SREKAAYPSDWLRDYKFWPSVGRIDNAFGDRNLVCSCVGMEAYTE  977



>ref|WP_015081132.1| glycine dehydrogenase [Anabaena sp. 90]
 gb|AFW95989.1| glycine dehydrogenase (decarboxylating) [Anabaena sp. 90]
Length=961

 Score =   376 bits (966),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 220/280 (79%), Gaps = 8/280 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  686   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHSVVR  745

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG         LGA+SAAPWGSA IL IS+ YI MMG+ GLT+A+KIAILNANYMAK+L
Sbjct  746   MGG--------DLGAVSAAPWGSASILVISWMYIIMMGADGLTEATKIAILNANYMAKKL  797

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  798   ESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDYGFHAPTVSWPVAGTIM  857

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD LI+IREE+A IE G  DI++N+LKNAPH    L+   W  PY
Sbjct  858   VEPTESESKQELDRFCDALIAIREEVAAIESGTMDIHDNLLKNAPHTAESLIIGEWNHPY  917

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  918   SREQAAYPALWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  957



>ref|WP_015264586.1| glycine dehydrogenase, decarboxylating [Echinicola vietnamensis]
 gb|AGA77020.1| glycine dehydrogenase, decarboxylating [Echinicola vietnamensis 
DSM 17526]
Length=966

 Score =   376 bits (966),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 223/288 (77%), Gaps = 7/288 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V KHL  FLPS P+V 
Sbjct  684   GANMNAQVGLTSPGVIGADVCHLNLHKTFCIPHGGGGPGMGPICVAKHLEEFLPSSPLVK  743

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       QP+ AISAAP+GSA ILPISY YIAMMG +GL  A++ AILNANY+  RL
Sbjct  744   TGG------QQPISAISAAPFGSASILPISYAYIAMMGREGLKHATQTAILNANYIKARL  797

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
              + +P L+ G  G  AHE I+D R FK   G+E ED+AKRL+DYGFH PT+S+PV GT+M
Sbjct  798   GEFFPTLYTGAQGRAAHEMIVDFREFK-AVGVEVEDIAKRLIDYGFHSPTVSFPVAGTMM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD LI+IR EI +IE+GK D  NNVLKNAPH   ++M+DAW  PY
Sbjct  857   IEPTESESKAELDRFCDALIAIRGEIREIEEGKADAENNVLKNAPHTAGMVMSDAWDMPY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEA  189
             SRE A +P +++K +KFWPT  R+D+ YGDRNL+C+ +P     E+ A
Sbjct  917   SREKAVYPLEYVKNSKFWPTVRRIDSAYGDRNLVCSCIPTEDYAEEAA  964



>ref|XP_007902171.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Callorhinchus milii]
Length=943

 Score =   375 bits (964),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 195/281 (69%), Positives = 224/281 (80%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LPSHPV+P
Sbjct  651   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPSHPVIP  710

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                + S   ++PLG ISAAPWGS+ ILPIS  YI MMG+ GL  A++IAILNANYMAKRL
Sbjct  711   ---LVSDSDARPLGTISAAPWGSSAILPISLAYIKMMGANGLRHATEIAILNANYMAKRL  767

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E  Y ++FRG  G VAHEFI+D+R FK TA IEA DVAKRL DYGFH PTMSWPV GTLM
Sbjct  768   ETVYKIVFRGAKGYVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVSGTLM  827

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +ISIR+EIA IE+GK DI  N LK APH  + + A  W +PY
Sbjct  828   IEPTESEDKAELDRFCDAMISIRQEIADIEEGKMDIRVNPLKMAPHTLACIAASNWDRPY  887

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AAFP Q++K   KFWPT  R+D++YGD+NL+C+  P+
Sbjct  888   SREQAAFPLQFVKPETKFWPTIARIDDLYGDQNLVCSCPPM  928



>ref|WP_009457628.1| glycine dehydrogenase [Fischerella sp. JSC-11]
 gb|EHC12211.1| Glycine dehydrogenase (decarboxylating) [Fischerella sp. JSC-11]
Length=965

 Score =   376 bits (965),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 222/281 (79%), Gaps = 6/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL  FLP H V  
Sbjct  686   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLVEFLPGHAV--  743

Query  872   TGGIPSPDKS-QPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                I  PD + + +GA+SAAPWGSA IL IS+ YIAMMG+ GLTDA+K+AILNANY+AKR
Sbjct  744   ---IAMPDYNPKSIGAVSAAPWGSASILVISWMYIAMMGATGLTDATKVAILNANYIAKR  800

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LE HYP+L++G NG VAHE I+DLR  K +A IE +D+AKRLMDYGFH PT+SWPV GT+
Sbjct  801   LEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIAKRLMDYGFHAPTVSWPVAGTI  860

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +NVLKNAPH    L+   W  P
Sbjct  861   MVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQDNVLKNAPHTAESLIIGEWNHP  920

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             YSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  921   YSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  961



>ref|XP_009575710.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Fulmarus glacialis]
Length=451

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 223/282 (79%), Gaps = 4/282 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  159   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVI-  217

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I     ++PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKRL
Sbjct  218   --KIQLDKDARPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKRL  275

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHY +LFRG  G VAHEFI+D R FK +A IEA D+AKRL DYGFH PTMSWPV GTLM
Sbjct  276   EKHYKILFRGARGYVAHEFILDTRPFKKSANIEAVDLAKRLQDYGFHAPTMSWPVAGTLM  335

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +I IR+EIA+IE+G+ D   N LK +PH  + + +  W +PY
Sbjct  336   IEPTESEDKAELDRFCDAMIGIRQEIAEIEEGRMDPQINPLKMSPHTLNCVTSSKWDRPY  395

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  396   SREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  437



>ref|WP_016866657.1| glycine dehydrogenase [Fischerella muscicola]
Length=979

 Score =   376 bits (966),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 222/281 (79%), Gaps = 6/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL  FLP H V  
Sbjct  700   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLVEFLPGHAV--  757

Query  872   TGGIPSPDKS-QPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                I  PD + + +GA+SAAPWGSA IL IS+ YIAMMG+ GLTDA+K+AILNANY+AKR
Sbjct  758   ---IAMPDYNPKSMGAVSAAPWGSASILVISWMYIAMMGATGLTDATKVAILNANYIAKR  814

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LE HYP+L++G NG VAHE I+DLR  K +A IE +D+AKRLMDYGFH PT+SWPV GT+
Sbjct  815   LEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIAKRLMDYGFHAPTVSWPVAGTI  874

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +NVLKNAPH    L+   W  P
Sbjct  875   MVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQDNVLKNAPHTAESLIIGEWNHP  934

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             YSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  935   YSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  975



>ref|WP_016870901.1| glycine dehydrogenase [Fischerella thermalis]
Length=965

 Score =   376 bits (965),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 189/281 (67%), Positives = 222/281 (79%), Gaps = 6/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL  FLP H V  
Sbjct  686   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLVEFLPGHAV--  743

Query  872   TGGIPSPDKS-QPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                I  PD + + +GA+SAAPWGSA IL IS+ YIAMMG+ GLTDA+K+AILNANY+AKR
Sbjct  744   ---IAMPDYNPKSIGAVSAAPWGSASILVISWMYIAMMGATGLTDATKVAILNANYIAKR  800

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LE HYP+L++G NG VAHE I+DLR  K +A IE +D+AKRLMDYGFH PT+SWPV GT+
Sbjct  801   LEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIAKRLMDYGFHAPTVSWPVAGTI  860

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +NVLKNAPH    L+   W  P
Sbjct  861   MVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQDNVLKNAPHTAESLIIGEWNHP  920

Query  335   YSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             YSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  921   YSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  961



>ref|XP_003510272.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Cricetulus griseus]
Length=646

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 191/281 (68%), Positives = 224/281 (80%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHP+V 
Sbjct  354   GANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPSHPIV-  412

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I   + + P+G +SAAPWGS+ ILPIS+ YI MMGS+GL +A++IAILNANYMAKRL
Sbjct  413   --SIKPNEDTWPVGTVSAAPWGSSSILPISWAYIKMMGSKGLKEATEIAILNANYMAKRL  470

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHY VLFRG  G VAHEFI+D R FK +A IEA DVAKRL DYGFH PTMSWPV GTLM
Sbjct  471   EKHYRVLFRGARGYVAHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLM  530

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N LK +PH  + + +  W +PY
Sbjct  531   IEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSRWDRPY  590

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AAFP  ++K   KFWPT  R+D++YGD++L+CT  P+
Sbjct  591   SREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPM  631



>gb|EMO24999.1| glycine dehydrogenase-like protein [Leptospira interrogans serovar 
Bataviae str. HAI135]
Length=512

 Score =   363 bits (932),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 223/280 (80%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPG+GPIGV KHL PFLP H ++ 
Sbjct  235   GANMNAQVGLTSPGEIGADVCHLNLHKTFCIPHGGGGPGVGPIGVAKHLVPFLPGHVLID  294

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                          GA+SAAPWGSA I+ IS+ YIA+MGS+GLT+A++ +ILNANY+AKRL
Sbjct  295   N------KTGNEHGAVSAAPWGSASIILISWVYIALMGSEGLTNATRNSILNANYIAKRL  348

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EK YPVL++G NG VAHE I+DLR FK +AGIE EDVAKRL+DYGFH PTMS+PVPGTLM
Sbjct  349   EKVYPVLYKGKNGFVAHECILDLRPFKKSAGIEVEDVAKRLIDYGFHAPTMSFPVPGTLM  408

