BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12418

Length=1007
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGS56396.1|  LRR receptor-like serine/threonine-protein kinase       402   5e-135   Populus tremula [European aspen]
ref|XP_006452986.1|  hypothetical protein CICLE_v100073972mg            401   1e-134   
emb|CDP13474.1|  unnamed protein product                                417   8e-134   Coffea canephora [robusta coffee]
ref|XP_006353850.1|  PREDICTED: LRR receptor-like serine/threonin...    414   1e-132   Solanum tuberosum [potatoes]
ref|XP_004245043.1|  PREDICTED: LRR receptor-like serine/threonin...    412   6e-132   Solanum lycopersicum
ref|XP_009605434.1|  PREDICTED: LRR receptor-like serine/threonin...    412   7e-132   Nicotiana tomentosiformis
gb|KDO73637.1|  hypothetical protein CISIN_1g0023491mg                  404   4e-131   Citrus sinensis [apfelsine]
ref|XP_008220576.1|  PREDICTED: LRR receptor-like serine/threonin...    408   2e-130   Prunus mume [ume]
ref|XP_008220575.1|  PREDICTED: LRR receptor-like serine/threonin...    408   2e-130   Prunus mume [ume]
emb|CAN74952.1|  hypothetical protein VITISV_025649                     399   2e-129   Vitis vinifera
dbj|BAK61880.1|  LRR receptor-like serine/threonine-protein kinase      404   3e-129   Citrus unshiu [satsuma mandarin]
ref|XP_006474503.1|  PREDICTED: LRR receptor-like serine/threonin...    404   5e-129   Citrus sinensis [apfelsine]
ref|XP_009802873.1|  PREDICTED: LRR receptor-like serine/threonin...    404   1e-128   Nicotiana sylvestris
ref|NP_001235257.1|  ERECTA                                             388   2e-128   Glycine max [soybeans]
ref|XP_006381995.1|  hypothetical protein POPTR_0006s23680g             400   2e-128   
ref|XP_007225368.1|  hypothetical protein PRUPE_ppa000847mg             402   3e-128   
emb|CBI20727.3|  unnamed protein product                                400   1e-127   Vitis vinifera
ref|XP_002280069.2|  PREDICTED: LRR receptor-like serine/threonin...    401   2e-127   Vitis vinifera
ref|XP_007161049.1|  hypothetical protein PHAVU_001G038400g             397   2e-126   Phaseolus vulgaris [French bean]
ref|XP_011019342.1|  PREDICTED: LRR receptor-like serine/threonin...    397   4e-126   Populus euphratica
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...    395   1e-125   Cucumis melo [Oriental melon]
ref|XP_010098375.1|  LRR receptor-like serine/threonine-protein k...    396   2e-125   
ref|XP_004303459.1|  PREDICTED: LRR receptor-like serine/threonin...    395   3e-125   Fragaria vesca subsp. vesca
ref|XP_012077188.1|  PREDICTED: LRR receptor-like serine/threonin...    394   3e-125   Jatropha curcas
ref|XP_002516144.1|  erecta, putative                                   394   5e-125   Ricinus communis
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...    394   6e-125   Cucumis sativus [cucumbers]
ref|XP_008393579.1|  PREDICTED: LRR receptor-like serine/threonin...    393   1e-124   Malus domestica [apple tree]
gb|KEH39916.1|  LRR receptor-like kinase family protein                 392   2e-124   Medicago truncatula
ref|XP_003588942.1|  LRR receptor-like serine/threonine-protein k...    392   2e-124   
gb|AES59193.2|  LRR receptor-like kinase family protein                 392   2e-124   Medicago truncatula
gb|AIR08789.1|  receptor-like kinase ERECTA                             392   3e-124   Medicago sativa [alfalfa]
ref|XP_007012431.1|  Leucine-rich receptor-like protein kinase fa...    392   3e-124   
ref|XP_003544548.1|  PREDICTED: LRR receptor-like serine/threonin...    390   9e-124   Glycine max [soybeans]
ref|XP_009362801.1|  PREDICTED: LRR receptor-like serine/threonin...    390   2e-123   Pyrus x bretschneideri [bai li]
ref|XP_011069519.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    389   3e-123   Sesamum indicum [beniseed]
gb|KHN37058.1|  LRR receptor-like serine/threonine-protein kinase...    389   4e-123   Glycine soja [wild soybean]
ref|XP_004498861.1|  PREDICTED: LRR receptor-like serine/threonin...    386   3e-122   
ref|XP_004498860.1|  PREDICTED: LRR receptor-like serine/threonin...    386   6e-122   Cicer arietinum [garbanzo]
ref|XP_004498859.1|  PREDICTED: LRR receptor-like serine/threonin...    385   8e-122   Cicer arietinum [garbanzo]
ref|XP_011081595.1|  PREDICTED: LRR receptor-like serine/threonin...    385   1e-121   Sesamum indicum [beniseed]
ref|XP_003522304.1|  PREDICTED: LRR receptor-like serine/threonin...    383   8e-121   
ref|XP_006578096.1|  PREDICTED: LRR receptor-like serine/threonin...    383   9e-121   Glycine max [soybeans]
ref|XP_009337156.1|  PREDICTED: LRR receptor-like serine/threonin...    383   1e-120   Pyrus x bretschneideri [bai li]
ref|XP_010047401.1|  PREDICTED: LRR receptor-like serine/threonin...    379   2e-119   Eucalyptus grandis [rose gum]
ref|XP_006581305.1|  PREDICTED: LRR receptor-like serine/threonin...    379   2e-119   Glycine max [soybeans]
ref|XP_008393446.1|  PREDICTED: LRR receptor-like serine/threonin...    379   2e-119   
ref|XP_010431630.1|  PREDICTED: LRR receptor-like serine/threonin...    356   3e-119   Camelina sativa [gold-of-pleasure]
gb|KJB07391.1|  hypothetical protein B456_001G019800                    376   3e-118   Gossypium raimondii
ref|XP_010526027.1|  PREDICTED: LRR receptor-like serine/threonin...    375   8e-118   Tarenaya hassleriana [spider flower]
ref|XP_010669304.1|  PREDICTED: LRR receptor-like serine/threonin...    374   2e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010429656.1|  PREDICTED: LRR receptor-like serine/threonin...    355   9e-117   
ref|XP_010273915.1|  PREDICTED: LRR receptor-like serine/threonin...    372   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_010273914.1|  PREDICTED: LRR receptor-like serine/threonin...    372   1e-116   Nelumbo nucifera [Indian lotus]
gb|EPS58979.1|  hypothetical protein M569_15834                         349   2e-116   Genlisea aurea
ref|XP_010261893.1|  PREDICTED: LRR receptor-like serine/threonin...    371   3e-116   Nelumbo nucifera [Indian lotus]
ref|XP_009408412.1|  PREDICTED: LRR receptor-like serine/threonin...    369   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU32328.1|  hypothetical protein MIMGU_mgv1a000790mg                368   5e-115   Erythranthe guttata [common monkey flower]
dbj|BAD94220.1|  putative receptor-like protein kinase                  352   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136889.1|  hypothetical protein PHAVU_009G082500g             365   2e-114   Phaseolus vulgaris [French bean]
ref|XP_006296065.1|  hypothetical protein CARUB_v10025215mg             355   3e-110   Capsella rubella
ref|XP_010429655.1|  PREDICTED: LRR receptor-like serine/threonin...    355   3e-110   Camelina sativa [gold-of-pleasure]
gb|EYU20292.1|  hypothetical protein MIMGU_mgv1a026417mg                354   4e-110   Erythranthe guttata [common monkey flower]
ref|XP_010417421.1|  PREDICTED: LRR receptor-like serine/threonin...    354   5e-110   Camelina sativa [gold-of-pleasure]
ref|XP_002880777.1|  hypothetical protein ARALYDRAFT_481491             353   2e-109   
ref|NP_180201.1|  LRR receptor-like serine/threonine-protein kina...    353   2e-109   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD16970.1|  receptor protein kinase PERK1-like                     335   6e-109   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048290.1|  Os02g0777400                                       335   3e-108   
gb|EEE65279.1|  hypothetical protein OsJ_20503                          347   6e-108   Oryza sativa Japonica Group [Japonica rice]
gb|KJB65469.1|  hypothetical protein B456_010G096300                    347   7e-108   Gossypium raimondii
gb|KJB65470.1|  hypothetical protein B456_010G096300                    347   8e-108   Gossypium raimondii
gb|EEC80197.1|  hypothetical protein OsI_22078                          347   2e-107   Oryza sativa Indica Group [Indian rice]
gb|KJB65472.1|  hypothetical protein B456_010G096300                    347   2e-107   Gossypium raimondii
gb|KJB65471.1|  hypothetical protein B456_010G096300                    347   3e-107   Gossypium raimondii
ref|XP_008786642.1|  PREDICTED: LRR receptor-like serine/threonin...    346   5e-107   
ref|NP_001057087.1|  Os06g0203800                                       347   5e-107   
ref|XP_008786640.1|  PREDICTED: LRR receptor-like serine/threonin...    346   6e-107   Phoenix dactylifera
gb|KFK32516.1|  hypothetical protein AALP_AA6G252800                    346   7e-107   Arabis alpina [alpine rockcress]
ref|XP_008786639.1|  PREDICTED: LRR receptor-like serine/threonin...    346   8e-107   Phoenix dactylifera
ref|XP_010917192.1|  PREDICTED: LRR receptor-like serine/threonin...    345   2e-106   Elaeis guineensis
ref|XP_006408746.1|  hypothetical protein EUTSA_v10001898mg             343   8e-106   Eutrema salsugineum [saltwater cress]
ref|XP_006656743.1|  PREDICTED: LRR receptor-like serine/threonin...    343   1e-105   Oryza brachyantha
gb|EEC74102.1|  hypothetical protein OsI_09151                          341   2e-105   Oryza sativa Indica Group [Indian rice]
gb|KJB65473.1|  hypothetical protein B456_010G096300                    340   9e-105   Gossypium raimondii
ref|XP_010227884.1|  PREDICTED: LRR receptor-like serine/threonin...    340   1e-104   Brachypodium distachyon [annual false brome]
ref|XP_003564133.1|  PREDICTED: LRR receptor-like serine/threonin...    340   2e-104   Brachypodium distachyon [annual false brome]
ref|XP_006649092.1|  PREDICTED: LRR receptor-like serine/threonin...    339   3e-104   Oryza brachyantha
ref|NP_001132173.1|  uncharacterized protein LOC100193598               326   4e-104   
gb|EEE57902.1|  hypothetical protein OsJ_08587                          337   4e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009117015.1|  PREDICTED: LRR receptor-like serine/threonin...    338   6e-104   Brassica rapa
ref|XP_002438023.1|  hypothetical protein SORBIDRAFT_10g006670          338   7e-104   Sorghum bicolor [broomcorn]
ref|NP_001281212.1|  uncharacterized protein LOC103504710               320   2e-103   
gb|AFJ14786.1|  ERECTA-like kinase                                      337   2e-103   Oryza sativa Japonica Group [Japonica rice]
gb|AGL91677.1|  erecta leucine-rich-repeat receptor-like kinase         333   4e-102   Brassica napus [oilseed rape]
gb|ERN11268.1|  hypothetical protein AMTR_s00024p00237440               333   5e-102   Amborella trichopoda
ref|XP_006849687.2|  PREDICTED: LRR receptor-like serine/threonin...    333   6e-102   
ref|XP_002452905.1|  hypothetical protein SORBIDRAFT_04g034820          326   4e-100   
ref|XP_008647408.1|  PREDICTED: uncharacterized protein LOC100193...    327   9e-100   Zea mays [maize]
ref|XP_008647407.1|  PREDICTED: uncharacterized protein LOC100193...    327   2e-99    Zea mays [maize]
ref|XP_004955237.1|  PREDICTED: LRR receptor-like serine/threonin...    325   5e-99    
gb|AFW73726.1|  putative leucine-rich repeat receptor-like protei...    320   5e-99    
gb|AFW73725.1|  putative leucine-rich repeat receptor-like protei...    319   5e-99    
gb|AFW76643.1|  putative leucine-rich repeat receptor-like protei...    326   6e-99    
dbj|BAJ87863.1|  predicted protein                                      318   3e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004964941.1|  PREDICTED: LRR receptor-like serine/threonin...    320   4e-97    Setaria italica
ref|XP_004964942.1|  PREDICTED: LRR receptor-like serine/threonin...    320   4e-97    Setaria italica
gb|AFW73724.1|  putative leucine-rich repeat receptor-like protei...    319   9e-97    
dbj|BAJ96098.1|  predicted protein                                      318   2e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68149.1|  LRR receptor-like serine/threonine-protein kinase...    314   8e-96    Triticum urartu
dbj|BAK07025.1|  predicted protein                                      316   1e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN79933.1|  hypothetical protein VITISV_008329                     298   5e-95    Vitis vinifera
gb|EMT04765.1|  LRR receptor-like serine/threonine-protein kinase...    313   7e-95    
ref|XP_010109087.1|  LRR receptor-like serine/threonine-protein k...    303   1e-94    
gb|AGL91671.1|  erecta leucine-rich-repeat receptor-like kinase         312   2e-94    Triticum aestivum [Canadian hard winter wheat]
gb|AFJ38186.2|  receptor-like serine/threonine protein kinase 1         312   3e-94    Triticum aestivum [Canadian hard winter wheat]
gb|EMS63677.1|  LRR receptor-like serine/threonine-protein kinase...    311   3e-94    Triticum urartu
gb|AFJ38187.2|  receptor-like serine/threonine protein kinase 2         312   3e-94    Triticum aestivum [Canadian hard winter wheat]
gb|AFC88469.1|  ERECTA                                                  312   4e-94    Triticum aestivum [Canadian hard winter wheat]
gb|AGL91672.1|  erecta leucine-rich-repeat receptor-like kinase         310   2e-93    Triticum aestivum [Canadian hard winter wheat]
gb|EMT11370.1|  LRR receptor-like serine/threonine-protein kinase...    310   2e-93    
emb|CDP20026.1|  unnamed protein product                                296   1e-92    Coffea canephora [robusta coffee]
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...    305   2e-91    Elaeis guineensis
gb|EEE65024.1|  hypothetical protein OsJ_19993                          303   4e-91    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD44800.1|  putative transmembrane protein kinase                  302   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056687.1|  Os06g0130100                                       302   2e-90    
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...    300   6e-90    Nelumbo nucifera [Indian lotus]
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...    300   7e-90    Nelumbo nucifera [Indian lotus]
gb|ACF87330.1|  unknown                                                 281   7e-90    Zea mays [maize]
gb|ACY07616.1|  stress-induced protein kinase                           300   7e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...    300   8e-90    Nelumbo nucifera [Indian lotus]
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...    300   2e-89    Nelumbo nucifera [Indian lotus]
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...    299   2e-89    Oryza brachyantha
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...    299   3e-89    Nelumbo nucifera [Indian lotus]
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...    298   5e-89    
emb|CDP05285.1|  unnamed protein product                                297   1e-88    Coffea canephora [robusta coffee]
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...    297   1e-88    Phoenix dactylifera
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...    297   1e-88    Vitis vinifera
ref|XP_010035002.1|  PREDICTED: LRR receptor-like serine/threonin...    296   1e-88    
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...    297   1e-88    
dbj|BAC42683.1|  unknown protein                                        279   7e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006598683.1|  PREDICTED: ERECTA-like kinase isoform X2           295   8e-88    Glycine max [soybeans]
ref|XP_007038488.1|  ERECTA-like 1                                      295   1e-87    
gb|KHN24405.1|  LRR receptor-like serine/threonine-protein kinase...    294   1e-87    Glycine soja [wild soybean]
ref|XP_009398741.1|  PREDICTED: LRR receptor-like serine/threonin...    295   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF80312.1|  unknown                                                 277   2e-87    Zea mays [maize]
ref|XP_006598682.1|  PREDICTED: ERECTA-like kinase isoform X1           294   2e-87    Glycine max [soybeans]
gb|ADM86148.1|  leucine-rich repeat receptor-like kinase                293   2e-87    Populus nigra x Populus x canadensis
ref|NP_001235330.1|  ERECTA-like kinase                                 294   2e-87    Glycine max [soybeans]
ref|XP_002318267.2|  PTH-1 family protein                               293   3e-87    
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...    293   3e-87    Populus euphratica
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...    293   6e-87    Populus euphratica
ref|XP_006587379.1|  PREDICTED: LRR receptor-like serine/threonin...    292   7e-87    Glycine max [soybeans]
ref|XP_002510897.1|  erecta, putative                                   291   1e-86    
ref|XP_003561134.2|  PREDICTED: LRR receptor-like serine/threonin...    291   2e-86    
ref|NP_001237639.1|  ERECTA-like kinase                                 288   2e-86    Glycine max [soybeans]
gb|KHN27841.1|  LRR receptor-like serine/threonine-protein kinase...    290   2e-86    Glycine soja [wild soybean]
gb|ACR34621.1|  unknown                                                 279   3e-86    Zea mays [maize]
dbj|BAJ90194.1|  predicted protein                                      287   4e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...    290   4e-86    Setaria italica
gb|KJB39364.1|  hypothetical protein B456_007G009000                    290   5e-86    Gossypium raimondii
gb|ACN26436.1|  unknown                                                 280   6e-86    Zea mays [maize]
gb|KHG06831.1|  LRR receptor-like serine/threonine-protein kinase...    290   6e-86    Gossypium arboreum [tree cotton]
ref|XP_010444058.1|  PREDICTED: LRR receptor-like serine/threonin...    289   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_004308156.1|  PREDICTED: LRR receptor-like serine/threonin...    289   2e-85    Fragaria vesca subsp. vesca
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2           288   3e-85    Glycine max [soybeans]
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1           288   3e-85    Glycine max [soybeans]
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g             288   3e-85    Phaseolus vulgaris [French bean]
ref|XP_010483916.1|  PREDICTED: LRR receptor-like serine/threonin...    286   1e-84    Camelina sativa [gold-of-pleasure]
emb|CBI24498.3|  unnamed protein product                                286   1e-84    Vitis vinifera
ref|XP_008234344.1|  PREDICTED: LRR receptor-like serine/threonin...    286   2e-84    Prunus mume [ume]
dbj|BAJ89970.1|  predicted protein                                      286   2e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007152392.1|  hypothetical protein PHAVU_004G126100g             286   2e-84    Phaseolus vulgaris [French bean]
ref|XP_010483915.1|  PREDICTED: LRR receptor-like serine/threonin...    285   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_009345019.1|  PREDICTED: LRR receptor-like serine/threonin...    285   3e-84    
ref|XP_009346939.1|  PREDICTED: LRR receptor-like serine/threonin...    285   3e-84    
ref|XP_008376471.1|  PREDICTED: LRR receptor-like serine/threonin...    285   3e-84    Malus domestica [apple tree]
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970          285   4e-84    Sorghum bicolor [broomcorn]
ref|XP_012090380.1|  PREDICTED: LRR receptor-like serine/threonin...    285   4e-84    Jatropha curcas
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                   284   5e-84    Citrus sinensis [apfelsine]
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...    285   5e-84    
gb|AAL68842.1|AF466199_1  putative receptor protein kinase              284   5e-84    Sorghum bicolor [broomcorn]
ref|XP_012090381.1|  PREDICTED: LRR receptor-like serine/threonin...    285   6e-84    
ref|XP_006394418.1|  hypothetical protein EUTSA_v100036151mg            282   7e-84    
ref|NP_001146239.1|  uncharacterized LOC100279811                       279   3e-83    
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg             282   3e-83    
gb|KEH43759.1|  LRR receptor-like kinase family protein                 283   3e-83    Medicago truncatula
ref|XP_004149628.2|  PREDICTED: LRR receptor-like serine/threonin...    281   8e-83    Cucumis sativus [cucumbers]
ref|XP_009151345.1|  PREDICTED: LRR receptor-like serine/threonin...    281   1e-82    Brassica rapa
ref|XP_007221096.1|  hypothetical protein PRUPE_ppa017398mg             281   1e-82    
ref|XP_006279954.1|  hypothetical protein CARUB_v10025821mg             280   2e-82    Capsella rubella
emb|CDY00268.1|  BnaA06g21690D                                          280   2e-82    
ref|XP_009151343.1|  PREDICTED: LRR receptor-like serine/threonin...    280   2e-82    Brassica rapa
ref|XP_008465055.1|  PREDICTED: LRR receptor-like serine/threonin...    280   3e-82    Cucumis melo [Oriental melon]
gb|AGT17158.1|  ERECTA-like 2                                           280   3e-82    Saccharum hybrid cultivar R570
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...    279   4e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002975149.1|  hypothetical protein SELMODRAFT_102522             279   4e-82    
ref|XP_002977553.1|  hypothetical protein SELMODRAFT_107124             279   4e-82    
emb|CDX86913.1|  BnaC03g51830D                                          279   4e-82    
ref|NP_201029.1|  LRR receptor-like serine/threonine-protein kina...    279   5e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...    279   5e-82    
gb|AGL91675.1|  erecta-like leucine-rich-repeat receptor-like kinase    279   6e-82    Triticum aestivum [Canadian hard winter wheat]
gb|ERN19491.1|  hypothetical protein AMTR_s00069p00198500               279   6e-82    Amborella trichopoda
ref|XP_002864777.1|  hypothetical protein ARALYDRAFT_496399             278   7e-82    
ref|XP_009600406.1|  PREDICTED: LRR receptor-like serine/threonin...    278   8e-82    Nicotiana tomentosiformis
ref|XP_006858024.2|  PREDICTED: LRR receptor-like serine/threonin...    278   8e-82    
ref|XP_004496653.1|  PREDICTED: LRR receptor-like serine/threonin...    278   1e-81    Cicer arietinum [garbanzo]
ref|XP_009757534.1|  PREDICTED: LRR receptor-like serine/threonin...    277   2e-81    Nicotiana sylvestris
ref|XP_009757535.1|  PREDICTED: LRR receptor-like serine/threonin...    277   2e-81    Nicotiana sylvestris
ref|XP_006606082.1|  PREDICTED: LRR receptor-like serine/threonin...    277   2e-81    Glycine max [soybeans]
ref|XP_006606083.1|  PREDICTED: LRR receptor-like serine/threonin...    277   3e-81    Glycine max [soybeans]
gb|KHN15712.1|  LRR receptor-like serine/threonine-protein kinase...    277   3e-81    Glycine soja [wild soybean]
gb|AAP69763.1|  ERECTA-like kinase 1                                    276   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...    276   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_002322426.1|  PTH-1 family protein                               274   1e-80    
ref|XP_006348051.1|  PREDICTED: LRR receptor-like serine/threonin...    275   1e-80    Solanum tuberosum [potatoes]
ref|XP_006348052.1|  PREDICTED: LRR receptor-like serine/threonin...    275   1e-80    
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...    275   1e-80    Solanum lycopersicum
gb|KFK27954.1|  hypothetical protein AALP_AA8G452900                    275   2e-80    Arabis alpina [alpine rockcress]
gb|AGL91674.1|  erecta-like leucine-rich-repeat receptor-like kinase    275   2e-80    Triticum aestivum [Canadian hard winter wheat]
gb|EPS66497.1|  hypothetical protein M569_08274                         274   3e-80    Genlisea aurea
ref|XP_010423244.1|  PREDICTED: LRR receptor-like serine/threonin...    271   2e-79    
ref|XP_010555314.1|  PREDICTED: LRR receptor-like serine/threonin...    272   2e-79    Tarenaya hassleriana [spider flower]
ref|XP_011076300.1|  PREDICTED: LRR receptor-like serine/threonin...    271   4e-79    Sesamum indicum [beniseed]
ref|XP_011076298.1|  PREDICTED: LRR receptor-like serine/threonin...    271   4e-79    Sesamum indicum [beniseed]
ref|XP_010423243.1|  PREDICTED: LRR receptor-like serine/threonin...    271   5e-79    Camelina sativa [gold-of-pleasure]
ref|XP_006399198.1|  hypothetical protein EUTSA_v10012600mg             270   5e-79    
emb|CAB87274.1|  receptor-like protein kinase                           270   7e-79    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196335.2|  LRR receptor-like serine/threonine-protein kina...    270   8e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAO26312.1|  receptor-like protein kinase                            265   2e-78    Elaeis guineensis
gb|EMS58253.1|  LRR receptor-like serine/threonine-protein kinase...    269   2e-78    Triticum urartu
dbj|BAA97187.1|  receptor-like protein kinase                           268   5e-78    Arabidopsis thaliana [mouse-ear cress]
gb|EYU25015.1|  hypothetical protein MIMGU_mgv1a000865mg                268   7e-78    Erythranthe guttata [common monkey flower]
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657             267   1e-77    Arabidopsis lyrata subsp. lyrata
ref|XP_006289323.1|  hypothetical protein CARUB_v10002808mg             266   2e-77    
gb|EMT12712.1|  LRR receptor-like serine/threonine-protein kinase...    266   2e-77    
ref|XP_010491322.1|  PREDICTED: LRR receptor-like serine/threonin...    265   5e-77    Camelina sativa [gold-of-pleasure]
ref|XP_010452673.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    265   6e-77    
ref|XP_010474472.1|  PREDICTED: LRR receptor-like serine/threonin...    261   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_002981099.1|  hypothetical protein SELMODRAFT_114051             251   9e-72    
ref|XP_002982573.1|  hypothetical protein SELMODRAFT_155267             251   9e-72    
ref|XP_009122365.1|  PREDICTED: LRR receptor-like serine/threonin...    249   3e-71    Brassica rapa
emb|CDX70013.1|  BnaA10g23620D                                          247   1e-70    
gb|ABR08864.1|  erecta                                                  226   1e-69    Arabidopsis thaliana [mouse-ear cress]
gb|ABR08875.1|  erecta                                                  224   4e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CDX99001.1|  BnaC09g48340D                                          239   8e-68    
gb|AAL50210.1|  ER1-like receptor kinase                                204   3e-61    Camelina sativa [gold-of-pleasure]
ref|XP_001783127.1|  ERL1a AtERECTA-like receptor S/T protein kin...    218   4e-60    
ref|XP_001770079.1|  ERL1c AtERECTA-like receptor S/T protein kin...    216   8e-60    
ref|XP_006372044.1|  hypothetical protein POPTR_0018s08390g             206   5e-59    
ref|XP_001770421.1|  ERL2b AtERECTA-like receptor S/T protein kin...    209   3e-57    
gb|KFK22048.1|  hypothetical protein AALP_AAs71129U000200               195   2e-56    Arabis alpina [alpine rockcress]
ref|XP_001763775.1|  ERL2a AtERECTA-like receptor S/T protein kin...    206   5e-56    
ref|XP_001755991.1|  ERL1d AtERECTA-like receptor S/T protein kin...    205   7e-56    
ref|XP_010055907.1|  PREDICTED: LRR receptor-like serine/threonin...    189   3e-55    
gb|AFW76644.1|  putative leucine-rich repeat receptor-like protei...    202   9e-55    
ref|XP_001755734.1|  ERL1b AtERECTA-like receptor S/T protein kin...    201   1e-54    
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...    194   1e-51    
gb|KHG04653.1|  LRR receptor-like serine/threonine-protein kinase...    177   1e-49    Gossypium arboreum [tree cotton]
gb|ACI05997.1|  kinase-like protein pac.EREC.L.4                        174   6e-49    Platanus x hispanica [London plane tree]
ref|XP_010060188.1|  PREDICTED: LRR receptor-like serine/threonin...    163   2e-45    Eucalyptus grandis [rose gum]
gb|ACN87697.1|  kinase-like protein                                     154   4e-41    Corylus avellana [European hazelnut]
gb|KCW81624.1|  hypothetical protein EUGRSUZ_C02985                     162   8e-41    Eucalyptus grandis [rose gum]
ref|XP_010049140.1|  PREDICTED: receptor-like protein kinase HSL1       162   2e-40    Eucalyptus grandis [rose gum]
ref|XP_001781606.1|  predicted protein                                  155   3e-40    
ref|XP_010275524.1|  PREDICTED: receptor-like serine/threonine-pr...    155   4e-40    Nelumbo nucifera [Indian lotus]
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          160   1e-39    Sorghum bicolor [broomcorn]
gb|ADB85328.1|  putative receptor protein kinase                        157   3e-39    Phyllostachys edulis [kikko-chiku]
gb|EEC69150.1|  hypothetical protein OsI_38089                          151   4e-39    Oryza sativa Indica Group [Indian rice]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    158   4e-39    Oryza brachyantha
ref|XP_010229848.1|  PREDICTED: proline-rich receptor-like protei...    154   4e-39    
ref|XP_002285658.2|  PREDICTED: receptor-like serine/threonine-pr...    152   6e-39    Vitis vinifera
ref|XP_008353518.1|  PREDICTED: proline-rich receptor-like protei...    150   6e-39    
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    158   6e-39    Phoenix dactylifera
gb|AFK49312.1|  unknown                                                 147   9e-39    Lotus japonicus
gb|ACN35202.1|  unknown                                                 150   1e-38    Zea mays [maize]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    157   1e-38    
ref|NP_001051418.1|  Os03g0773700                                       156   1e-38    
ref|XP_009416804.1|  PREDICTED: proline-rich receptor-like protei...    154   1e-38    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE60014.1|  hypothetical protein OsJ_12761                          157   1e-38    Oryza sativa Japonica Group [Japonica rice]
dbj|BAF01968.1|  receptor protein kinase like protein                   148   1e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297165.1|  PREDICTED: proline-rich receptor-like protei...    155   1e-38    
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             157   2e-38    
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          157   2e-38    
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    157   2e-38    
gb|AAP68887.1|  putative receptor-like protein kinase 1                 157   2e-38    
gb|EAY92008.1|  hypothetical protein OsI_13698                          157   2e-38    
ref|XP_009339374.1|  PREDICTED: receptor-like serine/threonine-pr...    150   2e-38    
ref|XP_007139338.1|  hypothetical protein PHAVU_008G021000g             155   2e-38    
gb|KCW56393.1|  hypothetical protein EUGRSUZ_I02121                     152   2e-38    
ref|NP_001054375.1|  Os05g0100700                                       148   2e-38    
gb|KGN55018.1|  hypothetical protein Csa_4G622770                       147   2e-38    
ref|XP_010030811.1|  PREDICTED: proline-rich receptor-like protei...    152   3e-38    
gb|KHG05309.1|  LRR receptor-like serine/threonine-protein kinase...    145   3e-38    
ref|XP_010097823.1|  Proline-rich receptor-like protein kinase PE...    154   3e-38    
ref|XP_001763816.1|  predicted protein                                  150   4e-38    
ref|XP_008366523.1|  PREDICTED: receptor-like serine/threonine-pr...    149   4e-38    
ref|XP_009356507.1|  PREDICTED: proline-rich receptor-like protei...    154   4e-38    
emb|CDP02660.1|  unnamed protein product                                155   5e-38    
gb|KEH38485.1|  receptor-like kinase                                    148   5e-38    
ref|XP_009791189.1|  PREDICTED: proline-rich receptor-like protei...    154   5e-38    
ref|XP_008243134.1|  PREDICTED: proline-rich receptor-like protei...    154   5e-38    
gb|EMS54404.1|  Proline-rich receptor-like protein kinase PERK8         152   6e-38    
gb|EYU28934.1|  hypothetical protein MIMGU_mgv1a025530mg                150   6e-38    
gb|KJB12909.1|  hypothetical protein B456_002G044400                    149   6e-38    
ref|XP_001777220.1|  predicted protein                                  149   6e-38    
gb|AES76893.2|  receptor-like kinase                                    150   6e-38    
ref|XP_009779466.1|  PREDICTED: receptor-like protein kinase HSL1       155   7e-38    
gb|KJB82092.1|  hypothetical protein B456_013G175900                    149   7e-38    
gb|KDO70152.1|  hypothetical protein CISIN_1g005443mg                   153   7e-38    
ref|XP_006484379.1|  PREDICTED: proline-rich receptor-like protei...    154   7e-38    
ref|XP_003530471.1|  PREDICTED: proline-rich receptor-like protei...    153   7e-38    
ref|XP_003620675.1|  Receptor protein kinase PERK1                      150   7e-38    
ref|XP_006437775.1|  hypothetical protein CICLE_v10030737mg             154   8e-38    
gb|AFK49115.1|  unknown                                                 147   8e-38    
ref|XP_007225200.1|  hypothetical protein PRUPE_ppa002064mg             153   8e-38    
ref|NP_001169902.1|  uncharacterized protein LOC100383797               151   8e-38    
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    155   8e-38    
ref|XP_003551795.1|  PREDICTED: proline-rich receptor-like protei...    153   8e-38    
gb|KHN13807.1|  Proline-rich receptor-like protein kinase PERK9         153   9e-38    
gb|KJB07471.1|  hypothetical protein B456_001G026000                    154   9e-38    
ref|XP_009587881.1|  PREDICTED: receptor-like protein kinase HSL1       154   9e-38    
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    154   1e-37    
ref|XP_011045570.1|  PREDICTED: receptor-like serine/threonine-pr...    149   1e-37    
ref|NP_001049659.1|  Os03g0266800                                       152   1e-37    
ref|XP_006656979.1|  PREDICTED: proline-rich receptor-like protei...    149   1e-37    
ref|XP_010241346.1|  PREDICTED: receptor-like serine/threonine-pr...    149   1e-37    
ref|XP_007149372.1|  hypothetical protein PHAVU_005G064700g             149   1e-37    
ref|XP_006384225.1|  hypothetical protein POPTR_0004s10490g             152   1e-37    
ref|XP_006596937.1|  PREDICTED: protein kinase family protein iso...    148   1e-37    
emb|CAN68080.1|  hypothetical protein VITISV_021805                     144   1e-37    
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    154   1e-37    
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    154   1e-37    
ref|XP_010241342.1|  PREDICTED: receptor-like serine/threonine-pr...    148   1e-37    
ref|XP_010241344.1|  PREDICTED: receptor-like serine/threonine-pr...    148   1e-37    
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...    153   1e-37    
gb|KHG05608.1|  Proline-rich receptor-like protein kinase PERK8         153   1e-37    
ref|XP_009401207.1|  PREDICTED: receptor-like serine/threonine-pr...    152   2e-37    
ref|XP_009401208.1|  PREDICTED: receptor-like serine/threonine-pr...    152   2e-37    
gb|KJB48795.1|  hypothetical protein B456_008G087500                    154   2e-37    
ref|XP_002453157.1|  hypothetical protein SORBIDRAFT_04g000920          154   2e-37    
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    154   2e-37    
ref|XP_009599624.1|  PREDICTED: proline-rich receptor-like protei...    152   2e-37    
ref|XP_007033397.1|  Proline-rich receptor protein kinase PERK10 ...    152   2e-37    
ref|XP_008341853.1|  PREDICTED: proline-rich receptor-like protei...    152   2e-37    
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    154   2e-37    
ref|XP_011654019.1|  PREDICTED: receptor-like serine/threonine-pr...    148   2e-37    
dbj|BAD18097.1|  putative serine/threonine protein kinase               145   2e-37    
ref|XP_010106739.1|  Receptor-like serine/threonine-protein kinase      148   2e-37    
ref|XP_004237515.1|  PREDICTED: leucine-rich repeat receptor-like...    154   2e-37    
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    154   2e-37    
ref|XP_009355906.1|  PREDICTED: proline-rich receptor-like protei...    152   2e-37    
emb|CBI16871.3|  unnamed protein product                                149   2e-37    
ref|XP_002991493.1|  hypothetical protein SELMODRAFT_133636             149   2e-37    
ref|XP_008452434.1|  PREDICTED: receptor-like serine/threonine-pr...    147   2e-37    
ref|XP_007046367.1|  Proline-rich receptor protein kinase PERK10 ...    152   2e-37    
ref|XP_010474392.1|  PREDICTED: receptor-like serine/threonine-pr...    147   2e-37    
ref|XP_009398051.1|  PREDICTED: probable leucine-rich repeat rece...    154   2e-37    
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    153   2e-37    
ref|XP_002978933.1|  hypothetical protein SELMODRAFT_177358             149   2e-37    
ref|XP_004238983.1|  PREDICTED: proline-rich receptor-like protei...    152   3e-37    
gb|KJB43162.1|  hypothetical protein B456_007G187200                    152   3e-37    
ref|XP_010428983.1|  PREDICTED: receptor-like serine/threonine-pr...    147   3e-37    
ref|XP_008341851.1|  PREDICTED: proline-rich receptor-like protei...    151   3e-37    
ref|XP_009371020.1|  PREDICTED: proline-rich receptor-like protei...    152   3e-37    
ref|XP_011098153.1|  PREDICTED: receptor-like serine/threonine-pr...    147   3e-37    
gb|KEH21835.1|  receptor-like kinase                                    152   3e-37    
ref|XP_006338285.1|  PREDICTED: proline-rich receptor-like protei...    151   3e-37    
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    153   3e-37    
ref|XP_002300445.2|  hypothetical protein POPTR_0001s38980g             147   3e-37    
gb|EAZ41508.1|  hypothetical protein OsJ_26033                          153   3e-37    
gb|KHG19858.1|  Receptor-like protein kinase HSL1                       153   3e-37    
ref|XP_002981408.1|  leucine rich repeat receptor kinase                150   4e-37    
ref|XP_003590907.1|  Pentatricopeptide repeat-containing protein        154   4e-37    
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    152   4e-37    
ref|XP_006389978.1|  hypothetical protein EUTSA_v10019485mg             147   4e-37    
ref|XP_009357018.1|  PREDICTED: proline-rich receptor-like protei...    151   4e-37    
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                        152   4e-37    
gb|AES61158.2|  LRR receptor-like kinase                                153   4e-37    
ref|XP_009352556.1|  PREDICTED: receptor-like protein kinase HSL1       152   4e-37    
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             152   4e-37    
ref|NP_177974.1|  receptor-like serine/threonine-protein kinase         147   5e-37    
ref|XP_003558273.1|  PREDICTED: LRR receptor-like serine/threonin...    150   5e-37    
ref|XP_008802949.1|  PREDICTED: LRR receptor-like serine/threonin...    150   5e-37    
gb|ACL54651.1|  unknown                                                 149   5e-37    
ref|XP_006477799.1|  PREDICTED: receptor-like serine/threonine-pr...    147   5e-37    
ref|XP_011046777.1|  PREDICTED: proline-rich receptor-like protei...    151   5e-37    
gb|EMS66270.1|  Somatic embryogenesis receptor kinase 1                 149   5e-37    
gb|KHN47566.1|  Leucine-rich repeat receptor-like serine/threonin...    151   5e-37    
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...    152   5e-37    
gb|KDO52114.1|  hypothetical protein CISIN_1g018702mg                   147   5e-37    
ref|XP_006649812.1|  PREDICTED: LRR receptor-like serine/threonin...    150   5e-37    
ref|XP_002979054.1|  hypothetical protein SELMODRAFT_177353             147   5e-37    
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...    152   5e-37    
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390             152   5e-37    
ref|XP_004228851.1|  PREDICTED: proline-rich receptor-like protei...    150   5e-37    
ref|XP_009401098.1|  PREDICTED: receptor-like serine/threonine-pr...    145   5e-37    
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    152   5e-37    
ref|XP_006340511.1|  PREDICTED: leucine-rich repeat receptor-like...    152   6e-37    
ref|XP_006442320.1|  hypothetical protein CICLE_v10020891mg             147   6e-37    
gb|EAZ02682.1|  hypothetical protein OsI_24796                          152   6e-37    
ref|XP_002526416.1|  serine-threonine protein kinase, plant-type,...    143   6e-37    
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          152   6e-37    
gb|KCW86402.1|  hypothetical protein EUGRSUZ_B030732                    149   6e-37    
ref|XP_002969939.1|  hypothetical protein SELMODRAFT_93043              149   6e-37    
ref|XP_008650543.1|  PREDICTED: proline-rich receptor-like protei...    147   6e-37    
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    152   6e-37    
ref|XP_007217642.1|  hypothetical protein PRUPE_ppa002001mg             150   6e-37    
ref|XP_010933053.1|  PREDICTED: LRR receptor-like serine/threonin...    149   6e-37    
gb|EEE61988.1|  hypothetical protein OsJ_16769                          150   6e-37    
ref|XP_009623756.1|  PREDICTED: leucine-rich repeat receptor-like...    152   6e-37    
ref|XP_008230372.1|  PREDICTED: proline-rich receptor-like protei...    151   7e-37    
gb|ACJ85782.1|  unknown                                                 146   7e-37    
ref|XP_011077492.1|  PREDICTED: proline-rich receptor-like protei...    150   7e-37    
gb|EEC78335.1|  hypothetical protein OsI_18076                          149   7e-37    
gb|EEE65746.1|  hypothetical protein OsJ_21402                          153   7e-37    
ref|XP_008784377.1|  PREDICTED: receptor-like serine/threonine-pr...    146   7e-37    
emb|CDY04245.1|  BnaC06g25700D                                          150   7e-37    
gb|KJB50828.1|  hypothetical protein B456_008G188800                    150   7e-37    
gb|ABO61511.1|  LRR receptor-like protein kinase m1'                    152   7e-37    
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    152   8e-37    
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    152   8e-37    
ref|XP_011077496.1|  PREDICTED: proline-rich receptor-like protei...    150   8e-37    
ref|XP_004514412.1|  PREDICTED: proline-rich receptor-like protei...    150   8e-37    
ref|XP_008785758.1|  PREDICTED: leucine-rich repeat receptor-like...    150   8e-37    
ref|XP_008657244.1|  PREDICTED: proline-rich receptor-like protei...    149   8e-37    
gb|EPS68268.1|  hypothetical protein M569_06502                         152   8e-37    
ref|XP_009783572.1|  PREDICTED: leucine-rich repeat receptor-like...    152   9e-37    
emb|CDY07370.1|  BnaA07g24490D                                          149   9e-37    
ref|XP_002516533.1|  serine-threonine protein kinase, plant-type,...    152   9e-37    
ref|XP_002279468.1|  PREDICTED: proline-rich receptor-like protei...    150   9e-37    
gb|AES94465.2|  LRR receptor-like kinase family protein                 152   9e-37    
gb|AAC36318.1|  leucine-rich receptor-like protein kinase               152   9e-37    
ref|XP_010046601.1|  PREDICTED: proline-rich receptor-like protei...    150   9e-37    
ref|XP_009344359.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    151   9e-37    
ref|XP_009609534.1|  PREDICTED: proline-rich receptor-like protei...    150   1e-36    
ref|XP_001777608.1|  predicted protein                                  149   1e-36    
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...    150   1e-36    
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
gb|AFS64762.1|  protein kinase                                          144   1e-36    
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
gb|KHN47452.1|  Receptor-like serine/threonine-protein kinase           146   1e-36    
ref|XP_009105023.1|  PREDICTED: proline-rich receptor-like protei...    149   1e-36    
ref|XP_008444991.1|  PREDICTED: receptor-like protein kinase HSL1       151   1e-36    
ref|XP_008339725.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    150   1e-36    
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             151   1e-36    
dbj|BAJ89729.1|  predicted protein                                      151   1e-36    
gb|AAT28307.1|  leucine-rich repeat receptor-like protein kinase        151   1e-36    
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
gb|KHN12015.1|  Leucine-rich repeat receptor-like serine/threonin...    149   1e-36    
ref|XP_003611507.1|  Receptor-like protein kinase                       152   1e-36    
ref|XP_010416831.1|  PREDICTED: receptor-like serine/threonine-pr...    146   1e-36    
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    151   1e-36    
ref|XP_008345968.1|  PREDICTED: receptor-like protein kinase HSL1       151   1e-36    
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
gb|AAT28308.1|  leucine-rich repeat receptor-like protein kinase        151   1e-36    
gb|EPS74129.1|  hypothetical protein M569_00625                         151   1e-36    
ref|XP_007211497.1|  hypothetical protein PRUPE_ppa007835mg             145   1e-36    
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    151   1e-36    
ref|XP_004304153.1|  PREDICTED: proline-rich receptor-like protei...    149   1e-36    
gb|AAT28309.1|  leucine-rich repeat receptor-like protein kinase        151   1e-36    
ref|XP_008444269.1|  PREDICTED: LRR receptor-like serine/threonin...    148   1e-36    
ref|XP_010112590.1|  LRR receptor-like serine/threonine-protein k...    148   1e-36    
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    151   1e-36    
ref|XP_011028003.1|  PREDICTED: LRR receptor-like serine/threonin...    149   1e-36    
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    151   1e-36    
ref|XP_004966984.1|  PREDICTED: proline-rich receptor-like protei...    148   1e-36    
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_006368262.1|  hypothetical protein POPTR_0001s01120g             145   1e-36    
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_004232101.1|  PREDICTED: proline-rich receptor-like protei...    149   1e-36    
ref|XP_012079496.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-36    
ref|XP_010069084.1|  PREDICTED: probable leucine-rich repeat rece...    151   2e-36    
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    151   2e-36    
ref|XP_008804749.1|  PREDICTED: probable leucine-rich repeat rece...    151   2e-36    
ref|XP_006660538.1|  PREDICTED: receptor-like protein kinase HSL1...    149   2e-36    
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    151   2e-36    
ref|XP_007153306.1|  hypothetical protein PHAVU_003G024000g             149   2e-36    
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           151   2e-36    
gb|KHG23750.1|  Proline-rich receptor-like protein kinase PERK10        149   2e-36    
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                        150   2e-36    
ref|XP_008383683.1|  PREDICTED: receptor-like protein kinase HSL1       151   2e-36    
gb|ABO61514.1|  LRR receptor-like protein kinase m4                     150   2e-36    
ref|XP_010916863.1|  PREDICTED: probable LRR receptor-like serine...    148   2e-36    
gb|KDO77158.1|  hypothetical protein CISIN_1g012213mg                   147   2e-36    
gb|AEP14552.1|  somatic embryogenesis receptor kinase 2                 148   2e-36    
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-36    
ref|XP_008645155.1|  PREDICTED: leucine-rich repeat receptor-like...    151   2e-36    
ref|XP_008337667.1|  PREDICTED: receptor-like protein kinase HSL1       150   2e-36    
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    150   2e-36    
emb|CDY08759.1|  BnaA06g24650D                                          150   2e-36    
ref|XP_003575217.1|  PREDICTED: somatic embryogenesis receptor ki...    148   2e-36    
ref|XP_004294182.1|  PREDICTED: receptor-like serine/threonine-pr...    145   2e-36    
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             150   2e-36    
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    150   2e-36    
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-36    