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESES  ELDRFC+ ++ I +EI  ++ G  D  +N+LKN+PH  +++ +D W   Y
Sbjct  409   IEPTESESLEELDRFCEAMLLIFQEILDVQNGILDKTDNLLKNSPHTAAMVTSDRWDHLY  468

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA WLK  KFWP  GRVDNVYGDRNL+C+ LP+
Sbjct  469   SRERAAYPASWLKDHKFWPYVGRVDNVYGDRNLVCSCLPI  508



>ref|WP_035401444.1| glycine dehydrogenase [Chlorobium sp. GBChlB]
 gb|KER10014.1| glycine dehydrogenase [Chlorobium sp. GBChlB]
Length=972

 Score =   376 bits (965),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 195/289 (67%), Positives = 225/289 (78%), Gaps = 7/289 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSP  IGADVCHLNLHKTFCIPHGGGGPGMGPIGV KHLAPFLP H +V 
Sbjct  688   GANMNAQVGLTSPANIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAKHLAPFLPKHRLVE  747

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       + + A+SAAP+GSA ILPISY YIAMMG  GLT+A+K+AILNANY+  RL
Sbjct  748   TGG------EKGITAVSAAPYGSASILPISYAYIAMMGGDGLTNATKMAILNANYIKARL  801

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E  YPVL+   NG  AHE IIDLR FK   GIEAEDVAKRLMDYGFH PT+S+PV GT+M
Sbjct  802   EGEYPVLYTNQNGRCAHEMIIDLRPFK-AVGIEAEDVAKRLMDYGFHAPTLSFPVAGTIM  860

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE K+ELDRFC+ ++SIREEI +IE GK D  NNVLKNAPH  +++M+DAW KPY
Sbjct  861   IEPTESEPKSELDRFCEAMLSIREEIREIEHGKADRANNVLKNAPHTAAMVMSDAWDKPY  920

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAA  186
             SRE AA+P  +++ AK W T  R+D  YGDRNL+C   P+    + E A
Sbjct  921   SREKAAYPLAFVREAKIWATVRRIDGAYGDRNLVCACEPIESYADVEKA  969



>ref|WP_039895601.1| glycine dehydrogenase, partial [Lyngbya sp. PCC 8106]
Length=950

 Score =   375 bits (963),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 188/281 (67%), Positives = 218/281 (78%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP H VV 
Sbjct  669   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLIPFLPGHSVVT  728

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                    D  Q LGAISAAPWGS  IL IS+ YIAMMG++GLT+A+K+AILNANYMA RL
Sbjct  729   M----QDDNPQSLGAISAAPWGSPSILVISWMYIAMMGAEGLTEATKVAILNANYMAFRL  784

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             +  YP+L++G NG +AHE I+DLRG K +A IE +D+AKRLMD+GFH PT+SWPVPGT+M
Sbjct  785   KDAYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIAKRLMDFGFHAPTVSWPVPGTMM  844

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFC+ +I+IR EI  IE G  D  NN LKNAPH    L+   W  PY
Sbjct  845   VEPTESESKAELDRFCEAMIAIRREIGAIESGDIDTENNPLKNAPHTAESLIVGEWNHPY  904

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ LP+ 
Sbjct  905   SREQAAYPAPWLREHKFWPSVGRIDNAYGDRNFVCSCLPME  945



>ref|XP_001507722.2| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Ornithorhynchus anatinus]
Length=718

 Score =   369 bits (947),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 193/282 (68%), Positives = 224/282 (79%), Gaps = 6/282 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVK+HLAPFLP+HPV+ 
Sbjct  426   GANMNAQVGLCRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKQHLAPFLPNHPVIS  485

Query  872   TGGIPSPDK-SQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                   PDK ++ LG ISAAPWGS+ ILPIS+ YI MMG +GL  A++IAILNANYMAKR
Sbjct  486   M----QPDKDARSLGTISAAPWGSSAILPISWAYIKMMGGKGLKHATEIAILNANYMAKR  541

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LEKHY VLFRG  G VAHEFI+D R FK +A IEA DVAKRL DYGFH PTMSWPV GTL
Sbjct  542   LEKHYKVLFRGARGYVAHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTL  601

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N LK APH  + + +  W +P
Sbjct  602   MIEPTESEDKAELDRFCDAMISIRQEIADIEEGRMDSRVNPLKMAPHSLTCITSSNWDRP  661

Query  335   YSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             YSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+
Sbjct  662   YSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPM  703



>ref|WP_026955360.1| glycine dehydrogenase [Algoriphagus vanfongensis]
Length=964

 Score =   375 bits (964),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 185/290 (64%), Positives = 227/290 (78%), Gaps = 7/290 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V  HLAPFLP +P+V 
Sbjct  682   GANMNAQVGLTSPGRIGADVCHLNLHKTFCIPHGGGGPGMGPICVAAHLAPFLPGNPIVK  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      ++ + ++SAAP+GSA ILPISY YIAMMG  GLT+A+K+AILNANY+ +RL
Sbjct  742   TGG------TKAVSSVSAAPYGSASILPISYAYIAMMGGDGLTNATKMAILNANYIKERL  795

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + H+P+L+ G  G  AHE I+D RGFK   G+E ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  796   DGHFPILYTGTQGRAAHEMIVDCRGFKEV-GVEVEDIAKRLMDYGFHAPTVSFPVAGTLM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE+KAELD+FCD L+SIR EI +IE+GK D  NNVLKNAPH   +++   W  PY
Sbjct  855   IEPTESETKAELDKFCDALVSIRAEIKEIEEGKADKENNVLKNAPHTSQMVLVGEWDLPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAA  183
             SRE A +P +++K  KFWP+  R+D+ +GDRNL+C+ +PV     +E  A
Sbjct  915   SREKAVYPLEYVKENKFWPSVRRIDSAFGDRNLMCSCIPVDAYASEEEMA  964



>ref|WP_043391215.1| glycine dehydrogenase [Cystobacter violaceus]
 gb|KFA93774.1| glycine dehydrogenase [Cystobacter violaceus Cb vi76]
Length=965

 Score =   375 bits (963),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 228/292 (78%), Gaps = 6/292 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLTSP  IGADVCH+NLHKTFCIPHGGGGPGMGPI V  HL  FLP H V+ 
Sbjct  680   GANLNAQVGLTSPAAIGADVCHINLHKTFCIPHGGGGPGMGPICVASHLVKFLPRHSVIS  739

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +  +GA+SAAPWGSA IL IS+ YIAMMG++GLT A+K+AILNANY+A+RL
Sbjct  740   TGG------NDGIGAVSAAPWGSASILVISWMYIAMMGAEGLTKATKLAILNANYIAERL  793

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             ++HYPVL+RG  G VAHE I+DLR  K TAG+E EDVAKRLMDYGFH PT+S+PV GTLM
Sbjct  794   QEHYPVLYRGKRGRVAHECIVDLRHLKKTAGVEVEDVAKRLMDYGFHAPTVSFPVAGTLM  853

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAE+DR CD LISIR EI +IE+GK   +NNVLKNAPH   ++    W +PY
Sbjct  854   IEPTESESKAEIDRLCDALISIRGEIREIEEGKAPRDNNVLKNAPHTARVMTDPEWNRPY  913

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SRE AAFPA W+   KFWP+ GR++NV GDR L+C+  P+   +  E + +A
Sbjct  914   SREQAAFPAPWVAEHKFWPSVGRLNNVLGDRKLVCSCPPIEDYMSPEPSRAA  965



>ref|WP_015130859.1| glycine dehydrogenase [Calothrix sp. PCC 7507]
 gb|AFY35062.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 7507]
Length=980

 Score =   375 bits (964),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 228/289 (79%), Gaps = 12/289 (4%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP HPV+ 
Sbjct  690   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLVPFLPGHPVLG  749

Query  872   TGG---------IPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAIL  720
             TG          +P+   +Q +GAI+AAPWGSA IL IS+ YIAMMG+  LT A+K+AIL
Sbjct  750   TGDWELGTRKEKVPN---NQRIGAIAAAPWGSASILVISWMYIAMMGAVSLTQATKVAIL  806

Query  719   NANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTM  540
             NANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +D+AKRL+DYGFH PT+
Sbjct  807   NANYIAKRLESYYPVLYKGKNGLVAHECILDLRSLKKSASIEIDDIAKRLIDYGFHAPTV  866

Query  539   SWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLL  360
             SWPV GT+M+EPTESESKAELDRFCD LI+IR+EIA+IE GK DI +N+LKN+PH  + L
Sbjct  867   SWPVAGTIMVEPTESESKAELDRFCDALIAIRQEIAEIESGKVDIQDNLLKNSPHTAASL  926

Query  359   MADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             +   W  PYSRE AA+PA W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  927   ITGDWQHPYSREQAAYPAPWTREHKFWPSVGRIDAAFGDRNFVCSCLPM  975



>ref|WP_012410110.1| glycine dehydrogenase (decarboxylating) [Nostoc punctiforme]
 sp|B2J427.1|GCSP_NOSP7 RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Nostoc punctiforme PCC 73102]
 gb|ACC82139.1| glycine dehydrogenase [Nostoc punctiforme PCC 73102]
Length=979

 Score =   375 bits (963),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 220/280 (79%), Gaps = 3/280 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP HPVV 
Sbjct  698   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHPVVT  757