>gb|AGS56396.1| LRR receptor-like serine/threonine-protein kinase, partial [Populus 
tremula]
Length=413

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 226/248 (91%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  166  HGPMKKKKLDWDTRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  225

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK LC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNE 
Sbjct  226  IAKRLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNEC  285

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANN VME+VD EI+ATC+DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  286  NLHHLILSKTANNEVMETVDPEITATCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRV  345

Query  456  LGSLMP-SSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P  + PKQ  Q P  APLPSAKVPCY+DEY N+++P +L CPSMSTSDAQLFLKF
Sbjct  346  LGSLVPLITPPKQCTQAPP-APLPSAKVPCYIDEYANIKSPHILNCPSMSTSDAQLFLKF  404

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  405  GEVISQNS  412



>ref|XP_006452986.1| hypothetical protein CICLE_v100073972mg, partial [Citrus clementina]
 gb|ESR66226.1| hypothetical protein CICLE_v100073972mg, partial [Citrus clementina]
Length=400

 Score =   401 bits (1030),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 226/248 (91%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  153  HGPTKKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  212

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTGRKAVDNE 
Sbjct  213  IAKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNEC  272

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANN VME+VD EISATC+DLG VKKVFQLALLC+KRQP++RP+MHEV+RV
Sbjct  273  NLHHLILSKTANNDVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRV  332

Query  456  LGSLMPSSHP-KQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P+  P KQ    PS A L SAKVPCY DEY NL+TP +L CPSMSTSDAQLFLKF
Sbjct  333  LGSLVPAPEPQKQPTSIPS-ALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKF  391

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  392  GEVISQNS  399



>emb|CDP13474.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   417 bits (1072),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 213/247 (86%), Positives = 230/247 (93%), Gaps = 0/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK++KLDWDTRL IALGAAEGLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  743  HGPTKKQKLDWDTRLRIALGAAEGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  802

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCT+K++TSTYIMGTIGYIDPEYA TSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  803  IAKSLCTTKTHTSTYIMGTIGYIDPEYAGTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  862

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH+LILTKAANNAVM +VD EISATC DLG+VKKVFQLALLC++RQPSERP+MHEVARV
Sbjct  863  NLHYLILTKAANNAVMGTVDPEISATCNDLGEVKKVFQLALLCSRRQPSERPTMHEVARV  922

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGSLMPSS PK +   P+   LPSAKVPCYMDEY NL+TPQL+ C SMSTSDAQLFLKFG
Sbjct  923  LGSLMPSSTPKMLTTNPTANLLPSAKVPCYMDEYANLKTPQLVNCSSMSTSDAQLFLKFG  982

Query  276  EVISQNS  256
            EVISQNS
Sbjct  983  EVISQNS  989



>ref|XP_006353850.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Solanum tuberosum]
Length=990

 Score =   414 bits (1064),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  987  TKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  808
            TK+KKLDW TRL IALG+A+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFGIAK
Sbjct  746  TKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  805

Query  807  SLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  628
            SLC SK+YTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH
Sbjct  806  SLCISKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  865

Query  627  HLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGS  448
            H+ILTKAANNAVME+VD EI+ TC+DL DVKKVFQLALLC+KRQP+ERP+MHEVARVL S
Sbjct  866  HMILTKAANNAVMETVDPEITGTCKDLADVKKVFQLALLCSKRQPAERPTMHEVARVLES  925

Query  447  LMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVI  268
            L+P +  KQ N TPSLA LPSAKVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVI
Sbjct  926  LIPVAETKQPNPTPSLALLPSAKVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFGEVI  985

Query  267  SQNS  256
            SQNS
Sbjct  986  SQNS  989



>ref|XP_004245043.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Solanum lycopersicum]
Length=990

 Score =   412 bits (1060),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 211/244 (86%), Positives = 227/244 (93%), Gaps = 0/244 (0%)
 Frame = -3

Query  987  TKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  808
            TK+KKLDW TRL IALG+A+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFGIAK
Sbjct  746  TKKKKLDWVTRLRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  805

Query  807  SLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  628
            SLC SK+YTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH
Sbjct  806  SLCISKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  865

Query  627  HLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGS  448
            HLILTKAAN+AVME+VD EI+ TC+DL DVKKVFQLALLC+KRQP+ERP+MHEVARVL S
Sbjct  866  HLILTKAANDAVMETVDPEITCTCKDLADVKKVFQLALLCSKRQPAERPTMHEVARVLES  925

Query  447  LMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVI  268
            L+P +  KQ N TPSLA LPSAKVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFGEVI
Sbjct  926  LIPVAETKQPNPTPSLALLPSAKVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFGEVI  985

Query  267  SQNS  256
            SQNS
Sbjct  986  SQNS  989



>ref|XP_009605434.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana tomentosiformis]
Length=991

 Score =   412 bits (1059),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 210/246 (85%), Positives = 229/246 (93%), Gaps = 1/246 (0%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K+KKLDWDTR+ IALG+A+GLAYLHHDC+PRIIHRDVKSSNILLD+DFEAHLTDFGIA
Sbjct  747  SSKKKKLDWDTRIRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILLDRDFEAHLTDFGIA  806

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLCTSK+YTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL
Sbjct  807  KSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  866

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HH+ILTKAANNAVME+ D EI+ATC+DLGDVKKVFQLALLCTKRQP+ERP+MHEVARVL 
Sbjct  867  HHVILTKAANNAVMETADPEITATCKDLGDVKKVFQLALLCTKRQPAERPTMHEVARVLE  926

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            SL+P +  KQ N TP  A LPSAKVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFGEV
Sbjct  927  SLVPVAETKQPNPTPP-ALLPSAKVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFGEV  985

Query  270  ISQNST  253
            ISQNS 
Sbjct  986  ISQNSV  991



>gb|KDO73637.1| hypothetical protein CISIN_1g0023491mg, partial [Citrus sinensis]
Length=764

 Score =   404 bits (1038),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 227/248 (92%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  517  HGPTKKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  576

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTGRKAVDNE 
Sbjct  577  IAKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNEC  636

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD EISATC+DLG VKKVFQLALLC+KRQP++RP+MHEV+RV
Sbjct  637  NLHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRV  696

Query  456  LGSLMPSSHP-KQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P+  P KQ    PS A L SAKVPCY DEY NL+TP +L CPSMSTSDAQLFLKF
Sbjct  697  LGSLVPAPEPQKQPTSIPS-ALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKF  755

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  756  GEVISQNS  763



>ref|XP_008220576.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Prunus mume]
Length=991

 Score =   408 bits (1049),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 211/250 (84%), Positives = 229/250 (92%), Gaps = 3/250 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  741  HGPSKKKKLDWATRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  800

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYG+VLLELLTGRKAVDNES
Sbjct  801  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNES  860

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD E++ATC DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  861  NLHHLILSKTANNAVMETVDPEVTATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRV  920

Query  456  LGSLMPS-SHPKQVN--QTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            LGSL+PS + PKQ+     PS   LPSAKVPCYMDEY NL+TP +L CPSMSTSDAQLFL
Sbjct  921  LGSLVPSPAPPKQLTPMNPPSTQLLPSAKVPCYMDEYANLKTPHMLNCPSMSTSDAQLFL  980

Query  285  KFGEVISQNS  256
            KFGEVISQNS
Sbjct  981  KFGEVISQNS  990



>ref|XP_008220575.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Prunus mume]
Length=992

 Score =   408 bits (1049),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 211/250 (84%), Positives = 229/250 (92%), Gaps = 3/250 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  742  HGPSKKKKLDWATRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  801

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYG+VLLELLTGRKAVDNES
Sbjct  802  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNES  861

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD E++ATC DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  862  NLHHLILSKTANNAVMETVDPEVTATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRV  921

Query  456  LGSLMPS-SHPKQVN--QTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            LGSL+PS + PKQ+     PS   LPSAKVPCYMDEY NL+TP +L CPSMSTSDAQLFL
Sbjct  922  LGSLVPSPAPPKQLTPMNPPSTQLLPSAKVPCYMDEYANLKTPHMLNCPSMSTSDAQLFL  981

Query  285  KFGEVISQNS  256
            KFGEVISQNS
Sbjct  982  KFGEVISQNS  991



>emb|CAN74952.1| hypothetical protein VITISV_025649 [Vitis vinifera]
Length=756

 Score =   399 bits (1026),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/246 (83%), Positives = 227/246 (92%), Gaps = 1/246 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  503  HGPTKKKKLDWETRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  562

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK LC+SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  563  IAKVLCSSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  622

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K  NNAVME+VD +I+ATC+DLG VKKVFQLALLCTK+QPS+RP+MHEV RV
Sbjct  623  NLHHLILSKTTNNAVMETVDPDITATCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRV  682

Query  456  LGSLMPSSHPKQVNQTPS-LAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P++ PKQ+  T +  APLPS KVPCYMDEY NL+TP ++ C SMSTSDAQLFLKF
Sbjct  683  LGSLVPATAPKQIALTTTPPAPLPSTKVPCYMDEYANLKTPHMVNCSSMSTSDAQLFLKF  742

Query  279  GEVISQ  262
            GEVISQ
Sbjct  743  GEVISQ  748



>dbj|BAK61880.1| LRR receptor-like serine/threonine-protein kinase [Citrus unshiu]
Length=933

 Score =   404 bits (1038),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 227/248 (92%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  686  HGPTKKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  745

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTGRKAVDNE 
Sbjct  746  IAKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNEC  805

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD EISATC+DLG VKKVFQLALLC+KRQP++RP+MHEV+RV
Sbjct  806  NLHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRV  865

Query  456  LGSLMPSSHP-KQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P+  P KQ    PS A L SAKVPCY DEY NL+TP +L CPSMSTSDAQLFLKF
Sbjct  866  LGSLVPAPEPQKQPTSIPS-ALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKF  924

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  925  GEVISQNS  932



>ref|XP_006474503.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Citrus sinensis]
Length=981

 Score =   404 bits (1039),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 227/248 (92%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  734  HGPTKKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTGRKAVDNE 
Sbjct  794  IAKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNEC  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD EISATC+DLG VKKVFQLALLC+KRQP++RP+MHEV+RV
Sbjct  854  NLHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRV  913

Query  456  LGSLMPSSHP-KQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P+  P KQ    PS A L SAKVPCY DEY NL+TP +L CPSMSTSDAQLFLKF
Sbjct  914  LGSLVPAPEPQKQPTSIPS-ALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKF  972

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  973  GEVISQNS  980



>ref|XP_009802873.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana sylvestris]
Length=990

 Score =   404 bits (1037),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 229/248 (92%), Gaps = 1/248 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDWDTR+ IALG+A+GLAYLHHDC+PRIIHRDVKSSNILLD+DFEAHLTDFG
Sbjct  744  HGPSKKKKLDWDTRIRIALGSAQGLAYLHHDCSPRIIHRDVKSSNILLDRDFEAHLTDFG  803

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCTSK+YTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  804  IAKSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  863

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHH+ILTKAANNAVME+VD EI+ATC+DLGDVKKVFQLALLCTKRQP+ERP+MHEVARV
Sbjct  864  NLHHMILTKAANNAVMETVDPEITATCKDLGDVKKVFQLALLCTKRQPAERPTMHEVARV  923

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P +  KQ N T     LPSAKVPCYMDEY NL+TP L+ C SMSTSDAQLFLKFG
Sbjct  924  LESLVPVAETKQPNPT-PPTLLPSAKVPCYMDEYVNLKTPHLVNCSSMSTSDAQLFLKFG  982

Query  276  EVISQNST  253
            EVISQNS 
Sbjct  983  EVISQNSV  990



>ref|NP_001235257.1| ERECTA [Glycine max]
 gb|ACM89555.1| ERECTA [Glycine max]
Length=467

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 224/248 (90%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+ RL IALGAA+GLAYLHHDC PRIIHRDVKSSNILLD DFE HLTDFG
Sbjct  220  HGPTKKKKLDWELRLKIALGAAQGLAYLHHDCCPRIIHRDVKSSNILLDADFEPHLTDFG  279

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  280  IAKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  339

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KAA NAVME+VD +I+ATC+DLG VKKV+QLALLCTKRQP++RP+MHEV RV
Sbjct  340  NLHHLILSKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRV  399

Query  456  LGSLMPS-SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+ S + PKQ+   P  A  PSAKVPCY+DEY NL+TP L+ CPSMSTSDAQLFLKF
Sbjct  400  LGSLVLSNTPPKQLAALPP-ASNPSAKVPCYVDEYANLKTPHLVNCPSMSTSDAQLFLKF  458

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  459  GEVISQNS  466



>ref|XP_006381995.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
 gb|ERP59792.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
Length=890

 Score =   400 bits (1029),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 225/248 (91%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFE HLTDFG
Sbjct  643  HGPMKKKKLDWDTRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEPHLTDFG  702

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK LC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNE 
Sbjct  703  IAKRLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNEC  762

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANN VME+VD EI+ATC+DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  763  NLHHLILSKTANNEVMETVDPEITATCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRV  822

Query  456  LGSLMP-SSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P  + PKQ  Q P  APLPSAKVPCY+DEY N+++P +L CPSMSTSDAQLFLKF
Sbjct  823  LGSLVPLITPPKQCTQAPP-APLPSAKVPCYIDEYANIKSPHILNCPSMSTSDAQLFLKF  881

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  882  GEVISQNS  889



>ref|XP_007225368.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
 gb|EMJ26567.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
Length=983

 Score =   402 bits (1034),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 209/252 (83%), Positives = 226/252 (90%), Gaps = 7/252 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  733  HGPSKKKKLDWATRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYG+VLLELLTGRKAVDNES
Sbjct  793  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNES  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD E++ATC DL  VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  853  NLHHLILSKTANNAVMETVDPEVTATCMDLAAVKKVFQLALLCTKRQPTDRPTMHEVTRV  912

Query  456  LGSLMPSSHPKQVNQTPSLAP-----LPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQL  292
            LGSL+PS  P    Q+  L P     LPSAKVPCYMDEY NL+TP +L CPSMSTSDAQL
Sbjct  913  LGSLVPS--PALPKQSTPLNPASTQLLPSAKVPCYMDEYANLKTPHMLNCPSMSTSDAQL  970

Query  291  FLKFGEVISQNS  256
            FLKFGEVISQNS
Sbjct  971  FLKFGEVISQNS  982



>emb|CBI20727.3| unnamed protein product [Vitis vinifera]
Length=986

 Score =   400 bits (1029),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/247 (83%), Positives = 227/247 (92%), Gaps = 3/247 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  733  HGPTKKKKLDWETRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK LC+SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  793  IAKVLCSSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K  NNAVME+VD +I+ATC+DLG VKKVFQLALLCTK+QPS+RP+MHEV RV
Sbjct  853  NLHHLILSKTTNNAVMETVDPDITATCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRV  912

Query  456  LGSLMPSSHPKQV--NQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSL+P++ PKQ+    TP  APLPS KVPCYMDEY NL+TP ++ C SMSTSDAQLFLK
Sbjct  913  LGSLVPATAPKQIALTTTPP-APLPSTKVPCYMDEYANLKTPHMVNCSSMSTSDAQLFLK  971

Query  282  FGEVISQ  262
            FGEVISQ
Sbjct  972  FGEVISQ  978



>ref|XP_002280069.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Vitis vinifera]
Length=994

 Score =   401 bits (1030),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/246 (83%), Positives = 227/246 (92%), Gaps = 1/246 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  741  HGPTKKKKLDWETRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  800

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK LC+SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  801  IAKVLCSSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  860

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K  NNAVME+VD +I+ATC+DLG VKKVFQLALLCTK+QPS+RP+MHEV RV
Sbjct  861  NLHHLILSKTTNNAVMETVDPDITATCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRV  920

Query  456  LGSLMPSSHPKQVNQTPS-LAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P++ PKQ+  T +  APLPS KVPCYMDEY NL+TP ++ C SMSTSDAQLFLKF
Sbjct  921  LGSLVPATAPKQIALTTTPPAPLPSTKVPCYMDEYANLKTPHMVNCSSMSTSDAQLFLKF  980

Query  279  GEVISQ  262
            GEVISQ
Sbjct  981  GEVISQ  986



>ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=958

 Score =   397 bits (1021),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/249 (82%), Positives = 225/249 (90%), Gaps = 4/249 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWD RL +ALGAA+GLAYLHHDC+PRIIHRDVKSSNILLD DFE HLTDFG
Sbjct  711  HGPTKKKKLDWDLRLKVALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDSDFEPHLTDFG  770

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  771  IAKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  830

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL KAA NAVME+VD +I+ATC+DLG VKKV+QLALLCTKRQP++RP+MHEV RV
Sbjct  831  NLHHLILAKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRV  890

Query  456  LGSLMPSSHPKQVNQTPSLAPL--PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSL+PS+ P +  Q  +L P   PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLK
Sbjct  891  LGSLVPSNTPPK--QPAALPPASNPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLK  948

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  949  FGEVISQNS  957



>ref|XP_011019342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Populus euphratica]
Length=980

 Score =   397 bits (1020),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 222/248 (90%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFE HLTDFG
Sbjct  733  HGPMKKTKLDWDTRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEPHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK LC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNE 
Sbjct  793  IAKRLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNEC  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANN VME+VD EI+ATC DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  853  NLHHLILSKTANNEVMETVDPEITATCTDLGAVKKVFQLALLCTKRQPADRPTMHEVTRV  912

Query  456  LGSLMPS-SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+P  + PKQ  Q P  APLPSAK PCY+DEY N+++P +L CPSMSTSDAQLFLKF
Sbjct  913  LGSLVPPITPPKQCTQAPP-APLPSAKAPCYIDEYANIKSPHILNCPSMSTSDAQLFLKF  971

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  972  GEVISQNS  979



>ref|XP_008452789.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=991

 Score =   395 bits (1016),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 226/248 (91%), Gaps = 5/248 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G+TK+KKLDWDTRL IA GAA+GL+YLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFGI
Sbjct  746  GSTKKKKLDWDTRLNIAHGAAQGLSYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGI  805

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLCTSK+YTSTYIMGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTGRKAVDNESN
Sbjct  806  AKSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNESN  865

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LH LIL+K ANNAVME+VD EI+ATC+DLG VKK FQLALLCTKRQPS+RP+MHEV RV+
Sbjct  866  LHQLILSKTANNAVMETVDPEITATCKDLGAVKKAFQLALLCTKRQPSDRPTMHEVTRVI  925

Query  453  GSLMPSSH-PKQVNQTPSLAPL-PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            GSL+PS+  PK   QTP++  + PSAK  CY DEY NL+TP +L CP+MSTSDAQLF+KF
Sbjct  926  GSLLPSAATPK---QTPTITTIPPSAKSSCYKDEYANLKTPHVLNCPTMSTSDAQLFVKF  982

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  983  GEVISQNS  990



>ref|XP_010098375.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXB74899.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=1011

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/252 (82%), Positives = 227/252 (90%), Gaps = 5/252 (2%)
 Frame = -3

Query  996   YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
             +G TK+KKLDWDTRL IALGAA+GL+YLHHDC+PRIIHRD+KSSNILLDKDFEAHLTDFG
Sbjct  761   HGPTKKKKLDWDTRLKIALGAAQGLSYLHHDCSPRIIHRDIKSSNILLDKDFEAHLTDFG  820

Query  816   IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
             IAKSLC SKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  821   IAKSLCISKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  880

Query  636   NLHHLILTKAANNAVMESVDAEISATC-QDLGDVKKVFQLALLCTKRQPSERPSMHEVAR  460
             NLHHLIL+K ANNAVME+VD EI+ATC +DLG V+KVFQLALLC KRQP++RP+MHEV R
Sbjct  881   NLHHLILSKTANNAVMETVDPEITATCKEDLGAVRKVFQLALLCAKRQPTDRPTMHEVTR  940

Query  459   VLGSLMPSSHPKQVNQTPSLAP---LPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLF  289
             VL SL P + P +   TP+L P   LPSAKVP Y+DEY NL+TP L+ CPSMSTSDAQLF
Sbjct  941   VLSSLTPPAAPPK-QATPALPPPSTLPSAKVPGYIDEYANLKTPHLVNCPSMSTSDAQLF  999

Query  288   LKFGEVISQNST  253
             LKFGEVISQNST
Sbjct  1000  LKFGEVISQNST  1011



>ref|XP_004303459.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Fragaria vesca subsp. vesca]
Length=983

 Score =   395 bits (1014),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 202/245 (82%), Positives = 220/245 (90%), Gaps = 1/245 (0%)
 Frame = -3

Query  987  TKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  808
            TK+KKLDWDTR+ IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFGIAK
Sbjct  738  TKKKKLDWDTRVQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  797

Query  807  SLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  628
            SLC SK++TST +MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNE NLH
Sbjct  798  SLCISKTHTSTCVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECNLH  857

Query  627  HLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGS  448
            HLIL+K ANNAVME+VD EI++TC DLG VKKVFQLALLCTKRQP++RP+MHEV RVLGS
Sbjct  858  HLILSKTANNAVMETVDPEITSTCMDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVLGS  917

Query  447  LMPS-SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            L+PS + PKQ    P    L S K PCYMDEY NL+TP +L CPSMSTSDAQLFLKFGEV
Sbjct  918  LVPSPTQPKQATLNPLSITLSSVKAPCYMDEYANLKTPHMLNCPSMSTSDAQLFLKFGEV  977

Query  270  ISQNS  256
            ISQNS
Sbjct  978  ISQNS  982



>ref|XP_012077188.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Jatropha curcas]
 gb|KDP34024.1| hypothetical protein JCGZ_07595 [Jatropha curcas]
Length=986

 Score =   394 bits (1013),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 206/247 (83%), Positives = 223/247 (90%), Gaps = 0/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW TRL IA+GAAEGLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  733  HGPTKKKKLDWYTRLQIAIGAAEGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNE 
Sbjct  793  IAKSLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNEC  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD EI+ATC+DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  853  NLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVTRV  912

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGSL+PS   KQ        PLPSAKV CYMD+Y NL+TP ++ CPSMSTSDAQLFLKFG
Sbjct  913  LGSLLPSVPIKQCTTPAPPPPLPSAKVSCYMDDYANLKTPHMVNCPSMSTSDAQLFLKFG  972

Query  276  EVISQNS  256
            EVISQNS
Sbjct  973  EVISQNS  979



>ref|XP_002516144.1| erecta, putative [Ricinus communis]
 gb|EEF46146.1| erecta, putative [Ricinus communis]
Length=980

 Score =   394 bits (1012),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 207/247 (84%), Positives = 225/247 (91%), Gaps = 0/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  733  HGPMKKKKLDWDTRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNE 
Sbjct  793  IAKSLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNEC  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD EISATC+DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  853  NLHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRV  912

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGSL+PS+ P +       AP+PSAKV CYMDEY NL+TP ++ CPSMSTSDAQLFLKFG
Sbjct  913  LGSLVPSTTPPKQCMPAPPAPIPSAKVSCYMDEYANLKTPHMVNCPSMSTSDAQLFLKFG  972

Query  276  EVISQNS  256
            EVISQNS
Sbjct  973  EVISQNS  979



>ref|XP_004141340.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis sativus]
 gb|KGN55381.1| Erecta [Cucumis sativus]
Length=991

 Score =   394 bits (1012),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 225/248 (91%), Gaps = 5/248 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G+TK+KKLDWDTRL IA GAA+GL+YLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFGI
Sbjct  746  GSTKKKKLDWDTRLNIAHGAAQGLSYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGI  805

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLCTSK+YTSTYIMGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTGRKAVDNESN
Sbjct  806  AKSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNESN  865

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LH LIL+K ANNAVME+VD EI+ATC+DLG VKK FQLALLCTKRQPS+RP+MHEV RV+
Sbjct  866  LHQLILSKTANNAVMETVDPEITATCKDLGAVKKAFQLALLCTKRQPSDRPTMHEVTRVI  925

Query  453  GSLMPSSH-PKQVNQTPSLAPL-PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            GSL+PS+  PKQ+   P++  + PSAK  CY DEY NL+TP +L CP+MSTSDAQLF KF
Sbjct  926  GSLLPSAATPKQI---PTITTIPPSAKSSCYKDEYANLKTPHVLNCPTMSTSDAQLFAKF  982

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  983  GEVISQNS  990



>ref|XP_008393579.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=991

 Score =   393 bits (1010),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 225/249 (90%), Gaps = 2/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW TRL IALG A+GLAYLHHDC+PRIIHRD+KSSNILLDKDFEAHLTDFG
Sbjct  742  HGPSKKKKLDWTTRLQIALGTAQGLAYLHHDCSPRIIHRDIKSSNILLDKDFEAHLTDFG  801

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK+LC SK++TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  802  IAKNLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  861

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD++++ATC DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  862  NLHHLILSKTANNAVMETVDSDVTATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRV  921

Query  456  LGSLMPS-SHPKQ-VNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSL+PS + PKQ  +  P     PSAK PCY+DEY NL+TP +L CPSMSTSDAQLFLK
Sbjct  922  LGSLVPSPAPPKQPASANPPSTQHPSAKAPCYVDEYANLKTPHMLNCPSMSTSDAQLFLK  981

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  982  FGEVISQNS  990



>gb|KEH39916.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=956

 Score =   392 bits (1007),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 224/249 (90%), Gaps = 4/249 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW  RL IALGAA+GL+YLHHDC+PRIIHRDVKSSNILLD DFE HLTDFG
Sbjct  709  HGPSKKKKLDWHLRLKIALGAAQGLSYLHHDCSPRIIHRDVKSSNILLDSDFEPHLTDFG  768

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC +KS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  769  IAKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  828

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A+NAVME+VD +++ATC+DLG VKKVFQLALLCTKRQP++RP+MHEV+RV
Sbjct  829  NLHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRV  888

Query  456  LGSLMPSSHPKQVNQTPSLAPL--PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSLMPS  P +  Q   L P   PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLK
Sbjct  889  LGSLMPSVAPAK--QLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLK  946

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  947  FGEVISQNS  955



>ref|XP_003588942.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Medicago 
truncatula]
Length=978

 Score =   392 bits (1008),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 224/249 (90%), Gaps = 4/249 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW  RL IALGAA+GL+YLHHDC+PRIIHRDVKSSNILLD DFE HLTDFG
Sbjct  731  HGPSKKKKLDWHLRLKIALGAAQGLSYLHHDCSPRIIHRDVKSSNILLDSDFEPHLTDFG  790

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC +KS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  791  IAKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  850

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A+NAVME+VD +++ATC+DLG VKKVFQLALLCTKRQP++RP+MHEV+RV
Sbjct  851  NLHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRV  910

Query  456  LGSLMPSSHPKQVNQTPSLAPL--PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSLMPS  P +  Q   L P   PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLK
Sbjct  911  LGSLMPSVAPAK--QLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLK  968

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  969  FGEVISQNS  977



>gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   392 bits (1008),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 224/249 (90%), Gaps = 4/249 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW  RL IALGAA+GL+YLHHDC+PRIIHRDVKSSNILLD DFE HLTDFG
Sbjct  738  HGPSKKKKLDWHLRLKIALGAAQGLSYLHHDCSPRIIHRDVKSSNILLDSDFEPHLTDFG  797

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC +KS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  798  IAKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  857

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A+NAVME+VD +++ATC+DLG VKKVFQLALLCTKRQP++RP+MHEV+RV
Sbjct  858  NLHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRV  917

Query  456  LGSLMPSSHPKQVNQTPSLAPL--PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSLMPS  P +  Q   L P   PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLK
Sbjct  918  LGSLMPSVAPAK--QLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLK  975

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  976  FGEVISQNS  984



>gb|AIR08789.1| receptor-like kinase ERECTA [Medicago sativa]
Length=978

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 224/249 (90%), Gaps = 4/249 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW  RL IALGAA+GL+YLHHDC+PRIIHRDVKSSNILLD DFE HLTDFG
Sbjct  731  HGPSKKKKLDWHLRLKIALGAAQGLSYLHHDCSPRIIHRDVKSSNILLDSDFEPHLTDFG  790

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC +KS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  791  IAKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  850

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A+NAVME+VD +++ATC+DLG VKKVFQLALLCTKRQP++RP+MHEV+RV
Sbjct  851  NLHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRV  910

Query  456  LGSLMPSSHPKQVNQTPSLAPL--PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSLMPS  P +  Q   L P   PSAKVPCYMDEY NL+TP L+ CPSMSTSDAQLFLK
Sbjct  911  LGSLMPSVAPAK--QLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLK  968

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  969  FGEVISQNS  977



>ref|XP_007012431.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY30050.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=983

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 201/245 (82%), Positives = 219/245 (89%), Gaps = 0/245 (0%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TK+KKLDWDTRL +ALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFGIA
Sbjct  738  STKKKKLDWDTRLKVALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIA  797

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNE NL
Sbjct  798  KSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECNL  857

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            H LIL+K ANNAVME+VD EI+ATC+DLG VKK FQLALLCTKR PS+RP+MHEV RVLG
Sbjct  858  HQLILSKTANNAVMETVDPEITATCKDLGAVKKAFQLALLCTKRHPSDRPTMHEVTRVLG  917

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            SLMP   P +   +   +PLPS KV CY DEY NL+TP L+ CPSMSTSDAQLFLKFGEV
Sbjct  918  SLMPLDTPPKQPSSMQPSPLPSTKVTCYKDEYANLKTPHLVNCPSMSTSDAQLFLKFGEV  977

Query  270  ISQNS  256
            IS+NS
Sbjct  978  ISRNS  982



>ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   390 bits (1003),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 224/248 (90%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+ RL IALGAA+GLAYLHHDC PRIIHRDVKSSNI+LD DFE HLTDFG
Sbjct  733  HGPTKKKKLDWELRLKIALGAAQGLAYLHHDCCPRIIHRDVKSSNIILDADFEPHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTS LTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  793  IAKSLCPSKSHTSTYIMGTIGYIDPEYARTSHLTEKSDVYSYGIVLLELLTGRKAVDNES  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KAA NAVME+VD +I+ATC+DLG VKKV+QLALLCTKRQP++RP+MHEV RV
Sbjct  853  NLHHLILSKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRV  912

Query  456  LGSLMPSS-HPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+PSS  PKQ+   P  A  PSAKVPCY+DEY NL+TP L+ CPSMSTSDAQLFLKF
Sbjct  913  LGSLVPSSIPPKQLADLPP-ASNPSAKVPCYVDEYANLKTPHLVNCPSMSTSDAQLFLKF  971

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  972  GEVISQNS  979



>ref|XP_009362801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   390 bits (1001),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/249 (82%), Positives = 225/249 (90%), Gaps = 2/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  743  HGPSKKKKLDWTTRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  802

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK+LC SK++TST IMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  803  IAKNLCPSKTHTSTCIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  862

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K ANNAVME+VD+EI+ATC DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  863  NLHHLILSKTANNAVMETVDSEITATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRV  922

Query  456  LGSLMPS-SHPKQ-VNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            LGSL+ S + PKQ  +  P     PSAKVPCY+DEY NL+TP +L CPSMSTSDAQLFLK
Sbjct  923  LGSLVLSPAPPKQPASANPPSTQHPSAKVPCYVDEYANLKTPHMLNCPSMSTSDAQLFLK  982

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  983  FGEVISQNS  991



>ref|XP_011069519.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERECTA [Sesamum indicum]
Length=992

 Score =   389 bits (1000),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 225/249 (90%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD+EAHLTDFG
Sbjct  745  HGTTKKKKLDWETRLHIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYEAHLTDFG  804

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCTSK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRK VDNES
Sbjct  805  IAKSLCTSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNES  864

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLILTKAANN+VM++VD EIS TC+DLG+VKKVFQLALLCTK+QP +RP+MHEV RV
Sbjct  865  NLHHLILTKAANNSVMDTVDPEISETCKDLGEVKKVFQLALLCTKKQPLDRPTMHEVVRV  924

Query  456  LGSLMPSSHPKQVNQTPSL-APLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LG+L P   P+     P L APLPS+K+ CY+DEY NL+TP L+ C SMSTSDAQLFLKF
Sbjct  925  LGTLKPP--PESKTLAPILPAPLPSSKIQCYVDEYANLKTPHLVNCSSMSTSDAQLFLKF  982

Query  279  GEVISQNST  253
            GEVISQNS 
Sbjct  983  GEVISQNSV  991



>gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   389 bits (999),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 224/248 (90%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+ RL IALGAA+GLAYLHHDC PRIIHRDVKSSNILLD DFE HLTDFG
Sbjct  733  HGPTKKKKLDWELRLKIALGAAQGLAYLHHDCCPRIIHRDVKSSNILLDADFEPHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  793  IAKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KAA NAVME+VD +I+ATC+DLG VKKV+QLALLCTKRQP++RP+MHEV RV
Sbjct  853  NLHHLILSKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRV  912

Query  456  LGSLMPS-SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+ S + PKQ+   P  A  PSAKVPCY+DEY NL+TP L+ CPSMSTSDAQLFLKF
Sbjct  913  LGSLVLSNTPPKQLAALPP-ASNPSAKVPCYVDEYANLKTPHLVNCPSMSTSDAQLFLKF  971

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  972  GEVISQNS  979



>ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X3 [Cicer arietinum]
Length=959

 Score =   386 bits (991),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 225/245 (92%), Gaps = 4/245 (2%)
 Frame = -3

Query  987  TKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  808
            TK+KKL+WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLD DFE HLTDFGIAK
Sbjct  717  TKKKKLNWDLRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDADFEPHLTDFGIAK  776

Query  807  SLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  628
            SLC +KS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH
Sbjct  777  SLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  836

Query  627  HLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGS  448
            HLIL+K A+NAVME+VD +++ATC+DLG +KKV+QLALLCTKRQP++RP+MHEVARVL S
Sbjct  837  HLILSKTADNAVMETVDPDVTATCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVLAS  896

Query  447  LMP-SSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            L+P ++ PKQ+  TP L P  SAK+PCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEV
Sbjct  897  LVPLTTPPKQL--TPPL-PAISAKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEV  953

Query  270  ISQNS  256
            ISQNS
Sbjct  954  ISQNS  958



>ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Cicer arietinum]
Length=980

 Score =   386 bits (991),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 225/245 (92%), Gaps = 4/245 (2%)
 Frame = -3

Query  987  TKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  808
            TK+KKL+WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLD DFE HLTDFGIAK
Sbjct  738  TKKKKLNWDLRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDADFEPHLTDFGIAK  797

Query  807  SLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  628
            SLC +KS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH
Sbjct  798  SLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  857

Query  627  HLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGS  448
            HLIL+K A+NAVME+VD +++ATC+DLG +KKV+QLALLCTKRQP++RP+MHEVARVL S
Sbjct  858  HLILSKTADNAVMETVDPDVTATCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVLAS  917

Query  447  LMP-SSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            L+P ++ PKQ+  TP L P  SAK+PCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEV
Sbjct  918  LVPLTTPPKQL--TPPL-PAISAKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEV  974

Query  270  ISQNS  256
            ISQNS
Sbjct  975  ISQNS  979



>ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Cicer arietinum]
Length=984

 Score =   385 bits (990),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 225/245 (92%), Gaps = 4/245 (2%)
 Frame = -3

Query  987  TKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAK  808
            TK+KKL+WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLD DFE HLTDFGIAK
Sbjct  742  TKKKKLNWDLRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDADFEPHLTDFGIAK  801

Query  807  SLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  628
            SLC +KS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH
Sbjct  802  SLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLH  861

Query  627  HLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGS  448
            HLIL+K A+NAVME+VD +++ATC+DLG +KKV+QLALLCTKRQP++RP+MHEVARVL S
Sbjct  862  HLILSKTADNAVMETVDPDVTATCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVLAS  921

Query  447  LMP-SSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            L+P ++ PKQ+  TP L P  SAK+PCYMDEY NL+TP L+ CPSMSTSDAQLFLKFGEV
Sbjct  922  LVPLTTPPKQL--TPPL-PAISAKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEV  978

Query  270  ISQNS  256
            ISQNS
Sbjct  979  ISQNS  983



>ref|XP_011081595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Sesamum indicum]
Length=973

 Score =   385 bits (988),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 224/249 (90%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDW+TRL IALG+A+GLAYLHHDC+PRIIHRDVKSSNILLDKD+EAHLTDFG
Sbjct  727  HGTTKKKKLDWETRLGIALGSAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYEAHLTDFG  786

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  787  IAKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  846