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I    +   +GA++AAPWGSA IL IS+ YIAMMG+ GLT A+K+AILNANY+AK+L
Sbjct  758   ---INDSTQHSHIGAVAAAPWGSASILVISWMYIAMMGADGLTQATKVAILNANYIAKKL  814

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  815   ESYYPVLYQGKNGLVAHECILDLRSLKKSAAIEIDDVAKRLMDYGFHAPTVSWPVGGTIM  874

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD LI+IR+EIA+IE GK D  +NVLKNAPH    L+   W  PY
Sbjct  875   VEPTESESKQELDRFCDALIAIRQEIAEIEVGKVDAQDNVLKNAPHTAESLITGEWQHPY  934

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  935   SREQAAYPAPWTREYKFWPAVGRIDAAFGDRNFVCSCLPM  974



>ref|WP_017289075.1| glycine dehydrogenase [Leptolyngbya boryana]
Length=974

 Score =   375 bits (963),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 222/280 (79%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPG+GPIGV  HL PFLP+H VV 
Sbjct  697   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGVGPIGVASHLVPFLPNHSVVA  756

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             T G         +GA+SAAPWGSA ILPIS+ YIAMMG QGLT+A++IAILNANY+AKRL
Sbjct  757   TSG------ESGIGAVSAAPWGSASILPISWMYIAMMGGQGLTEATEIAILNANYIAKRL  810

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVL++G NG VAHE I+DLR FK  A IE +D+AKRL+DYGFH PT+SWPV GT+M
Sbjct  811   EGHYPVLYKGKNGWVAHECILDLREFKKNADIEVDDIAKRLIDYGFHPPTVSWPVAGTVM  870

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFCD +I+IREEI  IE G  D  NN+LKNAPH  + L ++ W +PY
Sbjct  871   VEPTESESKAELDRFCDAMIAIREEIRAIENGNVDRTNNLLKNAPHTVADLTSETWDRPY  930

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SR+ A FP  W K  KF+P  GR+DN +GDRNL+C+ LP+
Sbjct  931   SRQEAIFPTTWTKANKFYPAVGRIDNAFGDRNLVCSCLPM  970



>ref|WP_009094772.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
 gb|EMI46247.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
Length=990

 Score =   375 bits (964),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 218/280 (78%), Gaps = 4/280 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV   LAPFLP HPV  
Sbjct  711   GANMNAQVGLTSPGKCGADVCHLNLHKTFCIPHGGGGPGMGPIGVAPQLAPFLPEHPVQR  770

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                 P       +G +SAAP+GSA IL ISY YIAMMG+ GL  A+++AILNANYMAKRL
Sbjct  771   ----PDTAGEFSIGPVSAAPYGSASILAISYVYIAMMGASGLKKATQVAILNANYMAKRL  826

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               HY +L+   NG VAHEFI+D RGF+ +AG++ ED+AKRLMDYGFHGPTMSWPVPGTLM
Sbjct  827   SDHYDILYTDANGYVAHEFIVDCRGFEKSAGVQIEDIAKRLMDYGFHGPTMSWPVPGTLM  886

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFCD +ISIR EI  I+ G  D  +N LKNAPH    + +D W+ PY
Sbjct  887   IEPTESESKDELDRFCDAMISIRAEIQSIQDGTLDAKDNPLKNAPHTVGAIGSDNWSHPY  946

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             +RE AA+P  WL+ AKFWPT GR+DN YGDRNL+C+  P+
Sbjct  947   TREQAAWPKAWLRDAKFWPTVGRIDNTYGDRNLVCSCPPM  986



>ref|WP_008684764.1| glycine dehydrogenase [Rhodopirellula sallentina]
 gb|EMI53503.1| glycine dehydrogenase [Rhodopirellula sallentina SM41]
Length=990

 Score =   375 bits (963),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 221/280 (79%), Gaps = 4/280 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV   LAPFLP HPV  
Sbjct  711   GANMNAQVGLTSPGTCGADVCHLNLHKTFCIPHGGGGPGMGPIGVAPQLAPFLPEHPVQR  770

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                 P       +G +SAAP+GSA IL ISY YIAMMG+ GL  A+++AILNANYMAKRL
Sbjct  771   ----PDTAGEFSIGPVSAAPYGSASILAISYVYIAMMGASGLKKATQVAILNANYMAKRL  826

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
              +H+ +L+   NG VAHEFI+D RGF+ +AG++ +D+AKRLMDYGFHGPTMSWPVPGTLM
Sbjct  827   SEHFNILYTDSNGYVAHEFIVDCRGFEKSAGVQIDDIAKRLMDYGFHGPTMSWPVPGTLM  886

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESK ELDRFCD +I+IREEI  I+ GK D  +N LKNAPH    + +D W+ PY
Sbjct  887   IEPTESESKDELDRFCDAMIAIREEIQSIQDGKLDAKDNPLKNAPHTVGEIGSDDWSHPY  946

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             +RE AA+P  WL+ AKFWPT GR+DN YGDRNL+C+  P+
Sbjct  947   TREQAAWPKAWLRDAKFWPTVGRIDNTYGDRNLVCSCPPM  986



>gb|EAW38056.1| glycine dehydrogenase [Lyngbya sp. PCC 8106]
Length=992

 Score =   375 bits (963),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 218/280 (78%), Gaps = 4/280 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP H VV 
Sbjct  711   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLIPFLPGHSVVT  770

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                    D  Q LGAISAAPWGS  IL IS+ YIAMMG++GLT+A+K+AILNANYMA RL
Sbjct  771   M----QDDNPQSLGAISAAPWGSPSILVISWMYIAMMGAEGLTEATKVAILNANYMAFRL  826

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             +  YP+L++G NG +AHE I+DLRG K +A IE +D+AKRLMD+GFH PT+SWPVPGT+M
Sbjct  827   KDAYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIAKRLMDFGFHAPTVSWPVPGTMM  886

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFC+ +I+IR EI  IE G  D  NN LKNAPH    L+   W  PY
Sbjct  887   VEPTESESKAELDRFCEAMIAIRREIGAIESGDIDTENNPLKNAPHTAESLIVGEWNHPY  946

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ LP+
Sbjct  947   SREQAAYPAPWLREHKFWPSVGRIDNAYGDRNFVCSCLPM  986



>ref|WP_011319516.1| glycine dehydrogenase (decarboxylating) [Anabaena variabilis]
 sp|Q3M9G1.1|GCSP_ANAVT RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Anabaena variabilis ATCC 29413]
 gb|ABA22375.1| glycine dehydrogenase (decarboxylating) alpha subunit [Anabaena 
variabilis ATCC 29413]
Length=974

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 222/280 (79%), Gaps = 5/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL  FLP HPV+ 
Sbjct  696   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVRFLPGHPVLG  755

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             +G  P     Q +GA++AAPWGSA IL IS+ YIAMMG+ GLT A+K+AILNANY+AKRL
Sbjct  756   SGKNP-----QNIGAVAAAPWGSASILVISWMYIAMMGADGLTQATKVAILNANYIAKRL  810

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +D+AKRL+DYGFH PT+SWPV GT+M
Sbjct  811   ETYYPVLYKGQNGLVAHECILDLRALKKSANIEIDDIAKRLIDYGFHAPTVSWPVTGTIM  870

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESES+AELDRFCD LI+IR+EIA IE GK D +NN+LKNAPH    L+   W  PY
Sbjct  871   VEPTESESQAELDRFCDALIAIRQEIAAIEAGKMDTHNNLLKNAPHTIESLIVGEWLHPY  930

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+P  W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  931   SREQAAYPVSWTREYKFWPSVGRIDAAFGDRNFVCSCLPM  970



>ref|WP_015115551.1| glycine dehydrogenase (decarboxylating) beta subunit [Nostoc 
sp. PCC 7107]
 gb|AFY45362.1| glycine dehydrogenase (decarboxylating) beta subunit [Nostoc 
sp. PCC 7107]
Length=975

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/294 (65%), Positives = 225/294 (77%), Gaps = 11/294 (4%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VVP
Sbjct  685   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHAVVP  744

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                  +    Q  GA++AAPWGSA IL IS+ YIAMMG+ GLT+A+K+AILNANY+AKRL
Sbjct  745   L----NKSTQQSTGAVAAAPWGSASILVISWMYIAMMGAAGLTEATKVAILNANYIAKRL  800

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGF-------KNTAGIEAEDVAKRLMDYGFHGPTMSW  534
             E +YPVL++G NG VAHE I+DLR         K +A I+ +DVAKRLMDYGFH PT+SW
Sbjct  801   ENYYPVLYKGKNGLVAHECILDLRSLRGASPSLKKSANIDIDDVAKRLMDYGFHAPTVSW  860

Query  533   PVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMA  354
             PV GT+M+EPTESES+ ELDRFCD +I+IR+EIA+IE GK DI +N+LKNAPH    L+A
Sbjct  861   PVAGTIMVEPTESESQTELDRFCDAMIAIRQEIAEIESGKMDIEDNLLKNAPHTAESLIA  920

Query  353   DAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
               WT PYSRE AA+PA W +  KFWP+ GR+D  +GDRN +C+ LP+      E
Sbjct  921   GEWTHPYSREQAAYPAPWTREHKFWPSVGRIDAAFGDRNFVCSCLPMEAYSNSE  974



>ref|WP_002639796.1| glycine dehydrogenase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK85487.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) protein [Myxococcus sp. (contaminant ex DSM 436)]
Length=970