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLILTKAA+NAVM++VD EI  TC+DLG+VKKVFQLALLCTKRQP +RP+MHEV RV
Sbjct  847  NLHHLILTKAASNAVMDTVDPEILETCKDLGEVKKVFQLALLCTKRQPLDRPTMHEVVRV  906

Query  456  LGSLMPSSHPKQVNQTPSL-APLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LG+L+P   P+    TP++ A L SA+  CYMDEY NL+TP L+ C SMSTSDAQLFLKF
Sbjct  907  LGTLVPP--PEAKLSTPTISAQLQSARAQCYMDEYANLKTPHLVNCSSMSTSDAQLFLKF  964

Query  279  GEVISQNST  253
            GEVISQNS 
Sbjct  965  GEVISQNSV  973



>ref|XP_003522304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Glycine max]
 gb|KHN29675.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=985

 Score =   383 bits (983),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 198/250 (79%), Positives = 222/250 (89%), Gaps = 3/250 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWD RL IALG+A+GL+YLHHDC+PRIIHRDVKSSNILLDKDFE HLTDFG
Sbjct  735  HGPTKKKKLDWDLRLKIALGSAQGLSYLHHDCSPRIIHRDVKSSNILLDKDFEPHLTDFG  794

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  795  IAKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  854

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K AN+ VME+VD +I+ATC+D+G VKKVFQLALLCTK+QP +RP+MHEV RV
Sbjct  855  NLHHLILSKTANDGVMETVDPDITATCKDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRV  914

Query  456  LGSLMPS-SHPKQVNQTPSLA--PLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SL+PS + PKQ +QT  +     PSAK+ CY DEY NL TP L+ CPSMSTSDAQLFL
Sbjct  915  LASLVPSITPPKQTDQTQVVLSDSQPSAKMQCYKDEYANLTTPHLVNCPSMSTSDAQLFL  974

Query  285  KFGEVISQNS  256
            KFGEVISQNS
Sbjct  975  KFGEVISQNS  984



>ref|XP_006578096.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Glycine max]
Length=992

 Score =   383 bits (983),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 198/250 (79%), Positives = 222/250 (89%), Gaps = 3/250 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWD RL IALG+A+GL+YLHHDC+PRIIHRDVKSSNILLDKDFE HLTDFG
Sbjct  742  HGPTKKKKLDWDLRLKIALGSAQGLSYLHHDCSPRIIHRDVKSSNILLDKDFEPHLTDFG  801

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  802  IAKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  861

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K AN+ VME+VD +I+ATC+D+G VKKVFQLALLCTK+QP +RP+MHEV RV
Sbjct  862  NLHHLILSKTANDGVMETVDPDITATCKDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRV  921

Query  456  LGSLMPS-SHPKQVNQTPSLA--PLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SL+PS + PKQ +QT  +     PSAK+ CY DEY NL TP L+ CPSMSTSDAQLFL
Sbjct  922  LASLVPSITPPKQTDQTQVVLSDSQPSAKMQCYKDEYANLTTPHLVNCPSMSTSDAQLFL  981

Query  285  KFGEVISQNS  256
            KFGEVISQNS
Sbjct  982  KFGEVISQNS  991



>ref|XP_009337156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   383 bits (983),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 199/250 (80%), Positives = 219/250 (88%), Gaps = 4/250 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+KKLDW TRL IALGAA+GLAYLHHDC+PRIIHRD+KSSNILLDKDFEAHL DFG
Sbjct  743  HGPFKKKKLDWTTRLQIALGAAQGLAYLHHDCSPRIIHRDIKSSNILLDKDFEAHLNDFG  802

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK+LC SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  803  IAKNLCHSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  862

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K  +NAVME+VD EI  TC DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  863  NLHHLILSKTESNAVMETVDPEILPTCTDLGQVKKVFQLALLCTKRQPTDRPTMHEVTRV  922

Query  456  LGSLMPSSHPKQVNQTPSLAP---LPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SLMPS  P +   TP+  P   LP  KVPCY+DEY N++TP LL CPSMSTSDAQLFL
Sbjct  923  LASLMPSPAPPK-QPTPANPPSSQLPITKVPCYVDEYANVKTPHLLNCPSMSTSDAQLFL  981

Query  285  KFGEVISQNS  256
            KFGEVISQNS
Sbjct  982  KFGEVISQNS  991



>ref|XP_010047401.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
 gb|KCW79310.1| hypothetical protein EUGRSUZ_C00732 [Eucalyptus grandis]
Length=988

 Score =   379 bits (974),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 223/248 (90%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ K DWDTRL IALGAAEGLAYLHHDC+PRIIHRDVKSSNILLDK+FEAHLTDFG
Sbjct  734  HGPAKKNKPDWDTRLKIALGAAEGLAYLHHDCSPRIIHRDVKSSNILLDKEFEAHLTDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK+LCT+KS+TST IMGTIGYIDPEYARTSRLTEKSDVYSYG+VLLELLTGRKAVDNES
Sbjct  794  IAKTLCTTKSHTSTSIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A++AVME+VD +++ATC+DLG VKKVFQLALLCTKRQPSERP+MHEVARV
Sbjct  854  NLHHLILSKTASDAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPSERPTMHEVARV  913

Query  456  LGSLMPSSH-PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKF  280
            LGSL+PS+  PKQ++   S APLP  K+  Y DEY NL+TP L+ C +MSTSDAQLF KF
Sbjct  914  LGSLLPSTTPPKQLSALGS-APLPGTKIASYKDEYANLKTPHLVNCSAMSTSDAQLFRKF  972

Query  279  GEVISQNS  256
            GEVISQNS
Sbjct  973  GEVISQNS  980



>ref|XP_006581305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN32167.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=984

 Score =   379 bits (973),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/250 (79%), Positives = 220/250 (88%), Gaps = 3/250 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWD RL IALG+A+GLAYLHHDC+P IIHRDVKSSNILLDKDFE HL DFG
Sbjct  734  HGPTKKKKLDWDLRLKIALGSAQGLAYLHHDCSPLIIHRDVKSSNILLDKDFEPHLADFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  794  IAKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K AN+ VME+VD +I+ TC+D+G VKKVFQLALLCTK+QP +RP+MHEV RV
Sbjct  854  NLHHLILSKTANDGVMETVDPDITTTCRDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRV  913

Query  456  LGSLMPS-SHPKQVNQTPSLAP--LPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            LGSL+PS + PKQ + T  L P    SAK+ CY DEY NL+TP L+ CPSMSTSDAQLFL
Sbjct  914  LGSLVPSITLPKQTDSTQVLLPDSQSSAKMQCYKDEYANLKTPHLVNCPSMSTSDAQLFL  973

Query  285  KFGEVISQNS  256
            KFGEVISQNS
Sbjct  974  KFGEVISQNS  983



>ref|XP_008393446.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=992

 Score =   379 bits (974),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 217/249 (87%), Gaps = 2/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+KKLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHL DFG
Sbjct  743  HGPFKKKKLDWTTRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLNDFG  802

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK+LC SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES
Sbjct  803  IAKTLCHSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  862

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K  +NAVME+VD EI  TC DLG VKKVFQLALLCTKRQP++RP+MHEV RV
Sbjct  863  NLHHLILSKTESNAVMETVDPEILPTCTDLGPVKKVFQLALLCTKRQPTDRPTMHEVTRV  922

Query  456  LGSLMPS-SHPKQ-VNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            L SLMP  + PKQ     P  + LP  K PCY+DEY NL+TP +L CPSMSTSDAQLFLK
Sbjct  923  LASLMPXPAPPKQPTXANPPSSQLPITKXPCYVDEYVNLKTPHMLNCPSMSTSDAQLFLK  982

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  983  FGEVISQNS  991



>ref|XP_010431630.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=245

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 207/246 (84%), Gaps = 5/246 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFGI
Sbjct  4    GPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGI  63

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ESN
Sbjct  64   AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  123

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQPS+RP+MH+V RVL
Sbjct  124  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVL  183

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGE  274
            GS M S  P  V  T   A L  +   CY+DEY NL+TP  + C SMS SDAQLFL+FG+
Sbjct  184  GSFMMSEQPPAVTDTS--AALAGS---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQ  238

Query  273  VISQNS  256
            VISQNS
Sbjct  239  VISQNS  244



>gb|KJB07391.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07392.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07393.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
Length=983

 Score =   376 bits (966),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 196/245 (80%), Positives = 214/245 (87%), Gaps = 0/245 (0%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TKRK L WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EAHLTDFGIA
Sbjct  738  STKRKVLGWDIRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEAHLTDFGIA  797

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRK VDNES+L
Sbjct  798  KSLCISKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESSL  857

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+KAAN+AVME+ D EI+ATC+DLG VKKVFQLALLCTKR P +RP+MHEV RVLG
Sbjct  858  HHLILSKAANDAVMETTDPEITATCKDLGAVKKVFQLALLCTKRHPLDRPTMHEVTRVLG  917

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            SL P   P +   T   APLPS KV  YMDEY NL+TP L+ CPSMSTSDAQLF+ FGEV
Sbjct  918  SLRPLEPPAKQPTTIPPAPLPSTKVTSYMDEYANLKTPHLVNCPSMSTSDAQLFINFGEV  977

Query  270  ISQNS  256
            IS+NS
Sbjct  978  ISRNS  982



>ref|XP_010526027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Tarenaya hassleriana]
Length=982

 Score =   375 bits (963),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 193/247 (78%), Positives = 214/247 (87%), Gaps = 7/247 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+TK+K+LDW+TRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  742  HGSTKKKRLDWETRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  801

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAV+NES
Sbjct  802  IAKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVENES  861

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NNAVME  D EI+ TC+DLG+VKKVFQLALLCTKRQP ERP+MH+V RV
Sbjct  862  NLHHLIMSKTGNNAVMEMADPEITTTCKDLGEVKKVFQLALLCTKRQPGERPTMHQVTRV  921

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGSL P+S P  V  T      P +   CY+DEY NL+ P  L CPSMS SDAQLFL+FG
Sbjct  922  LGSLAPTSVPVAVASTTQ----PGS---CYVDEYANLKAPHSLNCPSMSASDAQLFLRFG  974

Query  276  EVISQNS  256
            EVISQNS
Sbjct  975  EVISQNS  981



>ref|XP_010669304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=992

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 194/247 (79%), Positives = 221/247 (89%), Gaps = 1/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFE HLTDFG
Sbjct  746  HGHAKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEPHLTDFG  805

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+C SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYG+VLLELLTGRKAVD+ES
Sbjct  806  IAKSVCASKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDDES  865

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KA NNAVME+VD EI+ATC+DLG+VKKVFQLALLCTK+QP +RP+MHEV RV
Sbjct  866  NLHHLILSKATNNAVMETVDPEITATCKDLGNVKKVFQLALLCTKKQPGDRPTMHEVTRV  925

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P +  KQV  TP     PS  +P YM+EY NL++P ++ CP+MSTSDAQLFLKFG
Sbjct  926  LTSLIPETPVKQVALTPLPPLPPS-HMPSYMNEYANLKSPHMVNCPTMSTSDAQLFLKFG  984

Query  276  EVISQNS  256
            EVISQNS
Sbjct  985  EVISQNS  991



>ref|XP_010429656.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=381

 Score =   355 bits (910),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 208/247 (84%), Gaps = 5/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  139  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  198

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  199  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  258

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQPS+RP+MH+V RV
Sbjct  259  NLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRV  318

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P  V  T   A L  +   CY+DEY NL+TP  + C SMS SDAQLFL+FG
Sbjct  319  LGSFMMSEQPPAVTDTS--AALAGS---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFG  373

Query  276  EVISQNS  256
            +VISQNS
Sbjct  374  QVISQNS  380



>ref|XP_010273915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Nelumbo nucifera]
Length=965

 Score =   372 bits (954),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/250 (77%), Positives = 220/250 (88%), Gaps = 3/250 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDWDTRL IALGA++GLAYLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  710  HGPSKKKKLDWDTRLRIALGASQGLAYLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  769

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDN+S
Sbjct  770  IAKSLCISKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNDS  829

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH L+++K ANNAVME+VD EISATC+DLG VKKVFQLALLCTK+Q S+RP+MHEV R+
Sbjct  830  NLHQLVMSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCTKKQASDRPTMHEVTRI  889

Query  456  LGSLMPSSHPKQVNQTPSL-APLPSAK--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            LGSL+PS   K ++Q  +L AP+   K  V  YMDEY  L+ P ++ C S+STSDAQLFL
Sbjct  890  LGSLVPSEETKCLHQQFALQAPVSPTKTNVSSYMDEYAKLKNPHMVNCASLSTSDAQLFL  949

Query  285  KFGEVISQNS  256
            KFGEVISQ +
Sbjct  950  KFGEVISQTT  959



>ref|XP_010273914.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Nelumbo nucifera]
Length=988

 Score =   372 bits (955),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/248 (78%), Positives = 219/248 (88%), Gaps = 3/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDWDTRL IALGA++GLAYLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  733  HGPSKKKKLDWDTRLRIALGASQGLAYLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDN+S
Sbjct  793  IAKSLCISKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNDS  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH L+++K ANNAVME+VD EISATC+DLG VKKVFQLALLCTK+Q S+RP+MHEV R+
Sbjct  853  NLHQLVMSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCTKKQASDRPTMHEVTRI  912

Query  456  LGSLMPSSHPKQVNQTPSL-APLPSAK--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            LGSL+PS   K ++Q  +L AP+   K  V  YMDEY  L+ P ++ C S+STSDAQLFL
Sbjct  913  LGSLVPSEETKCLHQQFALQAPVSPTKTNVSSYMDEYAKLKNPHMVNCASLSTSDAQLFL  972

Query  285  KFGEVISQ  262
            KFGEVISQ
Sbjct  973  KFGEVISQ  980



>gb|EPS58979.1| hypothetical protein M569_15834, partial [Genlisea aurea]
Length=249

 Score =   349 bits (895),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 214/249 (86%), Gaps = 4/249 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TK+KKLDW TR+ +A+GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD+E HLTDFGIA
Sbjct  1    STKKKKLDWTTRIRVAMGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYEPHLTDFGIA  60

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC+SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KAVDNE NL
Sbjct  61   KSLCSSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNECNL  120

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLILTKA+NN+VME+VDAEI+ TC DLG+VKKVFQLALLCTKRQPS+RP+M EV RVLG
Sbjct  121  HHLILTKASNNSVMETVDAEITETCGDLGEVKKVFQLALLCTKRQPSDRPNMAEVVRVLG  180

Query  450  SLMP---SSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLK  283
            +L+P   ++     ++    +P        Y++EY  LRTP L+ C  S STSDAQLFLK
Sbjct  181  TLLPQPITASCDGKSRPAEASPPRGGGGGGYVNEYAKLRTPHLVNCSSSRSTSDAQLFLK  240

Query  282  FGEVISQNS  256
            FGEVISQN+
Sbjct  241  FGEVISQNT  249



>ref|XP_010261893.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nelumbo nucifera]
Length=979

 Score =   371 bits (952),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 201/245 (82%), Positives = 220/245 (90%), Gaps = 1/245 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAHLTDFG
Sbjct  733  HGPTKKKKLDWDTRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDN+S
Sbjct  793  IAKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNDS  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++K ANNAVME+VD EI+ATC DLG VKKVFQLALLCTK+QPS+RP+MHEV RV
Sbjct  853  NLHQLIMSKTANNAVMETVDPEITATCTDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRV  912

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LG LMPSS  KQ+ Q    AP P+AKVP YMDEY NL+ P ++ C S+ TSDAQLFLKFG
Sbjct  913  LGCLMPSSETKQLAQP-PSAPPPAAKVPSYMDEYANLKNPHMINCASLGTSDAQLFLKFG  971

Query  276  EVISQ  262
            EVISQ
Sbjct  972  EVISQ  976



>ref|XP_009408412.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Musa acuminata subsp. malaccensis]
Length=980

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 219/249 (88%), Gaps = 5/249 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKL+WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD+EAHLTDFG
Sbjct  734  HGPTKKKKLEWDARLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYEAHLTDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGRK VDNES
Sbjct  794  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGRKPVDNES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KAANNAVME+VD EIS+TC+DLGDVKKVFQLALLCTKRQPS+RP+MHEV+RV
Sbjct  854  NLHQLILSKAANNAVMETVDPEISSTCKDLGDVKKVFQLALLCTKRQPSDRPTMHEVSRV  913

Query  456  LGSLM-PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
            LG L+ PS  PKQ  Q   L   PS  VP Y+DEY NL+ P +L C  S+STSD QLFLK
Sbjct  914  LGCLVQPSPTPKQP-QPHGLTQPPS--VPSYIDEYANLKNPNMLDCATSLSTSDGQLFLK  970

Query  282  FGEVISQNS  256
            FGEVISQNS
Sbjct  971  FGEVISQNS  979



>gb|EYU32328.1| hypothetical protein MIMGU_mgv1a000790mg [Erythranthe guttata]
Length=985

 Score =   368 bits (944),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 191/250 (76%), Positives = 215/250 (86%), Gaps = 2/250 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +GATK+KKLDW+TRL IALGAA+GL YLHHDCNPRIIHRD+KSSNILLDKD+EAHL DFG
Sbjct  736  HGATKKKKLDWETRLRIALGAAQGLEYLHHDCNPRIIHRDIKSSNILLDKDYEAHLADFG  795

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TST++MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTG KAVDN+S
Sbjct  796  IAKSLCVSKTHTSTFLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGLKAVDNDS  855

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL HLILTK ANN+VM++V  EIS TC+DLG+VKKVFQLALLCTKR P +RPSMHEV RV
Sbjct  856  NLLHLILTKTANNSVMDTVAREISETCKDLGEVKKVFQLALLCTKRLPLDRPSMHEVVRV  915

Query  456  LGSLMPS-SHPKQVNQTPSLAP-LPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            L +++ +    K   Q     P LPS K+ CYMDEY NL+TP L+ C SMSTSDAQLFLK
Sbjct  916  LNTMVVNLPEGKSFGQNIQSGPLLPSTKIQCYMDEYANLKTPHLVNCSSMSTSDAQLFLK  975

Query  282  FGEVISQNST  253
            FGEVISQNS 
Sbjct  976  FGEVISQNSV  985



>dbj|BAD94220.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=441

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 207/247 (84%), Gaps = 5/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  199  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  258

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  259  IAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  318

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQP++RP+MH+V RV
Sbjct  319  NLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRV  378

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P     T   A L  +   CY+DEY NL+TP  + C SMS SDAQLFL+FG
Sbjct  379  LGSFMLSEQPPAATDTS--ATLAGS---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFG  433

Query  276  EVISQNS  256
            +VISQNS
Sbjct  434  QVISQNS  440



>ref|XP_007136889.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
 gb|ESW08883.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
Length=958

 Score =   365 bits (938),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 218/253 (86%), Gaps = 10/253 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +KRK+LDWD RL IALG+A+GLAYLHHDC PRIIHRDVKSSNILLDKDFE HLTDFG
Sbjct  711  HGPSKRKRLDWDVRLKIALGSAQGLAYLHHDCCPRIIHRDVKSSNILLDKDFEPHLTDFG  770

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAV+NES
Sbjct  771  IAKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVENES  830

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A++AVME+VD +ISATC+++  VKKVFQLALLCTK+QP +RP+MHEV RV
Sbjct  831  NLHHLILSKTASDAVMETVDPDISATCKEMIAVKKVFQLALLCTKKQPVDRPTMHEVTRV  890

Query  456  LGSLMPSSHPKQVNQTPSLAPL-----PSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQL  292
            LGSL+P   PK+    P++  L     PSAK   Y DEY NL+ P L+ CPS+STSDAQL
Sbjct  891  LGSLVP---PKE--SVPTMQVLIPPSRPSAKTQSYKDEYANLKAPHLVNCPSISTSDAQL  945

Query  291  FLKFGEVISQNST  253
            FLKFGEVISQNS 
Sbjct  946  FLKFGEVISQNSV  958



>ref|XP_006296065.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
 gb|EOA28963.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
Length=976

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 208/247 (84%), Gaps = 5/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  734  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  794  IAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K ANN VME  D +I++TC+DLG VKKVFQLALLCTKRQPS+RP+MH+V RV
Sbjct  854  NLHHLIMSKTANNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P     T   A L  +   CY+DEY NL+TP  + C SMS SDAQLFL+FG
Sbjct  914  LGSFMLSEQPPAATDTS--AALAGS---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFG  968

Query  276  EVISQNS  256
            +VISQNS
Sbjct  969  QVISQNS  975



>ref|XP_010429655.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=982

 Score =   355 bits (910),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 208/247 (84%), Gaps = 5/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  740  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  799

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  800  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  859

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQPS+RP+MH+V RV
Sbjct  860  NLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRV  919

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P  V  T   A L  +   CY+DEY NL+TP  + C SMS SDAQLFL+FG
Sbjct  920  LGSFMMSEQPPAVTDTS--AALAGS---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFG  974

Query  276  EVISQNS  256
            +VISQNS
Sbjct  975  QVISQNS  981



>gb|EYU20292.1| hypothetical protein MIMGU_mgv1a026417mg, partial [Erythranthe 
guttata]
Length=953

 Score =   354 bits (908),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 211/248 (85%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  KRKKLDW+TR+ IALGAA+GLAYLHHDC+PRIIHRD+KSSNILLDK++ AHLTDFG
Sbjct  708  HGKAKRKKLDWETRIGIALGAAQGLAYLHHDCSPRIIHRDMKSSNILLDKEYGAHLTDFG  767

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK LC SK++TST +MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTG+KAVD+E 
Sbjct  768  IAKRLCASKTHTSTCVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGKKAVDDEL  827

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHH+ILTKAANN VM++VD EIS TC DLG+VKKVFQLALLCTKRQ  ERP+MHEV RV
Sbjct  828  NLHHMILTKAANNEVMDTVDPEISETCNDLGEVKKVFQLALLCTKRQLMERPTMHEVVRV  887

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L +L+P    K     PS   + S K  CYMDEY NL+TP L+ C SMSTSDA+LFLKFG
Sbjct  888  LRTLVPRED-KSSTVLPS-DQITSTKAQCYMDEYANLKTPHLVNCSSMSTSDAELFLKFG  945

Query  276  EVISQNST  253
            EVIS+NS 
Sbjct  946  EVISKNSV  953



>ref|XP_010417421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=975

 Score =   354 bits (909),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 208/247 (84%), Gaps = 5/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  733  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  793  IAKSLCLSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQPS+RP+MH+V RV
Sbjct  853  NLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRV  912

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P  V  T   A L  +   CY+DEY NL+TP  + C SMS SDAQLFL+FG
Sbjct  913  LGSFMLSEQPPAVTDTS--AALAGS---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFG  967

Query  276  EVISQNS  256
            +VISQNS
Sbjct  968  QVISQNS  974



>ref|XP_002880777.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57036.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   353 bits (905),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/247 (74%), Positives = 206/247 (83%), Gaps = 5/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  734  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  794  IAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQP++RP+MH+V RV
Sbjct  854  NLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P     T +     +    CY+DEY NL+TP  + C SMS SDAQLFL+FG
Sbjct  914  LGSFMLSEQPPAATDTSA-----TLAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFG  968

Query  276  EVISQNS  256
            +VISQNS
Sbjct  969  QVISQNS  975



>ref|NP_180201.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
 sp|Q42371.1|ERECT_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERECTA; AltName: Full=Protein QUANTITATIVE RESISTANCE TO 
PLECTOSPHAERELLA 1; AltName: Full=Protein QUANTITATIVE RESISTANCE 
TO RALSTONIA SOLANACEARUM 1; AltName: Full=Protein TRANSPIRATION 
EFFICIENCY 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC49302.1| ERECTA [Arabidopsis thaliana]
 dbj|BAA11869.1| receptor protein kinase [Arabidopsis thaliana]
 gb|AAC14518.1| putative receptor-like protein kinase, ERECTA [Arabidopsis thaliana]
 gb|AAK59615.1| putative receptor protein kinase, ERECTA [Arabidopsis thaliana]
 gb|ACN59296.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC07825.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
Length=976

 Score =   353 bits (905),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/247 (74%), Positives = 206/247 (83%), Gaps = 5/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  734  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  794  IAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQP++RP+MH+V RV
Sbjct  854  NLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P     T +     +    CY+DEY NL+TP  + C SMS SDAQLFL+FG
Sbjct  914  LGSFMLSEQPPAATDTSA-----TLAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFG  968

Query  276  EVISQNS  256
            +VISQNS
Sbjct  969  QVISQNS  975



>dbj|BAD16970.1| receptor protein kinase PERK1-like [Oryza sativa Japonica Group]
 dbj|BAG87384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   335 bits (859),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 211/249 (85%), Gaps = 7/249 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K++KLDW+ RL IALGAA+GLAYLHHDCNPRIIHRDVKS NILLDKD+EAHL DFGI
Sbjct  147  GSSKKQKLDWEARLRIALGAAQGLAYLHHDCNPRIIHRDVKSKNILLDKDYEAHLADFGI  206

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLCTSK++TSTY+MGTIGYIDPEYA TSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  207  AKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  266

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+KAA+N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEV RVL
Sbjct  267  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  326

Query  453  GSLMPSSHPKQVNQTPSLAP-LP-SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
              L+    P +    P+L P LP S+ VP Y++EY +LR    L+C  S S SDA+LFLK
Sbjct  327  DCLVYPDPPSK----PALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLK  382

Query  282  FGEVISQNS  256
            FGEVISQN+
Sbjct  383  FGEVISQNT  391



>ref|NP_001048290.1| Os02g0777400 [Oryza sativa Japonica Group]
 dbj|BAF10204.1| Os02g0777400, partial [Oryza sativa Japonica Group]
Length=447

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 211/249 (85%), Gaps = 7/249 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K++KLDW+ RL IALGAA+GLAYLHHDCNPRIIHRDVKS NILLDKD+EAHL DFGI
Sbjct  202  GSSKKQKLDWEARLRIALGAAQGLAYLHHDCNPRIIHRDVKSKNILLDKDYEAHLADFGI  261

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLCTSK++TSTY+MGTIGYIDPEYA TSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  262  AKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  321

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+KAA+N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEV RVL
Sbjct  322  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  381

Query  453  GSLMPSSHPKQVNQTPSLAP-LP-SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
              L+    P +    P+L P LP S+ VP Y++EY +LR    L+C  S S SDA+LFLK
Sbjct  382  DCLVYPDPPSK----PALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLK  437

Query  282  FGEVISQNS  256
            FGEVISQN+
Sbjct  438  FGEVISQNT  446



>gb|EEE65279.1| hypothetical protein OsJ_20503 [Oryza sativa Japonica Group]
Length=882

 Score =   347 bits (889),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 211/248 (85%), Gaps = 5/248 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G TK+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  637  GPTKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  696

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  697  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  756

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K ANNAVME+VD +I+ TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL
Sbjct  757  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  816

Query  453  GSLM-PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKF  280
              L+ P   PK   Q   LA      VP Y++EY +LR   +L+C + S TSDA+LFLKF
Sbjct  817  DCLVRPDPPPKSAQQ---LAMPQRPAVPSYINEYVSLRGTSVLSCANSSCTSDAELFLKF  873

Query  279  GEVISQNS  256
            GEVISQN+
Sbjct  874  GEVISQNT  881



>gb|KJB65469.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=927

 Score =   347 bits (891),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 200/231 (87%), Gaps = 4/231 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TK+KKL WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAH+TDFGIA
Sbjct  694  STKKKKLGWDMRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHITDFGIA  753

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRK VDNESNL
Sbjct  754  KSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESNL  813

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+K ANN+VME+VD EI+ TC+DLG VKKVFQLALLCTKRQPS+RP+MHEV RVLG
Sbjct  814  HHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLG  873

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            SLM    P     T  LA +  +KV CY DEY NL+TP L+ CPSMSTS  
Sbjct  874  SLMLLDTPP----TKQLASIQLSKVTCYKDEYVNLKTPHLVNCPSMSTSQG  920



>gb|KJB65470.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=928

 Score =   347 bits (891),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 200/231 (87%), Gaps = 4/231 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TK+KKL WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAH+TDFGIA
Sbjct  695  STKKKKLGWDMRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHITDFGIA  754

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRK VDNESNL
Sbjct  755  KSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESNL  814

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+K ANN+VME+VD EI+ TC+DLG VKKVFQLALLCTKRQPS+RP+MHEV RVLG
Sbjct  815  HHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLG  874

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            SLM    P     T  LA +  +KV CY DEY NL+TP L+ CPSMSTS  
Sbjct  875  SLMLLDTPP----TKQLASIQLSKVTCYKDEYVNLKTPHLVNCPSMSTSQG  921



>gb|EEC80197.1| hypothetical protein OsI_22078 [Oryza sativa Indica Group]
Length=930

 Score =   347 bits (889),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 211/248 (85%), Gaps = 5/248 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G TK+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  685  GPTKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  744

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  745  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  804

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K ANNAVME+VD +I+ TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL
Sbjct  805  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  864

Query  453  GSLM-PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKF  280
              L+ P   PK   Q   LA      VP Y++EY +LR   +L+C + S TSDA+LFLKF
Sbjct  865  DCLVRPDPPPKSAQQ---LAMPQRPAVPSYINEYVSLRGTSVLSCANSSCTSDAELFLKF  921

Query  279  GEVISQNS  256
            GEVISQN+
Sbjct  922  GEVISQNT  929



>gb|KJB65472.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=972

 Score =   347 bits (890),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 200/231 (87%), Gaps = 4/231 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TK+KKL WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAH+TDFGIA
Sbjct  739  STKKKKLGWDMRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHITDFGIA  798

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRK VDNESNL
Sbjct  799  KSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESNL  858

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+K ANN+VME+VD EI+ TC+DLG VKKVFQLALLCTKRQPS+RP+MHEV RVLG
Sbjct  859  HHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLG  918

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            SLM    P     T  LA +  +KV CY DEY NL+TP L+ CPSMSTS  
Sbjct  919  SLMLLDTPP----TKQLASIQLSKVTCYKDEYVNLKTPHLVNCPSMSTSQG  965



>gb|KJB65471.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=971

 Score =   347 bits (890),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 200/231 (87%), Gaps = 4/231 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TK+KKL WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAH+TDFGIA
Sbjct  738  STKKKKLGWDMRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHITDFGIA  797

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRK VDNESNL
Sbjct  798  KSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESNL  857

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+K ANN+VME+VD EI+ TC+DLG VKKVFQLALLCTKRQPS+RP+MHEV RVLG
Sbjct  858  HHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVLG  917

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            SLM    P     T  LA +  +KV CY DEY NL+TP L+ CPSMSTS  
Sbjct  918  SLMLLDTPP----TKQLASIQLSKVTCYKDEYVNLKTPHLVNCPSMSTSQG  964



>ref|XP_008786642.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X3 [Phoenix dactylifera]
Length=960

 Score =   346 bits (888),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWD+RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD+E+HLTDFG
Sbjct  713  HGPTKKKKLDWDSRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYESHLTDFG  772

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYG+VLLELLTG+KAVDNE 
Sbjct  773  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKAVDNEC  832

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KAA NAVME+VD +I++TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RV
Sbjct  833  NLHQLILSKAATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRV  892

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKF  280
            LG L+    P      P L   P   VP Y+DEY NL++P  LTC  S+STSDAQLFLKF
Sbjct  893  LGCLV-QPGPPPKQSPPPLPLPPPPSVPSYIDEYANLKSPNTLTCTASLSTSDAQLFLKF  951

Query  279  GEVISQNS  256
            GEVISQN+
Sbjct  952  GEVISQNT  959



>ref|NP_001057087.1| Os06g0203800 [Oryza sativa Japonica Group]
 dbj|BAD35990.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 dbj|BAF19001.1| Os06g0203800 [Oryza sativa Japonica Group]
Length=978

 Score =   347 bits (889),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 211/248 (85%), Gaps = 5/248 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G TK+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  733  GPTKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  792

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  852

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K ANNAVME+VD +I+ TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL
Sbjct  853  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  912

Query  453  GSLM-PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKF  280
              L+ P   PK   Q   LA      VP Y++EY +LR   +L+C + S TSDA+LFLKF
Sbjct  913  DCLVRPDPPPKSAQQ---LAMPQRPAVPSYINEYVSLRGTSVLSCANSSCTSDAELFLKF  969

Query  279  GEVISQNS  256
            GEVISQN+
Sbjct  970  GEVISQNT  977



>ref|XP_008786640.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Phoenix dactylifera]
Length=985

 Score =   346 bits (888),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KKLDWD+RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD+E+HLTDFG
Sbjct  738  HGPTKKKKLDWDSRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYESHLTDFG  797

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYG+VLLELLTG+KAVDNE 
Sbjct  798  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKAVDNEC  857

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KAA NAVME+VD +I++TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RV
Sbjct  858  NLHQLILSKAATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRV  917

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKF  280
            LG L+    P      P L   P   VP Y+DEY NL++P  LTC  S+STSDAQLFLKF
Sbjct  918  LGCLV-QPGPPPKQSPPPLPLPPPPSVPSYIDEYANLKSPNTLTCTASLSTSDAQLFLKF  976

Query  279  GEVISQNS  256
            GEVISQN+
Sbjct  977  GEVISQNT  984



>gb|KFK32516.1| hypothetical protein AALP_AA6G252800 [Arabis alpina]
Length=981

 Score =   346 bits (887),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 204/248 (82%), Gaps = 4/248 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LTDFG
Sbjct  738  HGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFG  797

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPEYARTS LTEKSDVYSYGIVLLELLT RKAVD++S
Sbjct  798  IAKSLCVSKSHTSTYVMGTIGYIDPEYARTSHLTEKSDVYSYGIVLLELLTRRKAVDDDS  857

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NNAVME  D +I++TC+DLG VKKVFQLALLCTKRQPS+RP+MH+V RV
Sbjct  858  NLHHLIMSKTGNNAVMEMADPDITSTCKDLGMVKKVFQLALLCTKRQPSDRPTMHQVTRV  917

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M    P       S     S    CY+DEY NL+TP  + C SMS SDA+LFL+FG
Sbjct  918  LGSFMLPEQPTAAAAAASTTLAGS----CYVDEYANLKTPHSVNCSSMSASDAELFLRFG  973

Query  276  EVISQNST  253
            +VISQNS 
Sbjct  974  QVISQNSV  981



>ref|XP_008786639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Phoenix dactylifera]
Length=1007

 Score =   346 bits (888),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = -3

Query  996   YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
             +G TK+KKLDWD+RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD+E+HLTDFG
Sbjct  760   HGPTKKKKLDWDSRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYESHLTDFG  819

Query  816   IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
             IAKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYG+VLLELLTG+KAVDNE 
Sbjct  820   IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKAVDNEC  879

Query  636   NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
             NLH LIL+KAA NAVME+VD +I++TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RV
Sbjct  880   NLHQLILSKAATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRV  939

Query  456   LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKF  280
             LG L+    P      P L   P   VP Y+DEY NL++P  LTC  S+STSDAQLFLKF
Sbjct  940   LGCLV-QPGPPPKQSPPPLPLPPPPSVPSYIDEYANLKSPNTLTCTASLSTSDAQLFLKF  998

Query  279   GEVISQNS  256
             GEVISQN+
Sbjct  999   GEVISQNT  1006



>ref|XP_010917192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Elaeis guineensis]
Length=986

 Score =   345 bits (885),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/247 (76%), Positives = 213/247 (86%), Gaps = 3/247 (1%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G TK+KKLDWD+RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD+EAHLTDFGI
Sbjct  741  GPTKKKKLDWDSRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDYEAHLTDFGI  800

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+KAVDNE N
Sbjct  801  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKAVDNECN  860

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LH LIL+K A NAVME+VD +I++TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL
Sbjct  861  LHQLILSKTATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVL  920

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTC-PSMSTSDAQLFLKFG  277
            G L+  + P + +    L   PS     Y+DEY NL+ P  LTC  S+STSDAQLFLKFG
Sbjct  921  GCLVQPTPPPKHSPPLPLPAPPSVPS--YIDEYANLKNPTTLTCTASLSTSDAQLFLKFG  978

Query  276  EVISQNS  256
            EVISQN+
Sbjct  979  EVISQNT  985



>ref|XP_006408746.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
 gb|ESQ50199.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
Length=977

 Score =   343 bits (880),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 179/248 (72%), Positives = 203/248 (82%), Gaps = 4/248 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDW+TRL IA GAA+GLAYLHHDC+PRIIHRDVK+SNILLDKD EA LTDFG
Sbjct  734  HGPTKKKTLDWNTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKTSNILLDKDLEARLTDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ES
Sbjct  794  IAKSLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLI++K  NNAVME  D +I++TC+DL  VKKVFQLALLCTK+QPS+RP+MH+V RV
Sbjct  854  NLHHLIMSKTGNNAVMEMADPDITSTCKDLAVVKKVFQLALLCTKKQPSDRPTMHQVTRV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGS M S  P       S          CY+DEY NL+ P  + C SMS SDA+LFL+FG
Sbjct  914  LGSFMLSEQPPAAAAATSTT----LTASCYIDEYANLKNPHNVNCSSMSASDAELFLRFG  969

Query  276  EVISQNST  253
            +VISQNS 
Sbjct  970  QVISQNSV  977



>ref|XP_006656743.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=979

 Score =   343 bits (879),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/247 (73%), Positives = 210/247 (85%), Gaps = 3/247 (1%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G TK+KKLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLD D+EAHLTDFGI
Sbjct  734  GPTKKKKLDWATRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDMDYEAHLTDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K ANNAVME+VD +I+ TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL
Sbjct  854  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKFG  277
              L+    P +  Q  ++   P+  VP Y++EY +LR   +L+C + S TSDA+LFLKFG
Sbjct  914  DCLVHPDPPLKSAQQLAMPQAPT--VPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFG  971

Query  276  EVISQNS  256
            EVISQN+
Sbjct  972  EVISQNT  978



>gb|EEC74102.1| hypothetical protein OsI_09151 [Oryza sativa Indica Group]
Length=913

 Score =   341 bits (875),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 213/250 (85%), Gaps = 7/250 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G++K++KLDW+ RL IALGAA+GLAYLHHDCNPRIIHRDVKS NILLDKD+EAHL DFG
Sbjct  667  HGSSKKQKLDWEARLRIALGAAQGLAYLHHDCNPRIIHRDVKSKNILLDKDYEAHLADFG  726

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCTSK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE 
Sbjct  727  IAKSLCTSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNEC  786

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KAA+N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEV RV
Sbjct  787  NLHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRV  846

Query  456  LGSLMPSSHPKQVNQTPSLAP-LP-SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFL  286
            L  L+    P +    P+L P LP S+ VP Y++EY +LR    L+C  S S SDA+LFL
Sbjct  847  LDCLVYPDPPSK----PALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFL  902

Query  285  KFGEVISQNS  256
            KFGEVISQN+
Sbjct  903  KFGEVISQNT  912



>gb|KJB65473.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=978

 Score =   340 bits (873),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 200/237 (84%), Gaps = 10/237 (4%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            +TK+KKL WD RL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLDKDFEAH+TDFGIA
Sbjct  739  STKKKKLGWDMRLRIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHITDFGIA  798

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SKS+TSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRK VDNESNL
Sbjct  799  KSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESNL  858

Query  630  HHL------ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHE  469
            HHL      IL+K ANN+VME+VD EI+ TC+DLG VKKVFQLALLCTKRQPS+RP+MHE
Sbjct  859  HHLYLYAYQILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHE  918

Query  468  VARVLGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            V RVLGSLM    P     T  LA +  +KV CY DEY NL+TP L+ CPSMSTS  
Sbjct  919  VTRVLGSLMLLDTPP----TKQLASIQLSKVTCYKDEYVNLKTPHLVNCPSMSTSQG  971



>ref|XP_010227884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Brachypodium distachyon]
Length=977

 Score =   340 bits (872),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 210/249 (84%), Gaps = 7/249 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLD D+EAHLTDFG
Sbjct  733  HGPSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDNDYEAHLTDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE 
Sbjct  793  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNEC  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTKRQPS+RP+MHEV RV
Sbjct  853  NLHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRV  912

Query  456  LGSLMPSSHP-KQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
            L  L+    P K V  + SL P+PS     Y++EY +LR    L+C  S STSDA+LFLK
Sbjct  913  LDCLVRPDPPLKPVQTSSSLQPVPS-----YVNEYVSLRGAGALSCATSSSTSDAELFLK  967

Query  282  FGEVISQNS  256
            FGE ISQN+
Sbjct  968  FGEAISQNT  976



>ref|XP_003564133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Brachypodium distachyon]
Length=978

 Score =   340 bits (871),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 209/248 (84%), Gaps = 7/248 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLD D+EAHLTDFGI
Sbjct  735  GPSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDNDYEAHLTDFGI  794

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  795  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  854

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL
Sbjct  855  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  914

Query  453  GSLMPSSHP-KQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKF  280
              L+    P K V  + SL P+PS     Y++EY +LR    L+C  S STSDA+LFLKF
Sbjct  915  DCLVRPDPPLKPVQTSSSLQPVPS-----YVNEYVSLRGAGALSCATSSSTSDAELFLKF  969

Query  279  GEVISQNS  256
            GE ISQN+
Sbjct  970  GEAISQNT  977



>ref|XP_006649092.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=999

 Score =   339 bits (870),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 179/246 (73%), Positives = 207/246 (84%), Gaps = 3/246 (1%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K+ KLDW+ RL IALGAA+GLAYLHHDCNPRIIHRDVKS NILLDKD+EAHL DFGI
Sbjct  753  GSSKKPKLDWEARLRIALGAAQGLAYLHHDCNPRIIHRDVKSKNILLDKDYEAHLADFGI  812

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLCTSK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  813  AKSLCTSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  872

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K A+N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEV RVL
Sbjct  873  LHHLILSKTADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  932

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFG  277
              L+    P +  Q P+L    S+ VP Y++EY +LR    L+C  S S SDA+LFLKFG
Sbjct  933  DCLVYPDPPSKPAQPPALP--QSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFG  990

Query  276  EVISQN  259
            EVISQN
Sbjct  991  EVISQN  996



>ref|NP_001132173.1| uncharacterized protein LOC100193598 [Zea mays]
 gb|ACF80913.1| unknown [Zea mays]
Length=492

 Score =   326 bits (836),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 206/253 (81%), Gaps = 10/253 (4%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K+ KLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  240  GSSKKNKLDWVTRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  299

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  300  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  359

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K A+N VME+VD ++  TC+DLG+VKK+FQLALLCTKRQPS+RP+MHEV RVL
Sbjct  360  LHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  419

Query  453  GSLM-------PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDA  298
              L+       P    ++ +    L P PS   P Y+DEY +LR    L+C  S STSDA
Sbjct  420  DCLVNPEPPPQPQQQQQKAHAHHQLPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSDA  477

Query  297  QLFLKFGEVISQN  259
            +LFLKFGE ISQN
Sbjct  478  ELFLKFGEAISQN  490



>gb|EEE57902.1| hypothetical protein OsJ_08587 [Oryza sativa Japonica Group]
Length=913

 Score =   337 bits (865),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 212/250 (85%), Gaps = 7/250 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G++K++KLDW+ RL IALGAA+GLAYLHHDCNPRIIHRDVKS NILLDKD+EAHL DFG
Sbjct  667  HGSSKKQKLDWEARLRIALGAAQGLAYLHHDCNPRIIHRDVKSKNILLDKDYEAHLADFG  726

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLCTSK++TSTY+MGTIGYIDPEYA TSRL EKSDVYSYGIVLLELLTG+K VDNE 
Sbjct  727  IAKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNEC  786

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KAA+N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEV RV
Sbjct  787  NLHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRV  846

Query  456  LGSLMPSSHPKQVNQTPSLAP-LP-SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFL  286
            L  L+    P +    P+L P LP S+ VP Y++EY +LR    L+C  S S SDA+LFL
Sbjct  847  LDCLVYPDPPSK----PALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFL  902

Query  285  KFGEVISQNS  256
            KFGEVISQN+
Sbjct  903  KFGEVISQNT  912



>ref|XP_009117015.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 ref|XP_009117016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 gb|AGL91676.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDY11488.1| BnaA09g40540D [Brassica napus]
Length=987

 Score =   338 bits (868),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 179/253 (71%), Positives = 205/253 (81%), Gaps = 5/253 (2%)
 Frame = -3

Query  996  YGATKRKK---LDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLT  826
            +G  K+KK   LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LT
Sbjct  735  HGPAKKKKNTLLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLT  794

Query  825  DFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  646
            DFGIAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD
Sbjct  795  DFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  854

Query  645  NESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEV  466
            +E NLHHLI++K  +NAVME  D +I++TC+DL  VKKVFQLALLCTKRQP++RP+MH+V
Sbjct  855  DEFNLHHLIMSKTVSNAVMEMADPDITSTCKDLAVVKKVFQLALLCTKRQPNDRPTMHQV  914

Query  465  ARVLGSLMPSSHP--KQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQL  292
             RVLGS M S  P         + A   +    CY+DEY NL+ P  + C SMS SDA+L
Sbjct  915  VRVLGSFMFSEQPPAANAVAAAAAATSATLASSCYVDEYANLKAPHNVNCSSMSASDAEL  974

Query  291  FLKFGEVISQNST  253
            FL+FG+VISQNS 
Sbjct  975  FLRFGQVISQNSV  987



>ref|XP_002438023.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
 gb|EER89390.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
Length=982

 Score =   338 bits (867),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 209/248 (84%), Gaps = 7/248 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  737  GSSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  796

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  797  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  856

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K A+N VM++VD +I  TC+DLG+VKK+FQLALLCTKRQPS+RP+MHEV RVL
Sbjct  857  LHHLILSKTASNEVMDTVDPDIGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  916

Query  453  GSLM-PSSHPK-QVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
              L+ P   PK   +Q P     PS  VP Y++EY +LR    L+C  S STSDA+LFLK
Sbjct  917  DCLVNPDPPPKPSAHQLPQ----PSPAVPSYINEYVSLRGTGALSCANSTSTSDAELFLK  972

Query  282  FGEVISQN  259
            FGE ISQN
Sbjct  973  FGEAISQN  980



>ref|NP_001281212.1| uncharacterized protein LOC103504710 [Zea mays]
 gb|ACN34449.1| unknown [Zea mays]
Length=360

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/254 (68%), Positives = 206/254 (81%), Gaps = 8/254 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
             ++K+KKLDW+ RL IALGAA+GLAYLHH+C+PRIIHRDVKS NILLDKD+EAHL DFGI
Sbjct  106  ASSKKKKLDWEARLKIALGAAQGLAYLHHECSPRIIHRDVKSKNILLDKDYEAHLADFGI  165

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSR+ EKSDVYSYGIVLLELLTG+K VD+E N
Sbjct  166  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECN  225

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+KAA N VME+VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEVARVL
Sbjct  226  LHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  285

Query  453  GSLM-PSSHPKQ---VNQTPSLAPLPSAKVPCYMDEYTNLRTPQL---LTCP-SMSTSDA  298
             SL+ P+  P +          +  PS   P Y+ EY  LR       L+C  S S SDA
Sbjct  286  DSLVCPAGPPPKQAQAQAQAQASEKPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDA  345

Query  297  QLFLKFGEVISQNS  256
            +LF+KFGEVIS+++
Sbjct  346  ELFMKFGEVISRST  359



>gb|AFJ14786.1| ERECTA-like kinase [Oryza sativa Japonica Group]
Length=986

 Score =   337 bits (864),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 211/249 (85%), Gaps = 7/249 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K++KLDW+ RL IALGAA+GLAYLHHDCNPRIIHRDVKS NILLDKD+EAHL DFGI
Sbjct  741  GSSKKQKLDWEARLRIALGAAQGLAYLHHDCNPRIIHRDVKSKNILLDKDYEAHLADFGI  800

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLCTSK++TSTY+MGTIGYIDPEYA TSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  801  AKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  860

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+KAA+N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEV RVL
Sbjct  861  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  920

Query  453  GSLMPSSHPKQVNQTPSLAP-LP-SAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
              L+    P +    P+L P LP S+ VP Y++EY +LR    L+C  S S SDA+LFLK
Sbjct  921  DCLVYPDPPSK----PALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLK  976

Query  282  FGEVISQNS  256
            FGEVISQN+
Sbjct  977  FGEVISQNT  985



>gb|AGL91677.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDX76712.1| BnaC08g32980D [Brassica napus]
Length=987

 Score =   333 bits (855),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 203/253 (80%), Gaps = 5/253 (2%)
 Frame = -3

Query  996  YGATKRKK---LDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLT  826
            +G  K+KK    DWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDKD EA LT
Sbjct  735  HGPAKKKKNTLFDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLT  794

Query  825  DFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  646
            DFGIAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD
Sbjct  795  DFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  854

Query  645  NESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEV  466
            +E NLHHLI++K  +NAVME  D +I++TC+DL  VKKVFQLALLCTKRQP++RP+MH+V
Sbjct  855  DEFNLHHLIMSKTVSNAVMEMADPDITSTCKDLAVVKKVFQLALLCTKRQPNDRPTMHQV  914

Query  465  ARVLGSLMPSSH--PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQL  292
             RVLGS M S            + A   +    CY+DEY NL+ P  + C SMS SDA+L
Sbjct  915  VRVLGSFMFSEQPPAANAVPAAAAATSATLASSCYVDEYANLKAPHNVNCSSMSASDAEL  974

Query  291  FLKFGEVISQNST  253
            FL+FG+VISQNS 
Sbjct  975  FLRFGQVISQNSV  987



>gb|ERN11268.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
Length=995

 Score =   333 bits (855),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 206/252 (82%), Gaps = 5/252 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K KKLDW TR+ IALGAA GLAYLHHDCNPRI+HRDVK+SNILLD + EAHLTDFG
Sbjct  743  HGPSKMKKLDWVTRVKIALGAAHGLAYLHHDCNPRIVHRDVKTSNILLDSEMEAHLTDFG  802

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSL  SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG KAVDNES
Sbjct  803  IAKSLLWSKAHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGMKAVDNES  862

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHH+IL+KAA+N VM++VD EI  TC+DL  VKKVFQLALLCTKRQPS+RP+MHEV RV
Sbjct  863  NLHHVILSKAASNTVMDTVDPEILDTCKDLNAVKKVFQLALLCTKRQPSDRPTMHEVTRV  922

Query  456  LGSLMPSS---HPKQVNQTPSLAPLPSAKVPC--YMDEYTNLRTPQLLTCPSMSTSDAQL  292
            LGSL+P S      Q  Q P   PL      C  YMDEY NL+ P L+ C S++T+D  L
Sbjct  923  LGSLVPQSITDPKPQAPQPPPCVPLIGISSTCRTYMDEYANLKNPNLIACTSLTTTDGHL  982

Query  291  FLKFGEVISQNS  256
            F+KFGEVISQN+
Sbjct  983  FVKFGEVISQNT  994



>ref|XP_006849687.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Amborella trichopoda]
Length=997

 Score =   333 bits (855),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 206/252 (82%), Gaps = 5/252 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K KKLDW TR+ IALGAA GLAYLHHDCNPRI+HRDVK+SNILLD + EAHLTDFG
Sbjct  743  HGPSKMKKLDWVTRVKIALGAAHGLAYLHHDCNPRIVHRDVKTSNILLDSEMEAHLTDFG  802

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSL  SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG KAVDNES
Sbjct  803  IAKSLLWSKAHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGMKAVDNES  862

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHH+IL+KAA+N VM++VD EI  TC+DL  VKKVFQLALLCTKRQPS+RP+MHEV RV
Sbjct  863  NLHHVILSKAASNTVMDTVDPEILDTCKDLNAVKKVFQLALLCTKRQPSDRPTMHEVTRV  922

Query  456  LGSLMPSS---HPKQVNQTPSLAPLPSAKVPC--YMDEYTNLRTPQLLTCPSMSTSDAQL  292
            LGSL+P S      Q  Q P   PL      C  YMDEY NL+ P L+ C S++T+D  L
Sbjct  923  LGSLVPQSITDPKPQAPQPPPCVPLIGISSTCRTYMDEYANLKNPNLIACTSLTTTDGHL  982

Query  291  FLKFGEVISQNS  256
            F+KFGEVISQN+
Sbjct  983  FVKFGEVISQNT  994



>ref|XP_002452905.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
 gb|EES05881.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
Length=893

 Score =   326 bits (836),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 206/247 (83%), Gaps = 5/247 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K+KKLDW+ RL IALGAA GLAYLHH+C+PRIIHRDVKS NILLDKD+EAHL DFGIA
Sbjct  649  SSKKKKLDWEARLKIALGAAHGLAYLHHECSPRIIHRDVKSKNILLDKDYEAHLADFGIA  708

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VD+E NL
Sbjct  709  KSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDDECNL  768

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+KAA N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEVARVL 
Sbjct  769  HHLILSKAAENTVMEMVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLD  828

Query  450  SLM-PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFG  277
            SL+ P   PKQ  Q  +L    S+  P Y+ EY  LR    L+C  S S SDA+LF+KFG
Sbjct  829  SLVCPGPLPKQA-QPQALE--KSSTAPSYVSEYVGLRGGSALSCANSSSASDAELFMKFG  885

Query  276  EVISQNS  256
            EVIS+++
Sbjct  886  EVISRST  892



>ref|XP_008647408.1| PREDICTED: uncharacterized protein LOC100193598 isoform X2 [Zea 
mays]
Length=993

 Score =   327 bits (839),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 207/254 (81%), Gaps = 10/254 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G++K+ KLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFG
Sbjct  740  HGSSKKNKLDWVTRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFG  799

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE 
Sbjct  800  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNEC  859

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A+N VME+VD ++  TC+DLG+VKK+FQLALLCTKRQPS+RP+MHEV RV
Sbjct  860  NLHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRV  919

Query  456  LGSLM-------PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSD  301
            L  L+       P    ++ +    L P PS   P Y+DEY +LR    L+C  S STSD
Sbjct  920  LDCLVNPEPPPQPQQQQQKAHAHHQLPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSD  977

Query  300  AQLFLKFGEVISQN  259
            A+LFLKFGE ISQN
Sbjct  978  AELFLKFGEAISQN  991



>ref|XP_008647407.1| PREDICTED: uncharacterized protein LOC100193598 isoform X1 [Zea 
mays]
 gb|ACN29076.1| unknown [Zea mays]
 gb|AFW76645.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=994

 Score =   327 bits (837),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 206/253 (81%), Gaps = 10/253 (4%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K+ KLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  742  GSSKKNKLDWVTRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  801

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  802  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  861

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+K A+N VME+VD ++  TC+DLG+VKK+FQLALLCTKRQPS+RP+MHEV RVL
Sbjct  862  LHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  921

Query  453  GSLM-------PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDA  298
              L+       P    ++ +    L P PS   P Y+DEY +LR    L+C  S STSDA
Sbjct  922  DCLVNPEPPPQPQQQQQKAHAHHQLPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSDA  979

Query  297  QLFLKFGEVISQN  259
            +LFLKFGE ISQN
Sbjct  980  ELFLKFGEAISQN  992



>ref|XP_004955237.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Setaria italica]
Length=975