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/291 (65%), Positives = 227/291 (78%), Gaps = 6/291 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLT+PG IGADVCH+NLHKTFCIPHGGGGPGMGPI V  HL  FLP HPV+ 
Sbjct  684   GANLNAQVGLTAPGLIGADVCHINLHKTFCIPHGGGGPGMGPICVASHLVKFLPGHPVIN  743

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      S+ +GAISAAPWGSA IL IS+ YIAMMG +GLT A+K+AIL+ANY+A+RL
Sbjct  744   TGG------SEAIGAISAAPWGSASILLISWMYIAMMGGEGLTHATKVAILSANYIAERL  797

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HYPVL+RG  G VAHE I+DLR  K TAG+E EDVAKRLMDYGFH PT+S+PV GTLM
Sbjct  798   QPHYPVLYRGKRGKVAHECIVDLRPLKKTAGVEVEDVAKRLMDYGFHAPTVSFPVAGTLM  857

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD +I+IR+EI  IE+G+   +NNVLK+APH   ++ A  W  PY
Sbjct  858   IEPTESESKAELDRFCDAMIAIRQEIRDIEEGRMPKDNNVLKHAPHTSRVVTAPEWNHPY  917

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAAS  180
             SRE A FP  W++  KFWP+ GR+++V GDR L+C+  P    +  E  A+
Sbjct  918   SREQAVFPTPWVRENKFWPSVGRLNSVLGDRKLVCSCPPTEDYMTPEPTAA  968



>ref|WP_002627258.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Cystobacter fuscus]
 gb|EPX55665.1| Glycine dehydrogenase (glycine cleavage system P protein) [Cystobacter 
fuscus DSM 2262]
Length=965

 Score =   374 bits (960),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/292 (66%), Positives = 226/292 (77%), Gaps = 6/292 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLT P  IGADVCH+NLHKTFCIPHGGGGPGMGPI V  HL  FLP HPV+ 
Sbjct  680   GANLNAQVGLTKPAEIGADVCHINLHKTFCIPHGGGGPGMGPICVASHLTRFLPGHPVIA  739

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +  +GAISAAPWGSA IL IS+ YIAMMG  GLT A+K AILNANY+A+RL
Sbjct  740   TGG------NDGIGAISAAPWGSASILVISWMYIAMMGGDGLTRATKTAILNANYIAERL  793

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HYPVL+RG  G VAHE I+DLR  K T+G+E EDVAKRLMDYGFH PT+S+PV GTLM
Sbjct  794   QPHYPVLYRGKRGRVAHECIVDLRPLKKTSGVEVEDVAKRLMDYGFHAPTVSFPVSGTLM  853

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESES+AELDR CD LI+IREEI +IE G+   +NNVLKNAPH   ++ A  W +PY
Sbjct  854   IEPTESESQAELDRLCDALIAIREEIREIEDGRMPRDNNVLKNAPHTARVITAPEWNRPY  913

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  177
             SRE AAFPA W+K  KFWP+ GR++NV GDR L+C+  P+   +  E + +A
Sbjct  914   SREKAAFPAPWVKDHKFWPSVGRLNNVLGDRKLVCSCPPIEDYLPPEPSKAA  965



>ref|XP_010204576.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Colius striatus]
Length=667

 Score =   366 bits (939),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/283 (67%), Positives = 224/283 (79%), Gaps = 6/283 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HP++ 
Sbjct  375   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPIIK  434

Query  872   TGGIPSPDKSQ-PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                   PDK   PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKR
Sbjct  435   I----QPDKDACPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKR  490

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LEKHY +LFRG  G VAHEFI+D R FK TA IEA D+AKRL DYGFH PTMSWPV GTL
Sbjct  491   LEKHYKILFRGAGGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTL  550

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N LK +PH  + + +  W +P
Sbjct  551   MIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMSPHTLNCVTSSKWDRP  610

Query  335   YSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             YSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  611   YSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  653



>ref|WP_014397794.1| glycine dehydrogenase [Corallococcus coralloides]
 gb|AFE08892.1| glycine dehydrogenase [Corallococcus coralloides DSM 2259]
Length=967

 Score =   374 bits (960),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/281 (66%), Positives = 222/281 (79%), Gaps = 6/281 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLT+PG +GADVCH+NLHKTFCIPHGGGGPGMGPI V  HL  FLP HPV+ 
Sbjct  683   GANLNAQVGLTAPGLVGADVCHINLHKTFCIPHGGGGPGMGPICVASHLVKFLPGHPVIQ  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +  +GAISAAPWGSA IL IS+ YI MMG +GLT A+K+AILNANY+A+RL
Sbjct  743   TGG------ADAIGAISAAPWGSASILLISWMYIQMMGGEGLTQATKMAILNANYVAERL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             + HYPVL+RG  G VAHE I+DLR  K TAG+E EDVAKRLMDYGFH PT+S+PV GTLM
Sbjct  797   QPHYPVLYRGKRGRVAHECIVDLRPLKKTAGVEVEDVAKRLMDYGFHAPTVSFPVAGTLM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD +I+IR+EI  +E+G+   +NNVLKNAPH    L A  W +PY
Sbjct  857   IEPTESESKAELDRFCDAMIAIRQEIRDVEEGRAPKDNNVLKNAPHTARTLTAPEWNRPY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             +RE A FP  W++  KFWP+ GR++NV GDR L+C+  P+ 
Sbjct  917   TREQAVFPTPWVRDNKFWPSVGRLNNVLGDRKLVCSCPPIE  957



>ref|WP_028088591.1| glycine dehydrogenase [Dolichospermum circinale]
Length=956

 Score =   374 bits (959),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 220/280 (79%), Gaps = 8/280 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H V+ 
Sbjct  681   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHSVMK  740

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG         LGA+SAAPWGSA IL IS+ YI MMG+ GLT+A+KIAILNANYMAK+L
Sbjct  741   MGG--------NLGAVSAAPWGSASILVISWMYIIMMGADGLTEATKIAILNANYMAKKL  792

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  793   ESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDYGFHAPTVSWPVAGTIM  852

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFC+ LI+IR+EI++IE GK D+ +NVLKNAPH    L+   W   Y
Sbjct  853   VEPTESESKEELDRFCEALIAIRKEISEIESGKMDLQDNVLKNAPHTAESLIVGEWKHDY  912

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  913   SREQAAYPASWSKEYKFWPSVGRIDAAFGDRNFVCSCLPM  952



>ref|WP_027255179.1| glycine dehydrogenase [Planktothrix agardhii]
Length=958

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 221/280 (79%), Gaps = 7/280 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  682   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHGVVD  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G  +       GA+SAAPWGSA IL IS+ YIAMMG++GLT+A+K+AILNANY+A RL
Sbjct  742   IQGSQT-------GAVSAAPWGSASILVISWMYIAMMGAKGLTEATKLAILNANYIASRL  794

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             +K+YP+L++G  G VAHE I+DLRG K +AGIE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  795   DKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGTMM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFCD +I+I +EI++IE G  D  NN+LKNAPH    L+   W  PY
Sbjct  855   VEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNNMLKNAPHTAISLLCGEWNHPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  915   SREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  954



>gb|EOZ92310.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Indibacter alkaliphilus LW1]
Length=940

 Score =   373 bits (957),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 224/290 (77%), Gaps = 7/290 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V +HL PFLP +P++ 
Sbjct  658   GANMNAQVGLTSPGRIGADVCHLNLHKTFCIPHGGGGPGMGPICVAEHLVPFLPGNPLIE  717

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +  + +ISAAP+GSA ILPISY YIAMMG  GLT+A+KIAILNANY+  RL
Sbjct  718   TGG------TSAISSISAAPYGSASILPISYAYIAMMGGDGLTNATKIAILNANYIKSRL  771

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+L+ G  G  AHE I+D R FK   GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  772   ETHYPILYTGKEGRAAHEMILDCRAFKEI-GIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  830

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESE+KAELDRFCD +I+IR EI ++ +GK D  NNVLKNAPH   L +AD W  PY
Sbjct  831   VEPTESETKAELDRFCDAMIAIRAEIQEVYEGKADKENNVLKNAPHTAQLALADNWDFPY  890

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAA  183
             SRE A +P  ++K  KFWP+  RVD+ YGDRNL+C+ +PV +  + E  A
Sbjct  891   SREKAVYPLPFVKGNKFWPSVRRVDSAYGDRNLMCSCIPVEEYADAEVEA  940



>ref|WP_039200768.1| glycine dehydrogenase [Aphanizomenon flos-aquae]
 gb|KHG42226.1| glycine dehydrogenase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=967

 Score =   374 bits (959),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 222/286 (78%), Gaps = 9/286 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVV-  876
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H V  
Sbjct  681   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHFVTT  740

Query  875   -----PTGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNAN  711
                  P   I +P  S   GA+SAAPWGSA IL IS+ YI MMG+ GLT+A+KIAILNAN
Sbjct  741   IQENNPKSKIQNPKSS---GAVSAAPWGSASILVISWMYIIMMGADGLTEATKIAILNAN  797

Query  710   YMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWP  531
             YMAK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWP
Sbjct  798   YMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDYGFHAPTVSWP  857

Query  530   VPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMAD  351
             V GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++N+LKNAPH    L+  
Sbjct  858   VAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHDNLLKNAPHTAESLIVG  917

Query  350   AWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
              W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  918   EWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  963



>ref|WP_027401604.1| glycine dehydrogenase [Aphanizomenon flos-aquae]
Length=967

 Score =   374 bits (959),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/286 (67%), Positives = 222/286 (78%), Gaps = 9/286 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVV-  876
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H V  
Sbjct  681   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHFVTT  740

Query  875   -----PTGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNAN  711
                  P   I +P  S   GA+SAAPWGSA IL IS+ YI MMG+ GLT+A+KIAILNAN
Sbjct  741   IQENNPKSKIQNPKSS---GAVSAAPWGSASILVISWMYIIMMGADGLTEATKIAILNAN  797

Query  710   YMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWP  531
             YMAK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWP
Sbjct  798   YMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDYGFHAPTVSWP  857

Query  530   VPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMAD  351
             V GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++N+LKNAPH    L+  
Sbjct  858   VAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHDNLLKNAPHTAESLIVG  917

Query  350   AWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
              W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  918   EWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  963



>ref|WP_037356834.1| glycine dehydrogenase [Schleiferia thermophila]
 gb|KFD40185.1| glycine dehydrogenase [Schleiferia thermophila str. Yellowstone]
Length=953

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 223/286 (78%), Gaps = 6/286 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLT+P  IGADVCHLNLHKTF IPHGGGGPGMGPI V KHL+PFLP HP+V 
Sbjct  674   GANMNAQVGLTNPAAIGADVCHLNLHKTFAIPHGGGGPGMGPICVAKHLSPFLPGHPIVK  733

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG       Q + +ISAAP+GS LIL ISY YI M+G+QGLTDA+K AILNANY+  RL
Sbjct  734   TGG------KQAISSISAAPYGSGLILIISYAYIKMLGAQGLTDATKYAILNANYIKIRL  787

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EK+YPVL+ G NGTVAHE I+D R FK  A +E  D+AKRLMDYGFH PT+S+PV GTLM
Sbjct  788   EKYYPVLYTGENGTVAHELILDCRAFKRDANVEVVDIAKRLMDYGFHAPTVSFPVAGTLM  847

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAE+DRFC+ +ISIR EI +I  G  D + NVLKNAPH   LL +D W  PY
Sbjct  848   IEPTESESKAEIDRFCEAMISIRHEIEEIINGDADKSENVLKNAPHTLELLTSDEWKLPY  907

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVED  195
             SR+ AA+PA ++   KFWP+  RVD+ YGDRNL+CT  P++  VE+
Sbjct  908   SRQKAAYPAPFVFDNKFWPSVRRVDDAYGDRNLVCTCEPITSYVEN  953



>emb|CCI29698.1| Glycine cleavage system P-protein (glycine dehydrogenase) (fragment) 
[Microcystis aeruginosa PCC 9809]
Length=387

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 213/279 (76%), Gaps = 3/279 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP   +V 
Sbjct  101   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLVPFLPDVSLVL  160

Query  872   TGGIPSPDKSQ---PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMA  702
                 P     +    +GAISAAPWGSA IL IS+ YIAMMG+ GL  A+++AILNANYMA
Sbjct  161   AKLSPETANGKHQDSIGAISAAPWGSASILVISWMYIAMMGAAGLKKATEVAILNANYMA  220

Query  701   KRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPG  522
              RLE  YPVLF+G  GTVAHE +IDLR  K  AGIE EDVAKRLMD+GFH PT+SWPV G
Sbjct  221   FRLESAYPVLFKGSAGTVAHECVIDLRPLKKQAGIEVEDVAKRLMDFGFHAPTVSWPVAG  280

Query  521   TLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWT  342
             T+M+EPTESES  ELDRFC+ L++I +E+  I  G  DI++N LKNAPH  ++L AD W+
Sbjct  281   TMMVEPTESESLGELDRFCEALLTIYQEVQAIANGSMDIHDNPLKNAPHTAAVLTADDWS  340

Query  341   KPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  225
             +PYSR+ AA+P  WLK  KFWP  GRVDN YGDRNL+C+
Sbjct  341   RPYSRQQAAYPLSWLKDYKFWPVVGRVDNAYGDRNLVCS  379



>ref|WP_045056788.1| glycine dehydrogenase [Chroococcales cyanobacterium CENA595]
 gb|KJH69807.1| glycine dehydrogenase [Chroococcales cyanobacterium CENA595]
Length=970

 Score =   373 bits (958),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 218/280 (78%), Gaps = 6/280 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  692   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVMSHLVPFLPGHSVVS  751

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              G        Q +GA++AAPWGSA IL IS+ YIAMMG+ GLT+A+K+AILNANY+A +L
Sbjct  752   IG------DEQAIGAVAAAPWGSASILTISWMYIAMMGAMGLTEATKVAILNANYIAHKL  805

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
                YPVL++G  G VAHE I+DLRG K +AGIE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  806   NADYPVLYKGKTGLVAHECILDLRGLKKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGTMM  865

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFC+ + SIR EIA+IE G  D+ +NVLKNAPH   +L AD W  PY
Sbjct  866   VEPTESESKAELDRFCEAMSSIRREIAEIEAGNADMKDNVLKNAPHTAEVLTADEWEHPY  925

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SR+ AA+PA W +  KFW   GR+DN +GDRN +C+ LP+
Sbjct  926   SRKQAAYPAPWTREHKFWAAVGRIDNAFGDRNFVCSCLPM  965



>ref|XP_010723944.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Meleagris gallopavo]
Length=808

 Score =   369 bits (948),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 225/282 (80%), Gaps = 4/282 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  516   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVIK  575

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I +   + PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKRL
Sbjct  576   ---IQTDKDACPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKRL  632

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHY +LFRGV G VAHEFI+D R FK TA +EA D+AKRL DYGFH PTMSWPV GTLM
Sbjct  633   EKHYKILFRGVRGYVAHEFILDTRPFKKTANVEAVDLAKRLQDYGFHAPTMSWPVAGTLM  692

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N LK +PH  + + +  W +PY
Sbjct  693   IEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDAQVNPLKMSPHTLNCVTSSKWDRPY  752

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  753   SREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  794



>ref|WP_009032864.1| glycine dehydrogenase [Indibacter alkaliphilus]
Length=965

 Score =   373 bits (958),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 224/290 (77%), Gaps = 7/290 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPI V +HL PFLP +P++ 
Sbjct  683   GANMNAQVGLTSPGRIGADVCHLNLHKTFCIPHGGGGPGMGPICVAEHLVPFLPGNPLIE  742

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG      +  + +ISAAP+GSA ILPISY YIAMMG  GLT+A+KIAILNANY+  RL
Sbjct  743   TGG------TSAISSISAAPYGSASILPISYAYIAMMGGDGLTNATKIAILNANYIKSRL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYP+L+ G  G  AHE I+D R FK   GIE ED+AKRLMDYGFH PT+S+PV GTLM
Sbjct  797   ETHYPILYTGKEGRAAHEMILDCRAFKEI-GIEVEDIAKRLMDYGFHAPTVSFPVAGTLM  855

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESE+KAELDRFCD +I+IR EI ++ +GK D  NNVLKNAPH   L +AD W  PY
Sbjct  856   VEPTESETKAELDRFCDAMIAIRAEIQEVYEGKADKENNVLKNAPHTAQLALADNWDFPY  915

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAA  183
             SRE A +P  ++K  KFWP+  RVD+ YGDRNL+C+ +PV +  + E  A
Sbjct  916   SREKAVYPLPFVKGNKFWPSVRRVDSAYGDRNLMCSCIPVEEYADAEVEA  965



>ref|WP_006631620.1| glycine dehydrogenase [Microcoleus vaginatus]
 gb|EGK90642.1| Glycine dehydrogenase (decarboxylating) [Microcoleus vaginatus 
FGP-2]
Length=990

 Score =   374 bits (959),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 188/287 (66%), Positives = 220/287 (77%), Gaps = 7/287 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL  FLPSH ++ 
Sbjct  698   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVMSHLVEFLPSHSILN  757

Query  872   T-----GGIPSPDKSQ--PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNA  714
             +         S   SQ   +GA+SAAPWGSA ILPIS+ YI MMG  GLT+A+K+AILNA
Sbjct  758   SQQSTANSQQSTVNSQQTSVGAVSAAPWGSASILPISWMYIRMMGGAGLTEATKVAILNA  817

Query  713   NYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSW  534
             NYMAKRLE +YPVL++G  G VAHE I+DLR  K +A IE ED+AKRLMDYG+H PT+SW
Sbjct  818   NYMAKRLESYYPVLYKGKAGLVAHECILDLRSLKKSAAIEVEDIAKRLMDYGYHAPTVSW  877

Query  533   PVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMA  354
             PV GT+M+EPTESESK ELDRFC+ +I+IR EIA+IEKG  D  NNVLKNAPH    LM 
Sbjct  878   PVAGTVMVEPTESESKQELDRFCEAMIAIRSEIAEIEKGNVDAQNNVLKNAPHTAESLMV  937

Query  353   DAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             D W +PY+R  AA+PA W +  KFWP  GR+DN +GDRN +C+ LP+
Sbjct  938   DEWNRPYTRAQAAYPAPWTREHKFWPAVGRIDNAFGDRNFVCSCLPM  984



>ref|WP_027001579.1| glycine dehydrogenase [Flexibacter roseolus]
Length=968

 Score =   373 bits (957),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 224/286 (78%), Gaps = 6/286 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSP  IGADVCHLNLHKTFCIPHGGGGPGMGPIGV K LAP+LPSHP++ 
Sbjct  687   GANMNAQVGLTSPANIGADVCHLNLHKTFCIPHGGGGPGMGPIGVVKDLAPYLPSHPIIG  746