 Score =   325 bits (833),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 174/247 (70%), Positives = 205/247 (83%), Gaps = 5/247 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K++KLDW+ RL IALGAA+GLAYLHH+C+PRIIHRDVKS NILLDKD+EAHL DFGIA
Sbjct  731  SSKKEKLDWEARLKIALGAAQGLAYLHHECSPRIIHRDVKSKNILLDKDYEAHLADFGIA  790

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC S ++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VD+E NL
Sbjct  791  KSLCVSLTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDDECNL  850

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+KAA+N VME VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEV RVL 
Sbjct  851  HHLILSKAADNTVMEMVDPDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLD  910

Query  450  SLM-PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFG  277
            SL+ P   PKQ     S     SA  P Y+ EY +LR    L+C  S S SDA+LF+KFG
Sbjct  911  SLVCPDPPPKQAQPQGSEQ---SATAPSYVSEYVSLRGGTALSCANSSSASDAELFMKFG  967

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  968  EVISRNT  974



>gb|AFW73726.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=721

 Score =   320 bits (819),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 174/255 (68%), Positives = 209/255 (82%), Gaps = 8/255 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            + ++K+KKLDW+ RL IALGAA+GLAYLHH+C+PRIIHRDVKS NILLDKD+EAHL DFG
Sbjct  466  HASSKKKKLDWEARLKIALGAAQGLAYLHHECSPRIIHRDVKSKNILLDKDYEAHLADFG  525

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SK++TSTY+MGTIGYIDPEYARTSR+ EKSDVYSYGIVLLELLTG+K VD+E 
Sbjct  526  IAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDEC  585

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KAA N VME+VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEVARV
Sbjct  586  NLHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARV  645

Query  456  LGSLM-PSSHPKQVNQTPSLAPL---PSAKVPCYMDEYTNLRTPQL---LTCP-SMSTSD  301
            L SL+ P+  P +  Q  + A     PS   P Y+ EY  LR       L+C  S S SD
Sbjct  646  LDSLVCPAGPPPKQAQAQAQAQASEKPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASD  705

Query  300  AQLFLKFGEVISQNS  256
            A+LF+KFGEVIS+++
Sbjct  706  AELFMKFGEVISRST  720



>gb|AFW73725.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=722

 Score =   319 bits (818),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 174/254 (69%), Positives = 208/254 (82%), Gaps = 8/254 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
             ++K+KKLDW+ RL IALGAA+GLAYLHH+C+PRIIHRDVKS NILLDKD+EAHL DFGI
Sbjct  468  ASSKKKKLDWEARLKIALGAAQGLAYLHHECSPRIIHRDVKSKNILLDKDYEAHLADFGI  527

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSR+ EKSDVYSYGIVLLELLTG+K VD+E N
Sbjct  528  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECN  587

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+KAA N VME+VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEVARVL
Sbjct  588  LHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  647

Query  453  GSLM-PSSHPKQVNQTPSLAPL---PSAKVPCYMDEYTNLRTPQL---LTCP-SMSTSDA  298
             SL+ P+  P +  Q  + A     PS   P Y+ EY  LR       L+C  S S SDA
Sbjct  648  DSLVCPAGPPPKQAQAQAQAQASEKPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDA  707

Query  297  QLFLKFGEVISQNS  256
            +LF+KFGEVIS+++
Sbjct  708  ELFMKFGEVISRST  721



>gb|AFW76643.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1034

 Score =   326 bits (835),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 206/253 (81%), Gaps = 10/253 (4%)
 Frame = -3

Query  993   GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
             G++K+ KLDW TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  782   GSSKKNKLDWVTRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  841

Query  813   AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
             AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  842   AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  901

Query  633   LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
             LHHLIL+K A+N VME+VD ++  TC+DLG+VKK+FQLALLCTKRQPS+RP+MHEV RVL
Sbjct  902   LHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  961

Query  453   GSLM-------PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDA  298
               L+       P    ++ +    L P PS   P Y+DEY +LR    L+C  S STSDA
Sbjct  962   DCLVNPEPPPQPQQQQQKAHAHHQLPPQPSP--PAYVDEYVSLRGTGALSCANSSSTSDA  1019

Query  297   QLFLKFGEVISQN  259
             +LFLKFGE ISQN
Sbjct  1020  ELFLKFGEAISQN  1032



>dbj|BAJ87863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=863

 Score =   318 bits (816),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 168/247 (68%), Positives = 199/247 (81%), Gaps = 7/247 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
             ++K+ KLDW+ RL IALG A+GLAYLHHDC+PRIIHRDVKS NILLDKD  AHL DFGI
Sbjct  622  ASSKKAKLDWEARLQIALGTAQGLAYLHHDCSPRIIHRDVKSKNILLDKDNVAHLADFGI  681

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKS+C SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  682  AKSVCISKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  741

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHHLIL+KAA+N VME VD +I+ATC+DLG+VK++FQLALLC+KRQPS+RP+MH+V  VL
Sbjct  742  LHHLILSKAADNTVMEMVDPDITATCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVL  801

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFG  277
              L+    P      P  A   S+  P Y++EY +LR    L+C  S S SDA+LFLKFG
Sbjct  802  SCLVCPEAP------PKTASPQSSTAPSYVNEYVSLRGASALSCANSSSASDAELFLKFG  855

Query  276  EVISQNS  256
            E ISQN+
Sbjct  856  EAISQNT  862



>ref|XP_004964941.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Setaria italica]
Length=996

 Score =   320 bits (821),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 176/249 (71%), Positives = 206/249 (83%), Gaps = 4/249 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K+KKLDW++RL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGIA
Sbjct  747  SSKKKKLDWESRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGIA  806

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE NL
Sbjct  807  KSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECNL  866

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+K A+N VME+VD +I  TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL 
Sbjct  867  HHLILSKTASNEVMETVDPDIGDTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLD  926

Query  450  SLMPSSHPKQV---NQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
             L+    P +      +      P + VP Y++EY +LR    L+C  S STSDA+LFLK
Sbjct  927  CLVNPDPPPKPPAHQPSGQSPLPPPSSVPSYINEYVSLRGTGALSCANSTSTSDAELFLK  986

Query  282  FGEVISQNS  256
            FGE ISQN+
Sbjct  987  FGEAISQNT  995



>ref|XP_004964942.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Setaria italica]
Length=990

 Score =   320 bits (820),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 176/249 (71%), Positives = 206/249 (83%), Gaps = 4/249 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K+KKLDW++RL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGIA
Sbjct  741  SSKKKKLDWESRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGIA  800

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE NL
Sbjct  801  KSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECNL  860

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+K A+N VME+VD +I  TC+DLG+VKKVFQLALLCTKRQPS+RP+MHEV RVL 
Sbjct  861  HHLILSKTASNEVMETVDPDIGDTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLD  920

Query  450  SLMPSSHPKQV---NQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
             L+    P +      +      P + VP Y++EY +LR    L+C  S STSDA+LFLK
Sbjct  921  CLVNPDPPPKPPAHQPSGQSPLPPPSSVPSYINEYVSLRGTGALSCANSTSTSDAELFLK  980

Query  282  FGEVISQNS  256
            FGE ISQN+
Sbjct  981  FGEAISQNT  989



>gb|AFW73724.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=999

 Score =   319 bits (818),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 208/253 (82%), Gaps = 8/253 (3%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K+KKLDW+ RL IALGAA+GLAYLHH+C+PRIIHRDVKS NILLDKD+EAHL DFGIA
Sbjct  746  SSKKKKLDWEARLKIALGAAQGLAYLHHECSPRIIHRDVKSKNILLDKDYEAHLADFGIA  805

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KSLC SK++TSTY+MGTIGYIDPEYARTSR+ EKSDVYSYGIVLLELLTG+K VD+E NL
Sbjct  806  KSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECNL  865

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+KAA N VME+VD +I+ TC+DLG+VKKVFQLALLC+KRQPS+RP+MHEVARVL 
Sbjct  866  HHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVLD  925

Query  450  SLM-PSSHPKQVNQTPSLAPL---PSAKVPCYMDEYTNLRTPQL---LTCP-SMSTSDAQ  295
            SL+ P+  P +  Q  + A     PS   P Y+ EY  LR       L+C  S S SDA+
Sbjct  926  SLVCPAGPPPKQAQAQAQAQASEKPSTTAPSYVSEYVGLRGGGGGSALSCTNSSSASDAE  985

Query  294  LFLKFGEVISQNS  256
            LF+KFGEVIS+++
Sbjct  986  LFMKFGEVISRST  998



>dbj|BAJ96098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score =   318 bits (814),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 177/248 (71%), Positives = 204/248 (82%), Gaps = 6/248 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  733  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  792

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  852

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  853  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  912

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKF  280
              L+    P +V Q P   P P+   P Y +EY +LR    L     S STSDA+LFLKF
Sbjct  913  DCLVHPDPPPKVAQ-PHPQP-PNG--PSYANEYVSLRGAGALSSCANSSSTSDAELFLKF  968

Query  279  GEVISQNS  256
            G+ IS N+
Sbjct  969  GQAISHNT  976



>gb|EMS68149.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=847

 Score =   314 bits (805),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 203/246 (83%), Gaps = 3/246 (1%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K+ KLDW+ RL IALG A+GLAYLHHDC+PRIIHRDVKS NILLDKD+ AHL DFGIA
Sbjct  603  SSKKTKLDWEARLQIALGTAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYVAHLADFGIA  662

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KS+C SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYG+VLLELLTG+K VDNE NL
Sbjct  663  KSVCISKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKPVDNECNL  722

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+KAA+N VME VD +I+ATC+DLG+VK++FQLALLC+KRQPS+RP+MH+V  VL 
Sbjct  723  HHLILSKAADNTVMEMVDPDITATCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVLS  782

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGE  274
             L+    P +  Q P+     S+  P Y++EY +LR+   L+C  S S SDA+LFLKFGE
Sbjct  783  CLVCPEAPPKPAQPPASP--QSSTAPSYVNEYVSLRSGSALSCANSSSASDAELFLKFGE  840

Query  273  VISQNS  256
             ISQN+
Sbjct  841  AISQNT  846



>dbj|BAK07025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score =   316 bits (810),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 204/248 (82%), Gaps = 6/248 (2%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  733  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  792

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE +
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECD  852

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  853  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  912

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKF  280
              L+    P +V Q P   P P+   P Y +EY +LR    L     S STSDA+LFLKF
Sbjct  913  DCLVHPDPPPKVAQ-PHPQP-PNG--PSYANEYVSLRGAGALSSCANSSSTSDAELFLKF  968

Query  279  GEVISQNS  256
            G+ IS N+
Sbjct  969  GQAISHNT  976



>emb|CAN79933.1| hypothetical protein VITISV_008329 [Vitis vinifera]
Length=340

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 199/251 (79%), Gaps = 8/251 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++F+AHL+DFG
Sbjct  93   HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFDAHLSDFG  152

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  153  IAKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  212

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+MHEVARV
Sbjct  213  NLHQLILSKADDNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARV  272

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQL--LTCPSMSTS--DAQLF  289
            L SL+P+  P +   +P   P P       MD+    +  QL     P  +TS  DAQ F
Sbjct  273  LVSLLPAP-PAKPCSSP---PKPIDYAHFVMDKGQKQQNAQLPPHVEPDNNTSSNDAQWF  328

Query  288  LKFGEVISQNS  256
            ++F EVIS+NS
Sbjct  329  VRFHEVISKNS  339



>gb|EMT04765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=939

 Score =   313 bits (803),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 165/246 (67%), Positives = 199/246 (81%), Gaps = 3/246 (1%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            ++K+ KLDW+ RL IALG A+GLAYLHHDC+PRIIHRDVKS NILLDKD+ AHL DFGIA
Sbjct  695  SSKKTKLDWEARLQIALGTAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYVAHLADFGIA  754

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KS+C SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE NL
Sbjct  755  KSVCISKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECNL  814

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            HHLIL+KAA+N VME VD +I+ATC+DLG+VK++FQLALLC+KRQPS+RP+MH+V  VL 
Sbjct  815  HHLILSKAADNTVMEMVDPDITATCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVLS  874

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLKFGE  274
             L+              A   S+  P Y++EY +LR+   L+C  S S SDA+LFLKFG+
Sbjct  875  CLV--CPEAPPKPAQPPASPQSSTAPSYVNEYVSLRSGSALSCANSSSASDAELFLKFGK  932

Query  273  VISQNS  256
             ISQN+
Sbjct  933  AISQNT  938



>ref|XP_010109087.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Morus 
notabilis]
 gb|EXC20887.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Morus 
notabilis]
Length=527

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 199/254 (78%), Gaps = 16/254 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GL+YLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  282  HGPSKKVKLDWETRLRIAVGAAQGLSYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  341

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+ T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  342  IAKSIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  401

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA NN VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+MHE+ARV
Sbjct  402  NLHQLILSKADNNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRNPSERPTMHEIARV  461

Query  456  LGSLMPSSHPKQVNQTPSLAPLP-SAKVPCYMDEYTNLRTPQ------LLTCPSMSTSDA  298
            L SL+P+         P++ P P + K   Y     +    Q      L      ++SDA
Sbjct  462  LVSLLPA---------PAIKPCPITPKTIDYAKFVVDKGGQQPKVMQPLARQQENNSSDA  512

Query  297  QLFLKFGEVISQNS  256
            Q F++FGEVIS+N+
Sbjct  513  QWFVRFGEVISKNT  526



>gb|AGL91671.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=939

 Score =   312 bits (799),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 199/249 (80%), Gaps = 9/249 (4%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  696  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  755

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  756  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  815

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  816  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  875

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL---TCPSMSTSDAQLFLK  283
              L+   HP    +            P Y +EY +LR    L      S STSDA+LFLK
Sbjct  876  DCLV---HPDPPPKAAQPQ---PPTGPSYANEYVSLRGAGTLSSSCANSSSTSDAELFLK  929

Query  282  FGEVISQNS  256
            FG+ IS N+
Sbjct  930  FGQAISHNT  938



>gb|AFJ38186.2| receptor-like serine/threonine protein kinase 1 [Triticum aestivum]
 gb|AGL91673.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=975

 Score =   312 bits (800),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 199/248 (80%), Gaps = 8/248 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  733  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  792

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  852

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  853  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  912

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKF  280
              L+   HP    +            P Y +EY +LR    L     S STSDA+LFLKF
Sbjct  913  DCLV---HPDPPPKAAQPQ---PPTGPSYANEYVSLRGAGTLSSCANSSSTSDAELFLKF  966

Query  279  GEVISQNS  256
            G+ IS N+
Sbjct  967  GQAISHNT  974



>gb|EMS63677.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=922

 Score =   311 bits (798),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 199/249 (80%), Gaps = 9/249 (4%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  679  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  738

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  739  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  798

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  799  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  858

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL---TCPSMSTSDAQLFLK  283
              L+   HP    +            P Y +EY +LR    L      S STSDA+LFLK
Sbjct  859  DCLV---HPDPPPKAAQPQ---PPTGPSYANEYVSLRGAGTLSSSCANSSSTSDAELFLK  912

Query  282  FGEVISQNS  256
            FG+ IS N+
Sbjct  913  FGQAISHNT  921



>gb|AFJ38187.2| receptor-like serine/threonine protein kinase 2 [Triticum aestivum]
Length=976

 Score =   312 bits (800),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 199/248 (80%), Gaps = 8/248 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  734  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  854  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKF  280
              L+   HP    +            P Y +EY +LR    L     S STSDA+LFLKF
Sbjct  914  DCLV---HPDPPPKAAQPQ---PPTGPSYANEYVSLRGAGTLSSCANSSSTSDAELFLKF  967

Query  279  GEVISQNS  256
            G+ IS N+
Sbjct  968  GQAISHNT  975



>gb|AFC88469.1| ERECTA [Triticum aestivum]
Length=977

 Score =   312 bits (799),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 199/249 (80%), Gaps = 9/249 (4%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  734  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  854  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL---TCPSMSTSDAQLFLK  283
              L+   HP    +            P Y +EY +LR    L      S STSDA+LFLK
Sbjct  914  DCLV---HPDPPPKAAQPQ---PPTGPSYANEYVSLRGAGTLSSSCANSSSTSDAELFLK  967

Query  282  FGEVISQNS  256
            FG+ IS N+
Sbjct  968  FGQAISHNT  976



>gb|AGL91672.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=976

 Score =   310 bits (794),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 173/248 (70%), Positives = 198/248 (80%), Gaps = 8/248 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD E HLTDFGI
Sbjct  734  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDCEPHLTDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  854  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKF  280
              L+   HP    +            P Y +EY +LR    L     S STSDA+LFLKF
Sbjct  914  DCLV---HPDPPPKAAQPQ---PPTGPSYANEYVSLRGAGTLSSCANSSSTSDAELFLKF  967

Query  279  GEVISQNS  256
            G+ IS N+
Sbjct  968  GQAISHNT  975



>gb|EMT11370.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=1019

 Score =   310 bits (795),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 200/251 (80%), Gaps = 8/251 (3%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+E HLTDFGI
Sbjct  685  GQSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEPHLTDFGI  744

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVYSYGIVLLELLTG+K VDNE N
Sbjct  745  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  804

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LHH IL+K A+NAVME+VD +I+ TCQDLG+VKKVFQLALLCTK+QPS+RP+MHEV RVL
Sbjct  805  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  864

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLKF  280
              L+   HP    +     P      P Y  +Y +LR    L     S STSDA+LFLKF
Sbjct  865  DCLV---HPDPPPKAAQPQPPTG---PSYAHQYASLRGAGTLSSCANSSSTSDAELFLKF  918

Query  279  GEVISQNST*R  247
            G+ IS N+  R
Sbjct  919  GQAISHNTECR  929



>emb|CDP20026.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 198/252 (79%), Gaps = 13/252 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL +A+GAA+GLAYLHH CNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  246  HGPSKKVKLDWETRLKVAVGAAQGLAYLHHGCNPRIIHRDVKSSNILLDENFEAHLSDFG  305

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K++ STY++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+KAVDN S
Sbjct  306  IAKSISAAKTHESTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDNNS  365

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL KA +N +ME+VD E+S TC DLG VKKVFQLALLCT+  PSERP++HEVARV
Sbjct  366  NLHQMILLKADDNTIMEAVDPEVSVTCMDLGHVKKVFQLALLCTRPHPSERPTIHEVARV  425

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCY-----MDEYTNLRTPQLLTCPSMSTSDAQL  292
            L SL+P          P+   L +AK   Y       E + L+T Q       ++SDA+ 
Sbjct  426  LVSLLPPP--------PTKPALGTAKTINYSQFVIAKEQSQLKTMQPQVRGDNNSSDAEW  477

Query  291  FLKFGEVISQNS  256
            F++FGEV+S+N+
Sbjct  478  FVRFGEVVSKNT  489



>ref|XP_010940921.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=988

 Score =   305 bits (780),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 198/254 (78%), Gaps = 21/254 (8%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  748  HGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  807

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  808  IAKCIPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  867

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+G VKK FQLALLCTKR PS+RP+MHEVARV
Sbjct  868  NLHQLILSKADDNTVMEAVDSEVSVTCMDMGLVKKAFQLALLCTKRHPSDRPTMHEVARV  927

Query  456  LGSLM--PSSHPKQVNQTPS-----LAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            L SL+  PS  P  V Q P      LA  P  K+    D+               S+SD 
Sbjct  928  LVSLLPVPSLKPGLVPQKPMDYAHYLAAGPDVKIKRNHDDN--------------SSSDG  973

Query  297  QLFLKFGEVISQNS  256
            Q FL+FGEVIS+N+
Sbjct  974  QWFLRFGEVISKNT  987



>gb|EEE65024.1| hypothetical protein OsJ_19993 [Oryza sativa Japonica Group]
Length=908

 Score =   303 bits (775),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 202/250 (81%), Gaps = 12/250 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KL+WDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  667  HGPSKKVKLNWDTRLRIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  726

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  727  IAKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  786

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+G V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  787  NLHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARV  846

Query  456  LGSLMPSSH---PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SL+P+S    PK V+ +  LA   +A          ++R   +      S+SD Q F+
Sbjct  847  LLSLLPASAMTTPKTVDYSRLLASTTTA---------ADMRGHDVTDIGDNSSSDEQWFV  897

Query  285  KFGEVISQNS  256
            +FGEVIS+++
Sbjct  898  RFGEVISKHT  907



>dbj|BAD44800.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD67663.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 gb|EEC79921.1| hypothetical protein OsI_21484 [Oryza sativa Indica Group]
Length=980

 Score =   302 bits (774),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 202/250 (81%), Gaps = 12/250 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KL+WDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  739  HGPSKKVKLNWDTRLRIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  798

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  799  IAKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  858

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+G V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  859  NLHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARV  918

Query  456  LGSLMPSSH---PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SL+P+S    PK V+ +  LA   +A          ++R   +      S+SD Q F+
Sbjct  919  LLSLLPASAMTTPKTVDYSRLLASTTTA---------ADMRGHDVTDIGDNSSSDEQWFV  969

Query  285  KFGEVISQNS  256
            +FGEVIS+++
Sbjct  970  RFGEVISKHT  979



>ref|NP_001056687.1| Os06g0130100 [Oryza sativa Japonica Group]
 gb|AAQ01160.1| transmembrane protein kinase [Oryza sativa]
 dbj|BAF18601.1| Os06g0130100 [Oryza sativa Japonica Group]
Length=999

 Score =   302 bits (774),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 202/250 (81%), Gaps = 12/250 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KL+WDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  758  HGPSKKVKLNWDTRLRIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  817

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  818  IAKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  877

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+G V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  878  NLHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARV  937

Query  456  LGSLMPSSH---PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SL+P+S    PK V+ +  LA   +A          ++R   +      S+SD Q F+
Sbjct  938  LLSLLPASAMTTPKTVDYSRLLASTTTA---------ADMRGHDVTDIGDNSSSDEQWFV  988

Query  285  KFGEVISQNS  256
            +FGEVIS+++
Sbjct  989  RFGEVISKHT  998



>ref|XP_010277441.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=962

 Score =   300 bits (769),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 196/248 (79%), Gaps = 4/248 (2%)
 Frame = -3

Query  1005  GFAYGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLT  826
             G  +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPR+IHRDVKSSNILLD++F+AHL+
Sbjct  715   GLLHGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRVIHRDVKSSNILLDENFDAHLS  774

Query  825   DFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  646
             DFGIAK + ++K+++ST++MGTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVD
Sbjct  775   DFGIAKCISSAKTHSSTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVD  834

Query  645   NESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEV  466
             NESNLH LIL+KA +N VME VD E+S TC D+G V+K FQLALLCTKR PSERP+MHEV
Sbjct  835   NESNLHQLILSKADDNTVMEVVDPEVSVTCMDMGLVRKTFQLALLCTKRNPSERPTMHEV  894

Query  465   ARVLGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
             ARVL SL+P    K    +P L       V     ++ + +  Q   C    +SDAQ F+
Sbjct  895   ARVLVSLLPPPPSKSCTLSPKLINYAQFVVNKEGKQHHHQQQGQQDNC----SSDAQWFM  950

Query  285   KFGEVISQ  262
             KFGEVIS+
Sbjct  951   KFGEVISK  958



>ref|XP_010277442.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
 ref|XP_010277443.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
Length=947

 Score =   300 bits (768),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 196/248 (79%), Gaps = 4/248 (2%)
 Frame = -3

Query  1005  GFAYGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLT  826
             G  +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPR+IHRDVKSSNILLD++F+AHL+
Sbjct  700   GLLHGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRVIHRDVKSSNILLDENFDAHLS  759

Query  825   DFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  646
             DFGIAK + ++K+++ST++MGTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVD
Sbjct  760   DFGIAKCISSAKTHSSTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVD  819

Query  645   NESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEV  466
             NESNLH LIL+KA +N VME VD E+S TC D+G V+K FQLALLCTKR PSERP+MHEV
Sbjct  820   NESNLHQLILSKADDNTVMEVVDPEVSVTCMDMGLVRKTFQLALLCTKRNPSERPTMHEV  879

Query  465   ARVLGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
             ARVL SL+P    K    +P L       V     ++ + +  Q   C    +SDAQ F+
Sbjct  880   ARVLVSLLPPPPSKSCTLSPKLINYAQFVVNKEGKQHHHQQQGQQDNC----SSDAQWFM  935

Query  285   KFGEVISQ  262
             KFGEVIS+
Sbjct  936   KFGEVISK  943



>gb|ACF87330.1| unknown [Zea mays]
Length=260

 Score =   281 bits (720),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 193/249 (78%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD  FEAHL+DFG
Sbjct  11   HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDGSFEAHLSDFG  70

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGRKAVDNES
Sbjct  71   IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNES  130

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA ++ VMESVD E+S TC D+  V+K FQLALLCTKR P++RP+MHEVARV
Sbjct  131  NLHQLILSKADDDTVMESVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARV  190

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLK  283
            L SL+P +  K      + A   +     ++    +LR   +        S+SD Q F++
Sbjct  191  LLSLLPPA-AKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVR  249

Query  282  FGEVISQNS  256
            FGEVIS+++
Sbjct  250  FGEVISKHT  258



>gb|ACY07616.1| stress-induced protein kinase [Oryza sativa Japonica Group]
Length=980

 Score =   300 bits (769),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 201/250 (80%), Gaps = 12/250 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ K +WDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  739  HGPSKKVKFNWDTRLRIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  798

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  799  IAKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  858

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+G V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  859  NLHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARV  918

Query  456  LGSLMPSSH---PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SL+P+S    PK V+ +  LA   +A          ++R   +      S+SD Q F+
Sbjct  919  LLSLLPASAMTTPKTVDYSRLLASTTTA---------ADMRGHDVTDIGDNSSSDEQWFV  969

Query  285  KFGEVISQNS  256
            +FGEVIS+++
Sbjct  970  RFGEVISKHT  979



>ref|XP_010277439.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=986

 Score =   300 bits (769),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 196/248 (79%), Gaps = 4/248 (2%)
 Frame = -3

Query  1005  GFAYGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLT  826
             G  +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPR+IHRDVKSSNILLD++F+AHL+
Sbjct  739   GLLHGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRVIHRDVKSSNILLDENFDAHLS  798

Query  825   DFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  646
             DFGIAK + ++K+++ST++MGTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVD
Sbjct  799   DFGIAKCISSAKTHSSTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVD  858

Query  645   NESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEV  466
             NESNLH LIL+KA +N VME VD E+S TC D+G V+K FQLALLCTKR PSERP+MHEV
Sbjct  859   NESNLHQLILSKADDNTVMEVVDPEVSVTCMDMGLVRKTFQLALLCTKRNPSERPTMHEV  918

Query  465   ARVLGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
             ARVL SL+P    K    +P L       V     ++ + +  Q   C    +SDAQ F+
Sbjct  919   ARVLVSLLPPPPSKSCTLSPKLINYAQFVVNKEGKQHHHQQQGQQDNC----SSDAQWFM  974

Query  285   KFGEVISQ  262
             KFGEVIS+
Sbjct  975   KFGEVISK  982



>ref|XP_010276048.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=981

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 195/247 (79%), Gaps = 6/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  740  HGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  799

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++K++ ST++MGTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  800  IAKCISSAKTHASTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  859

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC D+G V+K FQLALLCTKR PS+RP+MHEV+RV
Sbjct  860  NLHQLILSKADDNTVMEAVDPEVSVTCMDMGAVRKTFQLALLCTKRHPSDRPTMHEVSRV  919

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P   P    +     +     +  Q     + ++SDAQ F+KFG
Sbjct  920  LVSLLPPLSSKSCTALPK--PFNYTQFVVNKEG----KQNQHQQQDNNNSSDAQWFVKFG  973

Query  276  EVISQNS  256
            EVIS+NS
Sbjct  974  EVISKNS  980



>ref|XP_006656595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Oryza brachyantha]
Length=984