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             TGG    D       +SAAP+GSA IL ISY YIAMMG +GL  A++ AILNANY+  +L
Sbjct  747   TGGEAGIDP------VSAAPYGSASILLISYAYIAMMGGEGLKRATERAILNANYLKNKL  800

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVL+ G NG  AHEFI+D R FK TA IE  D+AKRLMDYGFH PT+S+PV GTLM
Sbjct  801   EGHYPVLYVGKNGRCAHEFILDCRNFKKTADIEVTDIAKRLMDYGFHAPTVSFPVAGTLM  860

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE++AELDRF + LI+IR EIA+IE+GK D  NNVLKN+PH  +LL+AD W  PY
Sbjct  861   IEPTESETQAELDRFAEALIAIRLEIAEIEQGKADAQNNVLKNSPHTAALLLADEWHYPY  920

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVED  195
             SR+ AA+P +W++  KFW +  R+DN YGDRNLIC+ LP+    E+
Sbjct  921   SRQKAAYPLEWVRERKFWVSVSRIDNAYGDRNLICSCLPLEAYAEE  966



>ref|WP_033563801.1| glycine dehydrogenase [Sphingobacteriaceae bacterium DW12]
Length=957

 Score =   373 bits (957),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 190/285 (67%), Positives = 225/285 (79%), Gaps = 7/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV KHL PFLP+H VV 
Sbjct  679   GANMNAQVGLTSPGHIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAKHLVPFLPNHEVVE  738

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
             T G       Q + A+SAAP+GSA IL IS+ YIAMMG+ GLT+A+K AILNANY+  RL
Sbjct  739   TSG------EQGIHAVSAAPFGSASILVISHAYIAMMGANGLTNATKTAILNANYIKSRL  792

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HYPVL+ G+NG  AHE I+D RGFK + GIE  D+AKRLMDYGFH PT+S+PV GTLM
Sbjct  793   ENHYPVLYSGINGRCAHEMILDCRGFK-SVGIEVADIAKRLMDYGFHAPTVSFPVAGTLM  851

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAE+DRFCD LI+IR+EIA IE G  D   NVLK+APH  S++ AD W +PY
Sbjct  852   VEPTESESKAEVDRFCDALIAIRQEIAAIEAGTIDQVENVLKHAPHTASVVTADEWNRPY  911

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SR+ AA+P ++LK +KFWP+ GRV+   GDR LIC+   + + +E
Sbjct  912   SRQTAAYPLEYLKVSKFWPSVGRVNESQGDRTLICSCPSIEEYME  956



>ref|XP_004072176.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Oryzias latipes]
Length=1031

 Score =   374 bits (961),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 194/281 (69%), Positives = 226/281 (80%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPVV 
Sbjct  740   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVV-  798

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                + S + S+ LG ISAAPWGS+ ILPIS+TYI MMGS+GLT A+++AILNANYMAKRL
Sbjct  799   --AMQSVNSSRSLGTISAAPWGSSAILPISWTYIKMMGSRGLTHATEVAILNANYMAKRL  856

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HY VLFRG  G VAHEFI+D+R FK TA IEA DVAKRL DYGFH PTMSWPV GTLM
Sbjct  857   EGHYKVLFRGRKGFVAHEFILDVRPFKKTANIEAVDVAKRLQDYGFHAPTMSWPVAGTLM  916

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAE+DRFCD L+ IR+EIA+IE+G+ D   N LK APH  + + +  W +PY
Sbjct  917   IEPTESEDKAEMDRFCDALLGIRQEIAEIEEGRMDSRINPLKMAPHSLACISSSNWDRPY  976

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SREYAAFP  +++   KFWPT  R+D++YGD++L+CT  P+
Sbjct  977   SREYAAFPLPFIRPETKFWPTISRIDDIYGDQHLVCTCPPM  1017



>ref|WP_013193021.1| glycine dehydrogenase [Trichormus azollae]
 gb|ADI66011.1| glycine dehydrogenase ['Nostoc azollae' 0708]
Length=964

 Score =   373 bits (957),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 189/280 (68%), Positives = 219/280 (78%), Gaps = 8/280 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  689   GANMNAQVGICRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVSSHLLPFLPGHSVVR  748

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG         LGA+SAAPWGSA IL IS+ Y+ MMG+ GLT+A+KIAILNANY+AKRL
Sbjct  749   MGG--------ELGAVSAAPWGSASILVISWMYMIMMGADGLTEATKIAILNANYIAKRL  800

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E +YP+L++G NG VAHE I+DLR  K +A IE +DVAKRLMDYGFH PT+SWPV GT+M
Sbjct  801   ELYYPILYQGKNGLVAHECILDLRSLKKSAHIEIDDVAKRLMDYGFHAPTVSWPVAGTIM  860

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESK ELDRFCD LI+IREE+A IE G+ DI +NVLKNAPH    L+   W  PY
Sbjct  861   VEPTESESKEELDRFCDALIAIREEVATIESGEMDIQDNVLKNAPHTAESLIVGEWNHPY  920

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W K  K WP+ GR+D  +GDRN +C+ LP+
Sbjct  921   SREQAAYPAPWNKEYKLWPSVGRIDAAFGDRNFVCSCLPM  960



>ref|WP_038029267.1| glycine dehydrogenase [Thermonema rossianum]
Length=961

 Score =   373 bits (957),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 194/285 (68%), Positives = 227/285 (80%), Gaps = 7/285 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLT+P  IGADVCHLNLHKTFCIPHGGGGPGMGPI VKKHLAPFLP+H +  
Sbjct  678   GANMNAQVGLTNPAIIGADVCHLNLHKTFCIPHGGGGPGMGPIAVKKHLAPFLPNHVM--  735

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
              GG      ++ + A++AAP+GSA ILPISY YIAMMG++GLT+A+K AIL+ANY+  RL
Sbjct  736   -GG---EKHAEGIHAVAAAPFGSASILPISYAYIAMMGAEGLTEATKAAILHANYIKARL  791

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EK YPVL+    G VAHE IID R FK   GIE ED+AKRLMDYGFH PT+S+PVPGTLM
Sbjct  792   EKAYPVLYTNEKGRVAHEMIIDCRAFKKV-GIEVEDIAKRLMDYGFHAPTVSFPVPGTLM  850

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESESKAELDRFCD L++IREEIA+IE+G++  +NNVLKNAPH  ++L A  W  PY
Sbjct  851   IEPTESESKAELDRFCDALLAIREEIAEIERGEYPKDNNVLKNAPHTAAMLTASEWNYPY  910

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVE  198
             SRE AA+P  +L+  KFW    RVDN YGDRNL+C+ LPVS   E
Sbjct  911   SREKAAYPLPYLRQRKFWVPVRRVDNAYGDRNLVCSCLPVSAYEE  955



>ref|WP_026721410.1| glycine dehydrogenase [Fischerella sp. PCC 9431]
Length=971

 Score =   373 bits (957),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 187/286 (65%), Positives = 222/286 (78%), Gaps = 9/286 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVV-  876
             GANMNAQVGL  PG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL  FLP + V+ 
Sbjct  685   GANMNAQVGLCRPGDIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLVEFLPGNAVIA  744

Query  875   -----PTGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNAN  711
                  P   I +P   + +GA+SAAPWGSA IL IS+ YIAMMG+ GLTDA+K+AILNAN
Sbjct  745   MQEYNPKSKIQNP---KSIGAVSAAPWGSASILVISWMYIAMMGAAGLTDATKVAILNAN  801

Query  710   YMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWP  531
             Y+AKRLE HYP+L++G NG VAHE I+DLR  K +A IE +D+AKRLMDYGFH PT+SWP
Sbjct  802   YIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKRLMDYGFHAPTVSWP  861

Query  530   VPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMAD  351
             V GT+M+EPTESESK ELDRFC+ +ISIR E+A+IE GK D+ +NVLKNAPH    L+  
Sbjct  862   VAGTIMVEPTESESKQELDRFCEAMISIRREVAEIEAGKADLQDNVLKNAPHTAESLIIG  921

Query  350   AWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
              W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  922   EWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPI  967



>ref|XP_009816061.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Gavia stellata]
Length=769

 Score =   368 bits (944),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 191/283 (67%), Positives = 226/283 (80%), Gaps = 6/283 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  477   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVIK  536

Query  872   TGGIPSPDK-SQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKR  696
                   PDK ++PLG +SAAPWGS+ ILPIS+ YI  MG++GL  AS+IAILNANYMAKR
Sbjct  537   I----QPDKDARPLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEIAILNANYMAKR  592

Query  695   LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTL  516
             LEKHY +LFRG  G VAHEFI+D R FK TA IEA D+AKRL DYGFH PTMSWPV GTL
Sbjct  593   LEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTL  652

Query  515   MIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKP  336
             MIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N LK +PH  + + +  W +P
Sbjct  653   MIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMSPHTLNCVTSSKWDRP  712

Query  335   YSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             YSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  713   YSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  755



>ref|WP_044035200.1| glycine dehydrogenase, partial [Microcystis aeruginosa]
Length=400

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 213/279 (76%), Gaps = 3/279 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  P   GADVCHLNLHKTFCIPHGGGGPGMGPIGVK HL PFLP   +V 
Sbjct  114   GANMNAQVGLCRPADFGADVCHLNLHKTFCIPHGGGGPGMGPIGVKSHLVPFLPDVSLVL  173

Query  872   TGGIPSPDKSQ---PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMA  702
                 P     +    +GAISAAPWGSA IL IS+ YIAMMG+ GL  A+++AILNANYMA
Sbjct  174   AKLSPETANGKHQDSIGAISAAPWGSASILVISWMYIAMMGAAGLKKATEVAILNANYMA  233

Query  701   KRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPG  522
              RLE  YPVLF+G  GTVAHE +IDLR  K  AGIE EDVAKRLMD+GFH PT+SWPV G
Sbjct  234   FRLESAYPVLFKGSAGTVAHECVIDLRPLKKQAGIEVEDVAKRLMDFGFHAPTVSWPVAG  293

Query  521   TLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWT  342
             T+M+EPTESES  ELDRFC+ L++I +E+  I  G  DI++N LKNAPH  ++L AD W+
Sbjct  294   TMMVEPTESESLGELDRFCEALLTIYQEVQAIANGSMDIHDNPLKNAPHTAAVLTADDWS  353

Query  341   KPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  225
             +PYSR+ AA+P  WLK  KFWP  GRVDN YGDRNL+C+
Sbjct  354   RPYSRQQAAYPLSWLKDYKFWPVVGRVDNAYGDRNLVCS  392



>dbj|BAK62095.1| glycine dehydrogenase [decarboxylating], mitochondrial precursor 
[Pan troglodytes]
Length=415

 Score =   356 bits (914),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 219/281 (78%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVG+  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLP+HPV+ 
Sbjct  123   GANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVI-  181

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                +   + + P+G +SAAPWGS+ ILPIS  YI MMG +GL  A++ AILNANYMAKRL
Sbjct  182   --SLKRNEDACPVGTVSAAPWGSSSILPISRAYIKMMGGKGLKQATETAILNANYMAKRL  239

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHY +LFRG  G V HEFI+D R FK +A IEA DVAKRL DYGFH PTMSWPV GTLM
Sbjct  240   EKHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLM  299

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N LK +PH  + + +  W +PY
Sbjct  300   VEPTESEDKAELDRFCDAMISIRQEIADIEEGRVDPRVNPLKMSPHSLTCVTSSHWDRPY  359

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AAFP  ++K   KFWPT  R+D++YGD++L+CT  P+
Sbjct  360   SREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPM  400



>gb|EYB23930.1| hypothetical protein FG05_08352, partial [Fusarium graminearum]
Length=538

 Score =   360 bits (925),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/280 (65%), Positives = 211/280 (75%), Gaps = 0/280 (0%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQ+GL SPG IGADVCHLNLHKTFCIPHGGGGPG+GPI VKKHLAP+LP HP + 
Sbjct  253   GANMNAQIGLCSPGDIGADVCHLNLHKTFCIPHGGGGPGVGPIAVKKHLAPYLPGHPEID  312

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I +   S  +  ISAAPWGSA ILPIS+TYI MMG  GLT  +  A+LNANY+  RL
Sbjct  313   PQRIGAERDSTAVAPISAAPWGSASILPISHTYILMMGGDGLTKQTGTALLNANYIMSRL  372

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               HY V++    G  AHEFI+D+R FK+TAG+E  D+AKRL DYGFH PTMS+PV GTLM
Sbjct  373   LPHYKVVYTNAQGRCAHEFILDVRPFKDTAGVEVADIAKRLADYGFHSPTMSFPVSGTLM  432

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESES+AELDRFCD LI IR+EIA IE GK    NN+L NAPHP   L++  W +PY
Sbjct  433   IEPTESESRAELDRFCDALIQIRKEIADIESGKVPRKNNILTNAPHPQEDLLSSEWDRPY  492

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             +RE AA+P  WL+  K WP+ GRVD+ YGD NL CT  PV
Sbjct  493   TREEAAYPLPWLREKKMWPSVGRVDDAYGDTNLFCTCPPV  532



>ref|XP_002120534.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Ciona intestinalis]
Length=998

 Score =   373 bits (957),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 194/281 (69%), Positives = 224/281 (80%), Gaps = 2/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHL PFLP+HPVVP
Sbjct  711   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLVPFLPTHPVVP  770

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G    D ++PLG +SAAPWGSA ILPIS+TYI +MG++GL +AS+IAILNANYMAKRL
Sbjct  771   PPGSLVSD-ARPLGVVSAAPWGSACILPISWTYIKLMGAKGLREASEIAILNANYMAKRL  829

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HY +L+ G NG VAHEFIID+RGFK T+ +EA D+AKRL DYGFH PTMSWPV  TLM
Sbjct  830   EGHYNILYTGTNGFVAHEFIIDVRGFKATSNVEAVDIAKRLQDYGFHAPTMSWPVTNTLM  889

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE K ELDRFCD LISIR+EI  IE GK D   N+LK APH    + AD W +PY
Sbjct  890   IEPTESEDKEELDRFCDALISIRKEIKDIEDGKVDKEINMLKMAPHTLESVSADNWQQPY  949

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             +R+ AAFP  +LK   K WP+TGR+D++YGD+NL CT  P+
Sbjct  950   TRKQAAFPLPYLKPDDKMWPSTGRIDDIYGDKNLFCTCPPM  990



>ref|WP_026796741.1| glycine dehydrogenase [Planktothrix prolifica]
Length=958

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 220/280 (79%), Gaps = 7/280 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  682   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHGVVD  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G  +       GA+SAAPWGSA IL IS+ YIAMMG +GLT+A+K+AILNANY+A RL
Sbjct  742   IQGSQT-------GAVSAAPWGSASILVISWMYIAMMGPKGLTEATKLAILNANYIASRL  794

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             +K+YP+L++G  G VAHE I+DLRG K +AGIE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  795   DKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGTMM  854

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFCD +I+I +EI++IE G  D  NN+LKNAPH    L+   W  PY
Sbjct  855   VEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNNMLKNAPHTAISLLCGEWNHPY  914

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  915   SREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  954



>ref|XP_007557910.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Poecilia formosa]
Length=1039

 Score =   374 bits (959),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/281 (68%), Positives = 225/281 (80%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPVVP
Sbjct  748   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVVP  807

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                + S + S  LG ISAAPWGS+ ILPIS+ YI MMGS+GLT A+++AILNANYMAKR+
Sbjct  808   ---MQSVNSSSSLGTISAAPWGSSAILPISWAYIKMMGSKGLTHATEVAILNANYMAKRV  864

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HY +LFRG  G VAHEFI+D+R FK TA IEA D+AKRL DYGFH PTMSWPV GTLM
Sbjct  865   EGHYKILFRGRKGFVAHEFILDVRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTLM  924

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAE+DRFCD L++IR+EIA IE+G+ D   N LK APH  + + +  W +PY
Sbjct  925   IEPTESEDKAEMDRFCDALLAIRQEIADIEEGRMDSRINPLKMAPHSLACISSSNWDRPY  984

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SREYAAFP  +++   KFWPT  R+D++YGD+NL+CT  P+
Sbjct  985   SREYAAFPLPFIRPETKFWPTISRIDDIYGDQNLVCTCPPM  1025



>ref|WP_043938103.1| glycine dehydrogenase [Planktothrix rubescens]
Length=961

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 187/280 (67%), Positives = 220/280 (79%), Gaps = 7/280 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL PFLP H VV 
Sbjct  685   GANMNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLVPFLPGHGVVD  744

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G  +       GA+SAAPWGSA IL IS+ YIAMMG +GLT+A+K+AILNANY+A RL
Sbjct  745   IQGSQT-------GAVSAAPWGSASILVISWMYIAMMGPKGLTEATKLAILNANYIASRL  797

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             +K+YP+L++G  G VAHE I+DLRG K +AGIE +D+AKRLMDYGFH PT+SWPV GT+M
Sbjct  798   DKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGTMM  857

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFCD +I+I +EI++IE G  D  NN+LKNAPH    L+   W  PY
Sbjct  858   VEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNNMLKNAPHTAISLLCGEWNHPY  917

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  918   SREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  957



>ref|XP_008416250.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Poecilia reticulata]
Length=1043

 Score =   373 bits (958),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/281 (68%), Positives = 225/281 (80%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPVVP
Sbjct  752   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVVP  811

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                + S + S  LG ISAAPWGS+ ILPIS+ YI MMGS+GLT A+++AILNANYMAKR+
Sbjct  812   ---MQSVNSSSSLGTISAAPWGSSAILPISWAYIKMMGSKGLTHATEVAILNANYMAKRV  868

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HY +LFRG  G VAHEFI+D+R FK TA IEA D+AKRL DYGFH PTMSWPV GTLM
Sbjct  869   EGHYKILFRGRKGFVAHEFILDVRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTLM  928

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAE+DRFCD L++IR+EIA IE+G+ D   N LK APH  + + +  W +PY
Sbjct  929   IEPTESEDKAEMDRFCDALLAIRQEIADIEEGRMDSRINPLKMAPHSLACISSSNWDRPY  988

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SREYAAFP  +++   KFWPT  R+D++YGD+NL+CT  P+
Sbjct  989   SREYAAFPLPFIRPETKFWPTISRIDDIYGDQNLVCTCPPM  1029



>ref|WP_027284971.1| glycine dehydrogenase [Rubritepida flocculans]
Length=962

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/282 (67%), Positives = 220/282 (78%), Gaps = 5/282 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGLTSP  IGADVCHLNLHKTFCIPHGGGGPG+GPIGV  HLAPFLP+HP++P
Sbjct  675   GANMNAQVGLTSPAAIGADVCHLNLHKTFCIPHGGGGPGVGPIGVAAHLAPFLPNHPLLP  734