 Score =   299 bits (766),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/250 (64%), Positives = 201/250 (80%), Gaps = 13/250 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KL+WDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD+ FEAHL+DFG
Sbjct  744  HGPSKKVKLNWDTRLRIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDEHFEAHLSDFG  803

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  804  IAKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  863

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+G V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  864  NLHQLILSKADDNTVMEAVDSEVSVTCTDIGLVRKAFQLALLCTKRHPSDRPTMHEVARV  923

Query  456  LGSLMPS---SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFL  286
            L SL+P+   + PK V+ +  LA   +A          ++R   +      S+SD Q F+
Sbjct  924  LLSLLPAPAVTTPKTVDYSRLLASTTAA----------DMRGHDVTDIGDNSSSDEQWFV  973

Query  285  KFGEVISQNS  256
            +FGEVIS+++
Sbjct  974  RFGEVISKHT  983



>ref|XP_010276057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=965

 Score =   299 bits (765),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 195/247 (79%), Gaps = 6/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  724  HGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  783

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++K++ ST++MGTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  784  IAKCISSAKTHASTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  843

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC D+G V+K FQLALLCTKR PS+RP+MHEV+RV
Sbjct  844  NLHQLILSKADDNTVMEAVDPEVSVTCMDMGAVRKTFQLALLCTKRHPSDRPTMHEVSRV  903

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P   P    +     +     +  Q     + ++SDAQ F+KFG
Sbjct  904  LVSLLPPLSSKSCTALPK--PFNYTQFVVNKEG----KQNQHQQQDNNNSSDAQWFVKFG  957

Query  276  EVISQNS  256
            EVIS+NS
Sbjct  958  EVISKNS  964



>ref|XP_008810292.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Phoenix dactylifera]
Length=939

 Score =   298 bits (762),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 195/254 (77%), Gaps = 22/254 (9%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GL YLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  700  HGPSKKVKLDWDTRLKIAVGAAQGLTYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  759

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  760  IAKCIPSAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  819

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+  V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  820  NLHQLILSKADDNTVMEAVDSEVSVTCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARV  879

Query  456  LGSLMPSSH-------PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            L SL+P+         PK V+    LA  P  K+     +               S+SD 
Sbjct  880  LVSLLPAPSLKPGLVPPKAVDYKHYLAAGPDVKIKGSHGD---------------SSSDG  924

Query  297  QLFLKFGEVISQNS  256
            Q F++FGEVIS N+
Sbjct  925  QWFVRFGEVISMNT  938



>emb|CDP05285.1| unnamed protein product [Coffea canephora]
Length=948

 Score =   297 bits (760),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 198/252 (79%), Gaps = 13/252 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL +A+GAA+GLAYLHH CNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  704  HGPSKKVKLDWETRLKVAVGAAQGLAYLHHGCNPRIIHRDVKSSNILLDENFEAHLSDFG  763

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K++ STY++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+KAVDN S
Sbjct  764  IAKSISAAKTHESTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDNNS  823

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL KA +N +ME+VD E+S TC DLG VKKVFQLALLCT+  PSERP++HEVARV
Sbjct  824  NLHQMILLKADDNTIMEAVDPEVSVTCMDLGHVKKVFQLALLCTRPHPSERPTIHEVARV  883

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCY-----MDEYTNLRTPQLLTCPSMSTSDAQL  292
            L SL+P          P+   L +AK   Y       E + L+T Q       ++SDA+ 
Sbjct  884  LVSLLPPP--------PTKPALGTAKTINYSQFVIAKEQSQLKTMQPQVRGDNNSSDAEW  935

Query  291  FLKFGEVISQNS  256
            F++FGEV+S+N+
Sbjct  936  FVRFGEVVSKNT  947



>ref|XP_008810291.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Phoenix dactylifera]
Length=987

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 195/254 (77%), Gaps = 22/254 (9%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GL YLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  748  HGPSKKVKLDWDTRLKIAVGAAQGLTYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  807

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  808  IAKCIPSAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  867

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+  V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  868  NLHQLILSKADDNTVMEAVDSEVSVTCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARV  927

Query  456  LGSLMPSSH-------PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            L SL+P+         PK V+    LA  P  K+     +               S+SD 
Sbjct  928  LVSLLPAPSLKPGLVPPKAVDYKHYLAAGPDVKIKGSHGD---------------SSSDG  972

Query  297  QLFLKFGEVISQNS  256
            Q F++FGEVIS N+
Sbjct  973  QWFVRFGEVISMNT  986



>ref|XP_002269540.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Vitis vinifera]
Length=989

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 200/254 (79%), Gaps = 14/254 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++F+AHL+DFG
Sbjct  742  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFDAHLSDFG  801

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  802  IAKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  861

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+MHEVARV
Sbjct  862  NLHQLILSKADDNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARV  921

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-------SMSTSDA  298
            L SL+P+   K  +  P   P+  A     MD+    +  QL   P       + S++DA
Sbjct  922  LVSLLPAPPAKPCSSPPK--PIDYAHF--VMDKGQKQQNAQL---PPHVEPDNNTSSNDA  974

Query  297  QLFLKFGEVISQNS  256
            Q F++F EVIS+NS
Sbjct  975  QWFVRFHEVISKNS  988



>ref|XP_010035002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
 gb|KCW46259.1| hypothetical protein EUGRSUZ_K00138 [Eucalyptus grandis]
Length=948

 Score =   296 bits (759),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 168/255 (66%), Positives = 196/255 (77%), Gaps = 18/255 (7%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  703  HGPPKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDIKSSNILLDENFEAHLSDFG  762

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T+K++ STY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  763  IAKCLPTAKTHASTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNES  822

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  +IL+KA NN VME+VD E+S TC D+  VKKVFQLALLC KR PSERP+MHEVARV
Sbjct  823  NLLQMILSKADNNTVMEAVDPEVSVTCMDISLVKKVFQLALLCAKRYPSERPTMHEVARV  882

Query  456  LGSLM--PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLT--CPSM----STSD  301
            L SL+  P+S P   N           K   Y     N +  Q L    P +    STSD
Sbjct  883  LISLLPAPASKPSSCN----------VKTIDYARFVINNKGQQQLMSQLPQVRQEDSTSD  932

Query  300  AQLFLKFGEVISQNS  256
            AQ FLKF EVIS+N+
Sbjct  933  AQWFLKFREVISKNT  947



>ref|XP_008810290.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Phoenix dactylifera]
Length=1017

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/254 (63%), Positives = 195/254 (77%), Gaps = 22/254 (9%)
 Frame = -3

Query  996   YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
             +G +K+ KLDWDTRL IA+GAA+GL YLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  778   HGPSKKVKLDWDTRLKIAVGAAQGLTYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  837

Query  816   IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
             IAK + ++K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  838   IAKCIPSAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  897

Query  636   NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
             NLH LIL+KA +N VME+VD+E+S TC D+  V+K FQLALLCTKR PS+RP+MHEVARV
Sbjct  898   NLHQLILSKADDNTVMEAVDSEVSVTCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARV  957

Query  456   LGSLMPSSH-------PKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
             L SL+P+         PK V+    LA  P  K+     +               S+SD 
Sbjct  958   LVSLLPAPSLKPGLVPPKAVDYKHYLAAGPDVKIKGSHGD---------------SSSDG  1002

Query  297   QLFLKFGEVISQNS  256
             Q F++FGEVIS N+
Sbjct  1003  QWFVRFGEVISMNT  1016



>dbj|BAC42683.1| unknown protein [Arabidopsis thaliana]
Length=325

 Score =   279 bits (713),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 190/247 (77%), Gaps = 15/247 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  93   HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  152

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSR+ EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  153  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEA  212

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  213  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  272

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    QV          + K+P        L+    +  P    S  Q F++F 
Sbjct  273  LLSLVPSL---QV----------AKKLPSLDHSTKKLQQENEVRNPDAEAS--QWFVQFR  317

Query  276  EVISQNS  256
            EVIS++S
Sbjct  318  EVISKSS  324



>ref|XP_006598683.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=949

 Score =   295 bits (754),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 192/247 (78%), Gaps = 1/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+ R+ IA+G AEGLAYLHHDCNPRIIHRD+KSSNILLD++FEA L+DFG
Sbjct  703  HGPSKKVKLDWEARMRIAVGTAEGLAYLHHDCNPRIIHRDIKSSNILLDENFEARLSDFG  762

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T++++ ST+++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  763  IAKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  822

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KA NN +ME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARV
Sbjct  823  NLHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARV  882

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+   K +   PS   +  A+      +  NL   Q+        S+ Q F++F 
Sbjct  883  LASLLPAPPSKNI-FVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFE  941

Query  276  EVISQNS  256
            +V+S NS
Sbjct  942  DVVSNNS  948



>ref|XP_007038488.1| ERECTA-like 1 [Theobroma cacao]
 gb|EOY22989.1| ERECTA-like 1 [Theobroma cacao]
Length=991

 Score =   295 bits (755),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 197/247 (80%), Gaps = 1/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL +A+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  745  HGPSKKVKLDWETRLKVAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  804

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  805  IAKCIPTTKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  864

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+MHEVARV
Sbjct  865  NLHQLILSKADDNTVMEAVDPEVSITCMDLSHVRKTFQLALLCTKRHPSERPTMHEVARV  924

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+  P +++  P  +   S  V     +   L   Q       ++SDAQ F++F 
Sbjct  925  LVSLLPAP-PTKLSSAPPKSIDYSQFVIGKGQKRLQLEQQQPQVEQETNSSDAQWFVRFR  983

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  984  EVISKNT  990



>gb|KHN24405.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=949

 Score =   294 bits (752),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 192/247 (78%), Gaps = 1/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+ R+ IA+G AEGLAYLHHDCNPRIIHRD+KSSNILLD++FEA L+DFG
Sbjct  703  HGPSKKVKLDWEARMRIAVGTAEGLAYLHHDCNPRIIHRDIKSSNILLDENFEARLSDFG  762

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T++++ ST+++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  763  IAKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  822

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KA NN +ME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARV
Sbjct  823  NLHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARV  882

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+   K +   PS   +  A+      +  NL   Q+        S+ Q F++F 
Sbjct  883  LASLLPAPPSKNI-FVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFE  941

Query  276  EVISQNS  256
            +V+S NS
Sbjct  942  DVVSNNS  948



>ref|XP_009398741.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Musa acuminata subsp. malaccensis]
Length=996

 Score =   295 bits (754),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 195/254 (77%), Gaps = 21/254 (8%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  756  HGPSKKVKLDWETRLKIAIGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  815

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
             AK L  +K++ STY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDNES
Sbjct  816  TAKCLSPAKTHASTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNES  875

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+G VKK FQLALLCTKR PS+RPSMH+VA V
Sbjct  876  NLHQLILSKADDNTVMEAVDSEVSITCMDMGLVKKAFQLALLCTKRHPSDRPSMHQVALV  935

Query  456  LGSLMPS-------SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            L +L+P+       + PK  + T  LA  P  K     D              S S SD 
Sbjct  936  LVTLLPAPSSKPSTAAPKPTDYTHYLAAGPVVKANAKHD--------------SSSLSDG  981

Query  297  QLFLKFGEVISQNS  256
            Q F++FGEVIS+++
Sbjct  982  QWFVRFGEVISKST  995



>gb|ACF80312.1| unknown [Zea mays]
Length=310

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 167/211 (79%), Gaps = 8/211 (4%)
 Frame = -3

Query  864  NILLDKDFEAHLTDFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGI  685
            NILLDKD+EAHL DFGIAKSLC SK++TSTY+MGTIGYIDPEYARTSR+ EKSDVYSYGI
Sbjct  99   NILLDKDYEAHLADFGIAKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGI  158

Query  684  VLLELLTGRKAVDNESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCT  505
            VLLELLTG+K VD+E NLHHLIL+KAA N VME+VD +I+ TC+DLG+VKKVFQLALLC+
Sbjct  159  VLLELLTGKKPVDDECNLHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCS  218

Query  504  KRQPSERPSMHEVARVLGSLM-PSSHPKQ---VNQTPSLAPLPSAKVPCYMDEYTNLR--  343
            KRQPS+RP+MHEVARVL SL+ P+  P +          +  PS   P Y+ EY  LR  
Sbjct  219  KRQPSDRPTMHEVARVLDSLVCPAGPPPKQAQAQAQAQASEKPSTTAPSYVSEYVGLRGG  278

Query  342  -TPQLLTCP-SMSTSDAQLFLKFGEVISQNS  256
                 L+C  S S SDA+LF+KFGEVIS+++
Sbjct  279  GGGSALSCTNSSSASDAELFMKFGEVISRST  309



>ref|XP_006598682.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
Length=993

 Score =   294 bits (753),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 192/247 (78%), Gaps = 1/247 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+ R+ IA+G AEGLAYLHHDCNPRIIHRD+KSSNILLD++FEA L+DFG
Sbjct  747  HGPSKKVKLDWEARMRIAVGTAEGLAYLHHDCNPRIIHRDIKSSNILLDENFEARLSDFG  806

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T++++ ST+++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  807  IAKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  866

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KA NN +ME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARV
Sbjct  867  NLHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARV  926

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+   K +   PS   +  A+      +  NL   Q+        S+ Q F++F 
Sbjct  927  LASLLPAPPSKNI-FVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFE  985

Query  276  EVISQNS  256
            +V+S NS
Sbjct  986  DVVSNNS  992



>gb|ADM86148.1| leucine-rich repeat receptor-like kinase [Populus nigra x Populus 
x canadensis]
Length=947

 Score =   293 bits (751),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 196/249 (79%), Gaps = 7/249 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G++K+ KLDW+TRL +A+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD+DFEAHL+DFG
Sbjct  703  HGSSKKVKLDWETRLKVAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDEDFEAHLSDFG  762

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+KS+ ST+++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  763  IAKCIPTTKSHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNES  822

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  LIL++A +N VME+VD E+S TC DL  VKK FQLALLCTKR PSERP+M +V+RV
Sbjct  823  NLQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRV  882

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSM--STSDAQLFLK  283
            L S +P+   K      SL P P       +D+    +       PS   ++SDAQ F++
Sbjct  883  LVSFLPALPTKA-----SLLPKPIDYAKFVIDKGQQQQPIVNQQQPSQENNSSDAQWFVR  937

Query  282  FGEVISQNS  256
            F EV+S+N+
Sbjct  938  FKEVVSKNT  946



>ref|NP_001235330.1| ERECTA-like kinase [Glycine max]
 gb|ACM89560.1| ERECTA-like kinase [Glycine max]
Length=1009

 Score =   294 bits (753),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 192/247 (78%), Gaps = 1/247 (0%)
 Frame = -3

Query  996   YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
             +G +K+ KLDW+ R+ IA+G AEGLAYLHHDCNPRIIHRD+KSSNILLD++FEA L+DFG
Sbjct  763   HGPSKKVKLDWEARMRIAVGTAEGLAYLHHDCNPRIIHRDIKSSNILLDENFEARLSDFG  822

Query  816   IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
             IAK L T++++ ST+++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  823   IAKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  882

Query  636   NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
             NLHHLIL+KA NN +ME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARV
Sbjct  883   NLHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARV  942

Query  456   LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
             L SL+P+   K +   PS   +  A+      +  NL   Q+        S+ Q F++F 
Sbjct  943   LASLLPAPPSKNI-FVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFE  1001

Query  276   EVISQNS  256
             +V+S NS
Sbjct  1002  DVVSNNS  1008



>ref|XP_002318267.2| PTH-1 family protein [Populus trichocarpa]
 gb|EEE96487.2| PTH-1 family protein [Populus trichocarpa]
Length=984

 Score =   293 bits (751),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 196/249 (79%), Gaps = 7/249 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G++K+ KLDW+TRL +A+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD+DFEAHL+DFG
Sbjct  740  HGSSKKVKLDWETRLKVAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDEDFEAHLSDFG  799

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+KS+ ST+++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  800  IAKCIPTTKSHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNES  859

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  LIL++A +N VME+VD E+S TC DL  VKK FQLALLCTKR PSERP+M +V+RV
Sbjct  860  NLQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRV  919

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSM--STSDAQLFLK  283
            L S +P+   K      SL P P       +D+    +       PS   ++SDAQ F++
Sbjct  920  LVSFLPALPTKA-----SLLPKPIDYAKFVIDKGQQQQPIVNQQQPSQENNSSDAQWFVR  974

Query  282  FGEVISQNS  256
            F EV+S+N+
Sbjct  975  FKEVVSKNT  983



>ref|XP_011029995.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=984

 Score =   293 bits (751),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 199/251 (79%), Gaps = 9/251 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G++K+ KLDW+TRL +A+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD+DFEAHL+DFG
Sbjct  738  HGSSKKVKLDWETRLKVAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDEDFEAHLSDFG  797

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ ST+++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  798  IAKCIPTTKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNES  857

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  LIL++A +N VME+VD E+S TC DL  VKK FQLALLCTKR PSERP+M +V+RV
Sbjct  858  NLQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRV  917

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLT--CPSM--STSDAQLF  289
            L S +P+   K      SL P P       +D+    + P ++    PS   ++SDAQ F
Sbjct  918  LVSFLPALPTKA-----SLLPKPIDYAKFVIDKGQQQQQPSIVNQQQPSQENNSSDAQWF  972

Query  288  LKFGEVISQNS  256
            ++F EV+S+N+
Sbjct  973  VRFKEVVSKNT  983



>ref|XP_011041677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=982

 Score =   293 bits (749),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 197/250 (79%), Gaps = 11/250 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL +A+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  740  HGPSKKVKLDWETRLKVAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  799

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ ST++MGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  800  IAKCIPTTKTHASTFVMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNES  859

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  LIL++A +N VME+VD E+S TC DL  VKK FQLALLCTKR PSERP+M +V+RV
Sbjct  860  NLQQLILSRADDNTVMEAVDPEVSVTCMDLTTVKKSFQLALLCTKRHPSERPTMQDVSRV  919

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMD---EYTNLRTPQLLTCPSMSTSDAQLFL  286
            L S +P+  P +     SL P P       MD   +   L  PQLL     ++SDA  F+
Sbjct  920  LVSFVPA--PTKA----SLLPKPFDYAKFVMDKGQQQPTLHQPQLLQ--ENNSSDAHWFM  971

Query  285  KFGEVISQNS  256
            +F EV+S+N+
Sbjct  972  RFKEVVSKNT  981



>ref|XP_006587379.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Glycine max]
Length=984

 Score =   292 bits (748),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 157/247 (64%), Positives = 191/247 (77%), Gaps = 11/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+ RL IA+GAAEGLAYLHHDCNPRIIHRD+KSSNILLD++FEA L+DFG
Sbjct  748  HGPLKKVKLDWEARLRIAMGAAEGLAYLHHDCNPRIIHRDIKSSNILLDENFEARLSDFG  807

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T++++ ST+++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  808  IAKCLSTTRTHVSTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  867

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KA NN +ME+VD E+S TC DL  VKK FQLALLCTKR PSERP+MHEVARV
Sbjct  868  NLHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKRNPSERPTMHEVARV  927

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+   K +   PS   +  A+         +L TPQ+           Q F++F 
Sbjct  928  LASLLPAPPSKNI-FVPSSNTIDYAQFVIQKVNKNSLHTPQM----------DQWFVRFE  976

Query  276  EVISQNS  256
            +V+S NS
Sbjct  977  DVVSNNS  983



>ref|XP_002510897.1| erecta, putative [Ricinus communis]
 gb|EEF51499.1| erecta, putative [Ricinus communis]
Length=948

 Score =   291 bits (745),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 191/248 (77%), Gaps = 4/248 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+G A+GLAYLHHDCNPRIIHRDVKSSNILLD +FEAHL+DFG
Sbjct  703  HGPSKKVKLDWETRLKIAVGTAQGLAYLHHDCNPRIIHRDVKSSNILLDDNFEAHLSDFG  762

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  763  IAKCISTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  822

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME VD E+S TC D+  V+K FQLALLCTKR PSERP+M EV RV
Sbjct  823  NLHQLILSKADDNTVMEVVDQEVSVTCMDITHVRKTFQLALLCTKRHPSERPTMPEVVRV  882

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQ-LLTCPSMSTSDAQLFLKF  280
            L S +P+   K+    P   P P       +D+      P+  L     ++SDAQ FL+F
Sbjct  883  LVSFLPAPPTKKPCSAP---PKPIDYAKFVIDKGQQQPAPKNQLAQQENNSSDAQWFLRF  939

Query  279  GEVISQNS  256
             EVIS+N+
Sbjct  940  REVISKNT  947



>ref|XP_003561134.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brachypodium distachyon]
Length=943

 Score =   291 bits (744),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 197/253 (78%), Gaps = 17/253 (7%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD+ FEAHL+DFG
Sbjct  701  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDEHFEAHLSDFG  760

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  761  IAKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  820

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL++A +N VME+VD+E+S TC D+G V+K FQLALLCTKR P +RP+MHEVARV
Sbjct  821  NLHQLILSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPMDRPTMHEVARV  880

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNL--RTPQL----LTCPSMSTSDAQ  295
            L SLMP+         P+L   PS        +YT     TP L        + S+SD Q
Sbjct  881  LLSLMPA---------PALK--PSYTTASKTVDYTRYLATTPDLNHDGTDIGNNSSSDEQ  929

Query  294  LFLKFGEVISQNS  256
             F++FGEVIS+++
Sbjct  930  WFVRFGEVISKHT  942



>ref|NP_001237639.1| ERECTA-like kinase [Glycine max]
 gb|ACM89517.1| ERECTA-like kinase [Glycine max]
Length=828

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 197/249 (79%), Gaps = 18/249 (7%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD++FEAHL+DFG AK +
Sbjct  591  KVKLDWETRLRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDENFEAHLSDFGTAKCI  650

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
             T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNESNLH L
Sbjct  651  STAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQL  710

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA NN VME+VD E+S TC DL  VKK FQLALLCTK+ PSERPSMHEVARVL SL+
Sbjct  711  ILSKADNNTVMEAVDPEVSITCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVLVSLL  770

Query  441  PSSHPKQVNQTPSLAPLPSAKV--PCYMDEYTNLR-----TPQLLTCPSMSTSDAQLFLK  283
            PS  P ++     LAP P+ K     ++ E    R      PQ       ++S+AQ F++
Sbjct  771  PSP-PSKI-----LAP-PAKKFDYAHFVIEKGQQRKMEEQKPQ----QDNNSSNAQWFVR  819

Query  282  FGEVISQNS  256
            FG+VIS+++
Sbjct  820  FGDVISKST  828



>gb|KHN27841.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=940

 Score =   290 bits (743),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 191/247 (77%), Gaps = 11/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+ RL IA+GAAEGLAYLHHDCNPRIIHRD+KSSNILLD++FEA L+DFG
Sbjct  704  HGPLKKVKLDWEARLRIAMGAAEGLAYLHHDCNPRIIHRDIKSSNILLDENFEARLSDFG  763

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T++++ ST+++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  764  IAKCLSTTRTHVSTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  823

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KA NN +ME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARV
Sbjct  824  NLHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARV  883

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+   K +   PS   +  A+         +L TPQ+           Q F++F 
Sbjct  884  LASLLPAPPSKNI-FVPSSNTIDYAQFVIQKVNKNSLHTPQM----------DQWFVRFE  932

Query  276  EVISQNS  256
            +V+S NS
Sbjct  933  DVVSNNS  939



>gb|ACR34621.1| unknown [Zea mays]
Length=460

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 193/249 (78%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD  FEAHL+DFG
Sbjct  211  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDGSFEAHLSDFG  270

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGRKAVDNES
Sbjct  271  IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNES  330

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA ++ VME+VD E+S TC D+  V+K FQLALLCTKR P++RP+MHEVARV
Sbjct  331  NLHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARV  390

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLK  283
            L SL+P +  K      + A   +     ++    +LR   +        S+SD Q F++
Sbjct  391  LLSLLPPA-AKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVR  449

Query  282  FGEVISQNS  256
            FGEVIS+++
Sbjct  450  FGEVISKHT  458



>dbj|BAJ90194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   287 bits (734),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 193/255 (76%), Gaps = 17/255 (7%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD+ FEAHL+DFG
Sbjct  524  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDEHFEAHLSDFG  583

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG KAVDN+S
Sbjct  584  IAKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDS  643

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI+++A +N VME+VD+E+S TC D+G V+K FQLALLCTKR P +RP+MHEVARV
Sbjct  644  NLHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARV  703

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSM--------STSD  301
            L SLMP          P  A  PS+      D    +   + L   +         S+SD
Sbjct  704  LLSLMPP---------PPAAVKPSSYGKTTTDASKKVDYTRYLAAAATPDTDHGDNSSSD  754

Query  300  AQLFLKFGEVISQNS  256
             Q F++FGEVIS+++
Sbjct  755  EQWFVRFGEVISKHT  769



>ref|XP_004964421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Setaria italica]
Length=978

 Score =   290 bits (743),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 199/255 (78%), Gaps = 20/255 (8%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD++FEAHL+DFG
Sbjct  734  HGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDENFEAHLSDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  794  IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL KA +N VME+VD+E+S TC D+  V+K FQLALLCTKR P++RP+MHEVARV
Sbjct  854  NLHQLILAKADDNTVMEAVDSEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYT--------NLRTPQLLTCPSMSTSD  301
            L SL+P+         P++ P P+ K      +YT        +++    +     S+SD
Sbjct  914  LLSLLPA---------PAVKP-PTTKGAA--GDYTRFLATTTADMKHDVSVDIGDNSSSD  961

Query  300  AQLFLKFGEVISQNS  256
             Q F++FGEVIS+++
Sbjct  962  EQWFVRFGEVISKHT  976



>gb|KJB39364.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
 gb|KJB39365.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
Length=993

 Score =   290 bits (743),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 197/249 (79%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDC+PRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  745  HGLSKKVKLDWETRLKIAVGAAQGLAYLHHDCSPRIIHRDVKSSNILLDENFEAHLSDFG  804

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++TSTY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  805  IAKCIPTTKTHTSTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  864

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC +L  V+K FQLALLCTKR PSERP+MHEVAR 
Sbjct  865  NLHQLILSKADDNTVMEAVDPEVSVTCMNLTHVRKTFQLALLCTKRHPSERPTMHEVARA  924

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAK--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            L SL+PS+   ++   P+  P+  A+  +   +      +  +       ++SDAQ F +
Sbjct  925  LVSLLPSAPAPKLCSAPT-KPVDYARFIIDKGLQRSQKEQQQRQQVPQETNSSDAQWFAR  983

Query  282  FGEVISQNS  256
            F EVIS N+
Sbjct  984  FREVISMNT  992



>gb|ACN26436.1| unknown [Zea mays]
Length=500

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 155/249 (62%), Positives = 193/249 (78%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD  FEAHL+DFG
Sbjct  251  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDGSFEAHLSDFG  310

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGRKAVDNES
Sbjct  311  IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNES  370

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA ++ VME+VD E+S TC D+  V+K FQLALLCTKR P++RP+MHEVARV
Sbjct  371  NLHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARV  430

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLK  283
            L SL+P +  K      + A   +     ++    +LR   +        S+SD Q F++
Sbjct  431  LLSLLPPA-AKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVR  489

Query  282  FGEVISQNS  256
            FGEVIS+++
Sbjct  490  FGEVISKHT  498



>gb|KHG06831.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Gossypium 
arboreum]
Length=991

 Score =   290 bits (742),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 158/249 (63%), Positives = 197/249 (79%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDC+PRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  743  HGLSKKVKLDWETRLKIAVGAAQGLAYLHHDCSPRIIHRDVKSSNILLDENFEAHLSDFG  802