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
               G      +   G +SAAP+GSA ILPISY YI MMG++GLT A+++AILNANYMA RL
Sbjct  735   EAG-----PATGFGPVSAAPFGSAAILPISYAYIRMMGAEGLTRATQVAILNANYMAARL  789

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
               HYP+L+RG NG VAHE I+D RGF+   G+  ED+AKRL DYGFH PTMSWPV GTLM
Sbjct  790   RDHYPILYRGGNGMVAHECILDCRGFQQGGGVLVEDIAKRLQDYGFHAPTMSWPVAGTLM  849

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESE+KAELDRF + +ISIR EI  IE+G+ D  +N LKNAPH  + + A  WT PY
Sbjct  850   VEPTESETKAELDRFIEAMISIRAEIRAIEQGRMDRADNPLKNAPHTAAEVTASEWTHPY  909

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  207
             SRE AAFP  W+K  K+WP   RVDNVYGDRNL+CT  P+ +
Sbjct  910   SREQAAFPLPWVKAQKYWPPVKRVDNVYGDRNLVCTCAPLEE  951



>ref|WP_017320159.1| glycine dehydrogenase [cyanobacterium PCC 7702]
Length=970

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 188/282 (67%), Positives = 221/282 (78%), Gaps = 8/282 (3%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG +GADVCHLNLHKTFCIPHGGGGPGMGPIGV  HL  FLP H VV 
Sbjct  691   GANMNAQVGLCRPGDMGADVCHLNLHKTFCIPHGGGGPGMGPIGVAAHLVEFLPGHAVV-  749

Query  872   TGGIPSPDKSQP--LGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAK  699
                  +  KS P  +GA+SAAPWGSA IL IS+ YI MMG+ GLT A+K+AILNANY+AK
Sbjct  750   -----TMPKSNPKAIGAVSAAPWGSASILVISWMYIVMMGTTGLTQATKVAILNANYIAK  804

Query  698   RLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGT  519
             RLE +YPVL+RG NG VAHE I+DLR  K +AGIE +D+AKRLMDYGFH PT+SWPV GT
Sbjct  805   RLEAYYPVLYRGKNGFVAHECILDLRSLKKSAGIEVDDIAKRLMDYGFHAPTVSWPVAGT  864

Query  518   LMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTK  339
             +M+EPTESESK ELDRFC+ +I+IR+EIA+IE GK D+ +NVLKNAPH    L+   W  
Sbjct  865   IMVEPTESESKQELDRFCEAMIAIRQEIAEIESGKADLQDNVLKNAPHTAESLIVGEWNH  924

Query  338   PYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  213
             PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  925   PYSREQAAYPAPWTREYKFWPAVGRIDAAFGDRNFVCSCLPM  966



>ref|XP_008944450.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Merops nubicus]
Length=451

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/282 (66%), Positives = 221/282 (78%), Gaps = 4/282 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVKKHLAP+LP+HPV+ 
Sbjct  159   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPYLPTHPVI-  217

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                I     +  LG +SAAPWGS+ ILPIS+ YI  MG++GL  AS++AILNANYMAKRL
Sbjct  218   --KIQLEKDACSLGTVSAAPWGSSAILPISWVYIKTMGAKGLKHASEVAILNANYMAKRL  275

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EKHY +LF+G  G VAHEFI+D R FK TA IEA D+AKRL DYGFH PTMSWPV GTLM
Sbjct  276   EKHYKILFKGAKGYVAHEFILDTRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTLM  335

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N LK +PH  + + +  W +PY
Sbjct  336   IEPTESEDKAELDRFCDAMISIRQEIADIEEGRMDPQINPLKMSPHTLNCVTSSKWDRPY  395

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPVS  210
             SRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+ 
Sbjct  396   SREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPME  437



>ref|XP_008416249.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Poecilia reticulata]
Length=1066

 Score =   374 bits (959),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/281 (68%), Positives = 225/281 (80%), Gaps = 4/281 (1%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL  PG  G+DV HLNLHKTFCIPHGGGGPGMGPIGVK HLAPFLPSHPVVP
Sbjct  775   GANMNAQVGLCRPGDYGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFLPSHPVVP  834

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                + S + S  LG ISAAPWGS+ ILPIS+ YI MMGS+GLT A+++AILNANYMAKR+
Sbjct  835   ---MQSVNSSSSLGTISAAPWGSSAILPISWAYIKMMGSKGLTHATEVAILNANYMAKRV  891

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             E HY +LFRG  G VAHEFI+D+R FK TA IEA D+AKRL DYGFH PTMSWPV GTLM
Sbjct  892   EGHYKILFRGRKGFVAHEFILDVRPFKKTANIEAVDLAKRLQDYGFHAPTMSWPVAGTLM  951

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             IEPTESE KAE+DRFCD L++IR+EIA IE+G+ D   N LK APH  + + +  W +PY
Sbjct  952   IEPTESEDKAEMDRFCDALLAIRQEIADIEEGRMDSRINPLKMAPHSLACISSSNWDRPY  1011

Query  332   SREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  213
             SREYAAFP  +++   KFWPT  R+D++YGD+NL+CT  P+
Sbjct  1012  SREYAAFPLPFIRPETKFWPTISRIDDIYGDQNLVCTCPPM  1052



>ref|XP_005716298.1| glycine dehydrogenase (decarboxylating), mitochondrial precursor 
[Chondrus crispus]
 emb|CDF36479.1| glycine dehydrogenase (decarboxylating), mitochondrial precursor 
[Chondrus crispus]
Length=1042

 Score =   373 bits (958),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 222/291 (76%), Gaps = 7/291 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GANMNAQVGL SPG IGADVCHLNLHKTFCIPHGGGGPGMGPIGV K LAPFLP HPV+ 
Sbjct  747   GANMNAQVGLCSPGEIGADVCHLNLHKTFCIPHGGGGPGMGPIGVAKQLAPFLPDHPVIS  806

Query  872   TGGIPSPDKSQ----PLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYM  705
                 P+PDK        G +SAAP+GS+ ILPISY YI MMG+ GL +A++ AILNANYM
Sbjct  807   P---PNPDKVHNKGIETGCVSAAPFGSSAILPISYMYIKMMGTDGLREATEQAILNANYM  863

Query  704   AKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVP  525
             AKRLE  Y VL+RG  G VAHEFIID+R FK+  GI   D+AKRL DYGFH PTMSWPV 
Sbjct  864   AKRLEDSYDVLYRGSKGRVAHEFIIDMRPFKSNCGISETDIAKRLQDYGFHAPTMSWPVS  923

Query  524   GTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAW  345
             GTLM+EPTESESK ELDRFCD +I IREEI  +E+G+ D  +N LK+APH  +++ A+ W
Sbjct  924   GTLMVEPTESESKEELDRFCDAMIMIREEIRAVEEGRMDKEDNPLKHAPHTAAIVSAEEW  983

Query  344   TKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  192
              + Y R   AFPA W++  KFWPT  RVD+V+GDRNL+CT  PVS   +D+
Sbjct  984   DRQYPRALGAFPAAWVENQKFWPTVSRVDDVFGDRNLMCTCPPVSDYTQDD  1034



>ref|WP_014560840.1| glycine dehydrogenase [Ignavibacterium album]
 gb|AFH49691.1| Glycine dehydrogenase [Ignavibacterium album JCM 16511]
Length=966

 Score =   371 bits (953),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 234/289 (81%), Gaps = 6/289 (2%)
 Frame = -2

Query  1052  GANMNAQVGLTSPGFIGADVCHLNLHKTFCIphggggpgmgpiGVKKHLAPFLPSHPVVP  873
             GAN+NAQVGLTSP FIGADVCH+NLHKTFCIPHGGGGPGMGPI V KHL P+LP HPVV 
Sbjct  683   GANLNAQVGLTSPAFIGADVCHINLHKTFCIPHGGGGPGMGPIAVAKHLVPYLPGHPVV-  741

Query  872   TGGIPSPDKSQPLGAISAAPWGSALILPISYTYIAMMGSQGLTDASKIAILNANYMAKRL  693
                  + +K + + ++S+APWGSA IL ISY YI MMGS+GLT+ASK AI+NANY+  +L
Sbjct  742   -----NINKEKSIHSVSSAPWGSAGILIISYAYIKMMGSEGLTNASKAAIVNANYIKAKL  796

Query  692   EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  513
             EK++PVL+ G+NG V HE I D+R FK++A IE ED+AKRLMDYG+H PT+S+PVPGTLM
Sbjct  797   EKYFPVLYSGLNGRVGHELIFDMRSFKHSAHIEVEDIAKRLMDYGYHAPTVSFPVPGTLM  856

Query  512   IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  333
             +EPTESESKAELDRFC+ +ISIREEI +IE+GK D NNNVLKNAPH   +L++D W  PY
Sbjct  857   VEPTESESKAELDRFCEVMISIREEIKEIEEGKADPNNNVLKNAPHTLQMLISDKWNYPY  916

Query  332   SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAA  186
             SRE A +P +W +  KFWP+  RVDN YGDRNL+C+ +PVS+  E+  A
Sbjct  917   SREKAGYPLKWTRQNKFWPSVARVDNAYGDRNLVCSCIPVSEYAEENLA  965



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2733788516091