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++TSTY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  803  IAKCIPTTKTHTSTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  862

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC +L  V+K FQLALLCTKR PSERP+MHEVAR 
Sbjct  863  NLHQLILSKADDNTVMEAVDPEVSVTCMNLTHVRKTFQLALLCTKRLPSERPTMHEVARA  922

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAK--VPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            L SL+PS+   ++   P+  P+  A+  V   +      +  +       ++SDAQ F +
Sbjct  923  LVSLLPSAPAPKLCSAPT-KPVDYARFIVDEGLQRSQKEQQQRQQVPQETNSSDAQWFAR  981

Query  282  FGEVISQNS  256
            F EVIS N+
Sbjct  982  FREVISMNT  990



>ref|XP_010444058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=968

 Score =   289 bits (739),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 192/247 (78%), Gaps = 15/247 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  736  HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  795

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  796  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  855

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  856  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  915

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL   PS K P +  E  NL               +Q F++F 
Sbjct  916  LLSLLPSLQVAK--KLPSLD--PSTKTPQHESEVRNLE-----------AEASQWFVQFR  960

Query  276  EVISQNS  256
            EVIS +S
Sbjct  961  EVISNSS  967



>ref|XP_004308156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Fragaria vesca subsp. vesca]
Length=989

 Score =   289 bits (739),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 192/249 (77%), Gaps = 6/249 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD+DFEAHL+DFG
Sbjct  744  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDEDFEAHLSDFG  803

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  + ++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVD ES
Sbjct  804  IAKSIPGANTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDRES  863

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA NN VME+VD E+S TC D   +KK FQLALLCTKR P+ERP+MHEVA V
Sbjct  864  NLHQLILSKADNNTVMETVDPEVSVTCMDTTHLKKTFQLALLCTKRNPTERPTMHEVASV  923

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMS--TSDAQLFLK  283
            L SL+P  H K+    P    +  AK     ++      PQ          ++DAQ F++
Sbjct  924  LVSLLPLRHSKK----PLSKGIDYAKFAVDKEQQQPKAQPQQPKPVQQENHSTDAQWFVR  979

Query  282  FGEVISQNS  256
            FGEVIS+N+
Sbjct  980  FGEVISKNT  988



>ref|XP_006588388.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=989

 Score =   288 bits (738),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 197/249 (79%), Gaps = 18/249 (7%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD++FEAHL+DFG AK +
Sbjct  752  KVKLDWETRLRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDENFEAHLSDFGTAKCI  811

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
             T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNESNLH L
Sbjct  812  STAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQL  871

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA NN VME+VD E+S TC DL  VKK FQLALLCTK+ PSERPSMHEVARVL SL+
Sbjct  872  ILSKADNNTVMEAVDPEVSITCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVLVSLL  931

Query  441  PSSHPKQVNQTPSLAPLPSAKV--PCYMDEYTNLR-----TPQLLTCPSMSTSDAQLFLK  283
            PS  P ++     LAP P+ K     ++ E    R      PQ       ++S+AQ F++
Sbjct  932  PSP-PSKI-----LAP-PAKKFDYAHFVIEKGQQRKMEEQKPQ----QDNNSSNAQWFVR  980

Query  282  FGEVISQNS  256
            FG+VIS+++
Sbjct  981  FGDVISKST  989



>ref|XP_006588387.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
 gb|KHN02765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   288 bits (738),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 197/249 (79%), Gaps = 18/249 (7%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD++FEAHL+DFG AK +
Sbjct  756  KVKLDWETRLRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDENFEAHLSDFGTAKCI  815

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
             T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNESNLH L
Sbjct  816  STAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQL  875

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA NN VME+VD E+S TC DL  VKK FQLALLCTK+ PSERPSMHEVARVL SL+
Sbjct  876  ILSKADNNTVMEAVDPEVSITCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVLVSLL  935

Query  441  PSSHPKQVNQTPSLAPLPSAKV--PCYMDEYTNLR-----TPQLLTCPSMSTSDAQLFLK  283
            PS  P ++     LAP P+ K     ++ E    R      PQ       ++S+AQ F++
Sbjct  936  PSP-PSKI-----LAP-PAKKFDYAHFVIEKGQQRKMEEQKPQ----QDNNSSNAQWFVR  984

Query  282  FGEVISQNS  256
            FG+VIS+++
Sbjct  985  FGDVISKST  993



>ref|XP_007143329.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
 gb|ESW15323.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
Length=987

 Score =   288 bits (737),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 192/246 (78%), Gaps = 12/246 (5%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD++FEAHL+DFG AKS+
Sbjct  750  KVKLDWETRLRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDENFEAHLSDFGTAKSI  809

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
             T++++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNESNLH L
Sbjct  810  STARTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQL  869

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL KA NN VME+VDAE+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARVL SL+
Sbjct  870  ILAKADNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLL  929

Query  441  PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSM----STSDAQLFLKFGE  274
            PS         PS    P AK   Y         P+ +         ++++AQ F++FG+
Sbjct  930  PSP--------PSKILAPPAKKFDYAHFVIEKGQPRKVEGQQPHQEDNSTNAQWFVRFGD  981

Query  273  VISQNS  256
            VIS+++
Sbjct  982  VISKST  987



>ref|XP_010483916.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Camelina sativa]
Length=964

 Score =   286 bits (732),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 191/247 (77%), Gaps = 15/247 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  732  HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  791

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  792  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  851

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  852  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  911

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL   PS K P +  E  N                +Q F++F 
Sbjct  912  LLSLLPSLQVAK--KLPSLD--PSTKTPQHESEVRN-----------REAEASQWFVQFR  956

Query  276  EVISQNS  256
            EVIS +S
Sbjct  957  EVISNSS  963



>emb|CBI24498.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   286 bits (731),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 192/249 (77%), Gaps = 23/249 (9%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++F+AHL+DFG
Sbjct  702  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFDAHLSDFG  761

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  762  IAKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  821

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+MHEVAR 
Sbjct  822  NLHQLILSKADDNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARP  881

Query  456  L--GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            +     +     KQ N          A++P +++   N            S++DAQ F++
Sbjct  882  IDYAHFVMDKGQKQQN----------AQLPPHVEPDNN-----------TSSNDAQWFVR  920

Query  282  FGEVISQNS  256
            F EVIS+NS
Sbjct  921  FHEVISKNS  929



>ref|XP_008234344.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Prunus mume]
Length=951

 Score =   286 bits (731),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 190/248 (77%), Gaps = 4/248 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++F AHL+DFG
Sbjct  706  HGPAKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFVAHLSDFG  765

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++TSTY++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+KAVD ES
Sbjct  766  IAKSIPASKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDKES  825

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA  N VME+VD E+S TC DL  V+K FQLALLC KR P ERP+MHEVARV
Sbjct  826  NLHQLILSKADTNTVMETVDPEVSVTCMDLSHVRKTFQLALLCLKRNPIERPTMHEVARV  885

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMS-TSDAQLFLKF  280
            L SL+PS   K  + +  +     AK      +  +    Q       S +SDAQ F +F
Sbjct  886  LVSLLPSPPTKHCSVSKGID---YAKFAVDKGQQQSKLQQQQHPVQQESNSSDAQWFERF  942

Query  279  GEVISQNS  256
            GEVIS N+
Sbjct  943  GEVISNNT  950



>dbj|BAJ89970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=982

 Score =   286 bits (732),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 193/255 (76%), Gaps = 17/255 (7%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD+ FEAHL+DFG
Sbjct  736  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDEHFEAHLSDFG  795

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG KAVDN+S
Sbjct  796  IAKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDS  855

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI+++A +N VME+VD+E+S TC D+G V+K FQLALLCTKR P +RP+MHEVARV
Sbjct  856  NLHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARV  915

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSM--------STSD  301
            L SLMP          P  A  PS+      D    +   + L   +         S+SD
Sbjct  916  LLSLMPP---------PPAAVKPSSYGKTTTDASKKVDYTRYLAAAATPDTDHGDNSSSD  966

Query  300  AQLFLKFGEVISQNS  256
             Q F++FGEVIS+++
Sbjct  967  EQWFVRFGEVISKHT  981



>ref|XP_007152392.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
 gb|ESW24386.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
Length=989

 Score =   286 bits (732),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 193/247 (78%), Gaps = 4/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+ RL IA+GA+EGLAYLHHDCNPRIIHRD+KSSNIL+D++FEA L+DFG
Sbjct  746  HGPLKKVKLDWEARLRIAVGASEGLAYLHHDCNPRIIHRDIKSSNILIDENFEARLSDFG  805

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T++++ ST ++GTIGYIDPEYAR+SRL EKSDVYS+GIVLLELLTG+KAVD++S
Sbjct  806  IAKCLSTTRTHASTSVLGTIGYIDPEYARSSRLNEKSDVYSFGIVLLELLTGKKAVDDDS  865

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+KA NN +ME+VD E+S TC DL  VKK FQLALLCTK  PSERP+MH+VARV
Sbjct  866  NLHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKGNPSERPTMHQVARV  925

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+  P  +   PS   +  A++   + +  NL  PQ+    S   S+ Q F++F 
Sbjct  926  LASLLPAP-PSNIFAPPS-KTIDYAQI--VIQKGNNLHPPQMERLQSQKYSNDQWFVRFE  981

Query  276  EVISQNS  256
             V+S NS
Sbjct  982  NVVSNNS  988



>ref|XP_010483915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Camelina sativa]
Length=965

 Score =   285 bits (730),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 190/246 (77%), Gaps = 15/246 (6%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFGI
Sbjct  734  GSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKS+  SK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+N
Sbjct  794  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RVL
Sbjct  854  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGE  274
             SL+PS    +  + PSL   PS K P +  E  N                +Q F++F E
Sbjct  914  LSLLPSLQVAK--KLPSLD--PSTKTPQHESEVRN-----------REAEASQWFVQFRE  958

Query  273  VISQNS  256
            VIS +S
Sbjct  959  VISNSS  964



>ref|XP_009345019.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=955

 Score =   285 bits (729),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/251 (61%), Positives = 195/251 (78%), Gaps = 16/251 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++F AHL+DFG
Sbjct  716  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFVAHLSDFG  775

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            +AK + T++++ STY++GTIGYIDPEYARTSR+TEKSDVYS+G+VLLELLTG+KAV+ +S
Sbjct  776  VAKFIPTAQTHASTYVLGTIGYIDPEYARTSRVTEKSDVYSFGVVLLELLTGKKAVEQDS  835

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA  N VMESVD E+S TC DL  V+K FQLALLCTKR P+ERP+MHEVARV
Sbjct  836  NLHQLILSKADTNTVMESVDPEVSVTCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARV  895

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMD--EYTNLRTPQLLTCPSMS--TSDAQLF  289
            L SL+P++  K               +P  +D  ++   + PQ          +S+AQ F
Sbjct  896  LVSLLPATATKH------------GSIPKGIDYAKFVADKEPQKPKPQQQESHSSNAQWF  943

Query  288  LKFGEVISQNS  256
            ++FGEVIS+N+
Sbjct  944  VRFGEVISKNT  954



>ref|XP_009346939.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=959

 Score =   285 bits (729),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 196/253 (77%), Gaps = 20/253 (8%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++F AHL+DFG
Sbjct  720  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFVAHLSDFG  779

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            +AK + T++++ STY++GTIGYIDPEYAR+SR+TEKSDVYS+G+VLLELLTG+KAV+ +S
Sbjct  780  VAKFIPTAQTHASTYVLGTIGYIDPEYARSSRVTEKSDVYSFGVVLLELLTGKKAVEQDS  839

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA  N VMESVD E+S TC DL  V+K FQLALLCTKR P+ERP+MHEVARV
Sbjct  840  NLHQLILSKADTNTVMESVDPEVSVTCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARV  899

Query  456  LGSLMPS------SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQ  295
            L SL+P+      S PK ++    +A           D+  +   PQ     S   SDAQ
Sbjct  900  LVSLLPATATKHGSIPKGIDYAKFVA-----------DKEPHKPKPQQQESHS---SDAQ  945

Query  294  LFLKFGEVISQNS  256
             F++FGEVIS+N+
Sbjct  946  WFVRFGEVISKNT  958



>ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=987

 Score =   285 bits (730),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 154/253 (61%), Positives = 196/253 (77%), Gaps = 13/253 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  741  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  800

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            +AK + T++++ STY++GTIGYIDPEYARTSR+TEKSDVYS+G+VLLELLTG+KAV+ +S
Sbjct  801  VAKFIPTAETHASTYVLGTIGYIDPEYARTSRVTEKSDVYSFGVVLLELLTGKKAVEQDS  860

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA  N VMESVD E+S TC DL  V+K FQLALLCTKR P+ERP+MHEVARV
Sbjct  861  NLHQLILSKADTNTVMESVDPEVSVTCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARV  920

Query  456  LGSLMPS------SHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQ  295
            L SL+P+      S PK ++    +A     +      +   ++           +SDAQ
Sbjct  921  LVSLLPAPATKHCSIPKGIDYAKFVADKEQQRPKSQQQQPRPVQQES-------HSSDAQ  973

Query  294  LFLKFGEVISQNS  256
             F++FGEVIS+N+
Sbjct  974  WFVRFGEVISKNT  986



>ref|XP_002436407.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
 gb|EER87774.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
Length=978

 Score =   285 bits (729),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 195/247 (79%), Gaps = 3/247 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  733  HGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  793  IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD+E+S TC D+  V+K FQLALLCTKR P +RP+MHEVARV
Sbjct  853  NLHQLILSKADDNTVMEAVDSEVSVTCTDMNLVRKAFQLALLCTKRHPVDRPTMHEVARV  912

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+    +   + ++A   +     ++    ++           S+SD Q F++FG
Sbjct  913  LLSLLPAPPAAKPPASKAVA---AGDYTRFLAAAADMNHGLPDDIGDNSSSDEQWFVRFG  969

Query  276  EVISQNS  256
            EVIS+++
Sbjct  970  EVISKHT  976



>ref|XP_012090380.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Jatropha curcas]
 gb|KDP22376.1| hypothetical protein JCGZ_26207 [Jatropha curcas]
Length=992

 Score =   285 bits (729),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 191/248 (77%), Gaps = 5/248 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  748  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  807

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T+K++  TY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  808  IAKCLPTTKTHALTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  867

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA NN VME VD E+S TC DL  V+K FQLALLCTK  PSERP+MHEV RV
Sbjct  868  NLHQLILSKADNNTVMEVVDQEVSVTCVDLTHVRKTFQLALLCTKPYPSERPTMHEVVRV  927

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTP-QLLTCPSMSTSDAQLFLKF  280
            L S +P+   K  +  P    +  AK    +D+      P Q       ++SDAQ F+ F
Sbjct  928  LVSFLPAPAMKPCSAPPK--RIDYAKF--VIDKGQQQPAPKQEQAQQENNSSDAQWFVGF  983

Query  279  GEVISQNS  256
             EVIS+N+
Sbjct  984  REVISKNT  991



>gb|KDO65362.1| hypothetical protein CISIN_1g002278mg [Citrus sinensis]
Length=943

 Score =   284 bits (727),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 193/247 (78%), Gaps = 8/247 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNIL+D++F+AHL+DFG
Sbjct  704  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILIDENFDAHLSDFG  763

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IA+ + T+  + ST+++GTIGYIDPEYA TSRL EKSDVYS+GIVLLE+LTG+KAVDNES
Sbjct  764  IARCIPTAMPHASTFVLGTIGYIDPEYAHTSRLNEKSDVYSFGIVLLEILTGKKAVDNES  823

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++KA +N VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+M EVARV
Sbjct  824  NLHQLIMSKADDNTVMEAVDPEVSVTCVDLSAVRKTFQLALLCTKRYPSERPTMQEVARV  883

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+         P+   L + K   Y  ++   R  Q       ++SDA+ F++FG
Sbjct  884  LVSLLPAP--------PAKLSLAAPKPIDYYTKFVVNRERQQRVEHDDNSSDARWFVRFG  935

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  936  EVISKNT  942



>ref|XP_006490262.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=965

 Score =   285 bits (728),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 193/247 (78%), Gaps = 8/247 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNIL+D++F+AHL+DFG
Sbjct  726  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILIDENFDAHLSDFG  785

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IA+ + T+  + ST+++GTIGYIDPEYA TSRL EKSDVYS+GIVLLE+LTG+KAVDNES
Sbjct  786  IARCIPTAMPHASTFVLGTIGYIDPEYAHTSRLNEKSDVYSFGIVLLEILTGKKAVDNES  845

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++KA +N VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+M EVARV
Sbjct  846  NLHQLIMSKADDNTVMEAVDPEVSVTCVDLSAVRKTFQLALLCTKRYPSERPTMQEVARV  905

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+         P+   L + K   Y  ++   R  Q       ++SDA+ F++FG
Sbjct  906  LVSLLPAP--------PAKLSLAAPKPIDYYTKFVVNRERQQRVEHDDNSSDARWFVRFG  957

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  958  EVISKNT  964



>gb|AAL68842.1|AF466199_1 putative receptor protein kinase [Sorghum bicolor]
Length=921

 Score =   284 bits (726),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 191/248 (77%), Gaps = 13/248 (5%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G++K+KKLDW+TRL IALGAA+GLAYLHHDC+PRIIHRDVKS NILLDKD+EAHLTDFGI
Sbjct  682  GSSKKKKLDWETRLRIALGAAQGLAYLHHDCSPRIIHRDVKSKNILLDKDYEAHLTDFGI  741

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKSLC SK++TSTY+MGTIGYIDPEYARTSRL EKSDVY     L     G  A D +  
Sbjct  742  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYR----LWHCSAG--AADWQEA  795

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
                IL+K A+N VM++VD +I  TC+DLG+VKK+FQLALLCTKRQPS+RP+MHEV RVL
Sbjct  796  SGQRILSKTASNEVMDTVDPDIGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  855

Query  453  GSLM-PSSHPK-QVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCP-SMSTSDAQLFLK  283
              L+ P   PK   +Q P     PS  VP Y++EY +LR    L+C  S STSDA+LFLK
Sbjct  856  DCLVNPDPPPKPSAHQLPQ----PSPAVPSYINEYVSLRGTGALSCANSTSTSDAELFLK  911

Query  282  FGEVISQN  259
            FGE ISQN
Sbjct  912  FGEAISQN  919



>ref|XP_012090381.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Jatropha curcas]
Length=992

 Score =   285 bits (728),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 191/248 (77%), Gaps = 5/248 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  748  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  807

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T+K++  TY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  808  IAKCLPTTKTHALTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  867

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA NN VME VD E+S TC DL  V+K FQLALLCTK  PSERP+MHEV RV
Sbjct  868  NLHQLILSKADNNTVMEVVDQEVSVTCVDLTHVRKTFQLALLCTKPYPSERPTMHEVVRV  927

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTP-QLLTCPSMSTSDAQLFLKF  280
            L S +P+   K  +  P    +  AK    +D+      P Q       ++SDAQ F+ F
Sbjct  928  LVSFLPAPAMKPCSAPPK--RIDYAKF--VIDKGQQQPAPKQEQAQQENNSSDAQWFVGF  983

Query  279  GEVISQNS  256
             EVIS+N+
Sbjct  984  REVISKNT  991



>ref|XP_006394418.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
 gb|ESQ31704.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
Length=821

 Score =   282 bits (721),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 194/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  578  HGPLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  637

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+ TSK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  638  IAKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  697

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH ++L+KA +N +ME+VD E++ TC DLG ++K F+LALLCTKR P ERP+M EV+RV
Sbjct  698  NLHQMVLSKADDNTIMETVDPEVTVTCMDLGHLRKTFKLALLCTKRNPLERPTMLEVSRV  757

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL   PS K   Y D+    +  +     +     +Q F++F 
Sbjct  758  LLSLLPSLQAGK--KLPSLD--PSKKPTEYEDKDQQKQKQEKGEVRNHEEEGSQWFVQFR  813

Query  276  EVISQNS  256
            EVIS+NS
Sbjct  814  EVISKNS  820



>ref|NP_001146239.1| uncharacterized LOC100279811 [Zea mays]
 gb|ACL53538.1| unknown [Zea mays]
Length=774

 Score =   279 bits (714),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 191/249 (77%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD  FEAHL+DFG
Sbjct  525  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDGSFEAHLSDFG  584

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGRKAVDNES
Sbjct  585  IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNES  644

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA ++ VME+VD E+S TC D+  V+K FQLALLCTKR P++RP+MHEVARV
Sbjct  645  NLHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARV  704

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLK  283
            L SL+     K      + A   +     ++    +LR   +        S+SD Q F++
Sbjct  705  LLSLL-PPAAKPPAPKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVR  763

Query  282  FGEVISQNS  256
            FGEVIS+++
Sbjct  764  FGEVISKHT  772



>ref|XP_006421768.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
 gb|ESR35008.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
Length=943

 Score =   282 bits (721),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 192/247 (78%), Gaps = 8/247 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNIL+D++F+AHL+DFG
Sbjct  704  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILIDENFDAHLSDFG  763

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IA+ + T+  +  T+++GTIGYIDPEYA TSRL EKSDVYS+GIVLLE+LTG+KAVDNES
Sbjct  764  IARCIPTAMPHALTFVLGTIGYIDPEYAHTSRLNEKSDVYSFGIVLLEILTGKKAVDNES  823

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++KA +N VME+VD E+S TC DL  V+K FQLALLCTKR PSERP+M EVARV
Sbjct  824  NLHQLIMSKADDNTVMEAVDPEVSVTCMDLSVVRKTFQLALLCTKRYPSERPTMQEVARV  883

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+         P+   L + K   Y  ++   R  Q       ++SDA+ F++FG
Sbjct  884  LVSLLPAP--------PTKLSLAAPKPIDYYTKFVVDRERQQRVEHDDNSSDARWFVRFG  935

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  936  EVISKNT  942



>gb|KEH43759.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=993

 Score =   283 bits (723),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/245 (64%), Positives = 193/245 (79%), Gaps = 9/245 (4%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TR+ IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD++FEAHL+DFG AKS+
Sbjct  754  KVKLDWETRMRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDENFEAHLSDFGTAKSI  813

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
              +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+SNLH L
Sbjct  814  PATKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSNLHQL  873

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA +N VME+VD E+S TC DL  VKK FQLALLCT+R PSERPSMHEVARVL SL+
Sbjct  874  ILSKADSNTVMEAVDPEVSVTCIDLAHVKKTFQLALLCTRRNPSERPSMHEVARVLISLL  933

Query  441  PSSHPKQV---NQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            P    K V    ++   AP  + K   +  +   L+  Q       + S+AQ F++FG+V
Sbjct  934  PPPPSKVVAAAAKSFDYAPFVAEK-GQHHRKLDGLQPQQ-----DNNLSNAQWFVRFGDV  987

Query  270  ISQNS  256
            IS++S
Sbjct  988  ISKSS  992



>ref|XP_004149628.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis sativus]
 gb|KGN49592.1| hypothetical protein Csa_5G014290 [Cucumis sativus]
Length=994

 Score =   281 bits (720),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 191/246 (78%), Gaps = 2/246 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+ RL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  744  HGTGKKVKLDWEARLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  803

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVD+ES
Sbjct  804  IAKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDDES  863

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+K  +N VME+VD E+S TC DL  V+K FQLALLCTK  PSERP+MHEV+RV
Sbjct  864  NLHQLILSKINSNTVMEAVDPEVSVTCIDLAHVRKTFQLALLCTKHNPSERPTMHEVSRV  923

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPS-MSTSDAQLFLKF  280
            L SL P     +    P+   L  A+      +  N +  Q     S ++TSDA+ F++F
Sbjct  924  LISLQPPRPTVKQTSFPT-KTLDYAQYVIEKGQNRNAKGGQEEQQKSDVNTSDARWFVQF  982

Query  279  GEVISQ  262
            GEV+S+
Sbjct  983  GEVMSE  988



>ref|XP_009151345.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Brassica rapa]
Length=966

 Score =   281 bits (718),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 191/248 (77%), Gaps = 13/248 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++F AHL+DFG
Sbjct  732  HGTSKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFVAHLSDFG  791

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+ TSK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNES
Sbjct  792  IAKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNES  851

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL KA +N VME+VD E++ TC DLG ++K F+LALLCTKR P ERP+M EV+RV
Sbjct  852  NLHQLILAKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRV  911

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PS  P PS K   Y      +R  Q       S   +Q F +F 
Sbjct  912  LLSLLPSMQVAK--KLPS--PDPSKKPTNY-----GVREQQ----QERSEEGSQWFEQFH  958

Query  276  EVISQNST  253
            EVIS++S 
Sbjct  959  EVISKSSV  966



>ref|XP_007221096.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
 gb|EMJ22295.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
Length=992

 Score =   281 bits (718),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 187/247 (76%), Gaps = 8/247 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++F AHL+DFG
Sbjct  753  HGPAKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFVAHLSDFG  812

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K++ STY++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+KAVD ES
Sbjct  813  IAKSIPAAKTHASTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDKES  872

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA  N VME++D E+S TC DL  V+K FQLALLC KR P ERP MHEVARV
Sbjct  873  NLHQLILSKADTNTVMETLDPEVSVTCMDLSHVRKTFQLALLCLKRNPIERPFMHEVARV  932

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P+   K  ++          + P    +    +          ++SDAQ F +FG
Sbjct  933  LVSLLPAPPTKHFDK--------GQQQPKLQQQQQPQQQQHHPVQQESNSSDAQWFERFG  984

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  985  EVISKNT  991



>ref|XP_006279954.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
 gb|EOA12852.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
Length=970

 Score =   280 bits (717),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 188/245 (77%), Gaps = 13/245 (5%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            + K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFGIA
Sbjct  738  SLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFGIA  797

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KS+  SK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+NL
Sbjct  798  KSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEANL  857

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
            H LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RVL 
Sbjct  858  HQLILSKADDNTVMEAVDPEVTVTCVDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVLL  917

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            SL+PS    +  Q PSL    S K P    E  N                ++ F++F EV
Sbjct  918  SLLPSLQVAKKLQEPSLD--KSTKKPQQESEVRN-----------REAEASEWFVQFREV  964

Query  270  ISQNS  256
            IS++S
Sbjct  965  ISKSS  969



>emb|CDY00268.1| BnaA06g21690D [Brassica napus]
Length=967

 Score =   280 bits (716),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++F AHL+DFGI
Sbjct  734  GTSKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFVAHLSDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKS+ TSK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNESN
Sbjct  794  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LH LIL KA +N VME+VD E++ TC DLG ++K F+LALLCTKR P ERP+M EV+RVL
Sbjct  854  LHQLILAKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGE  274
             SL+PS    +  + PS  P PS K   Y      +R  Q       S   +Q F +F E
Sbjct  914  LSLLPSMQVAK--KLPS--PDPSKKPTNY-----GVREQQ----QERSEEGSQWFEQFHE  960

Query  273  VISQNST  253
            VIS++S 
Sbjct  961  VISKSSV  967



>ref|XP_009151343.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Brassica rapa]
Length=967

 Score =   280 bits (716),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 190/247 (77%), Gaps = 13/247 (5%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++F AHL+DFGI
Sbjct  734  GTSKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFVAHLSDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKS+ TSK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNESN
Sbjct  794  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LH LIL KA +N VME+VD E++ TC DLG ++K F+LALLCTKR P ERP+M EV+RVL
Sbjct  854  LHQLILAKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGE  274
             SL+PS    +  + PS  P PS K   Y      +R  Q       S   +Q F +F E
Sbjct  914  LSLLPSMQVAK--KLPS--PDPSKKPTNY-----GVREQQ----QERSEEGSQWFEQFHE  960

Query  273  VISQNST  253
            VIS++S 
Sbjct  961  VISKSSV  967



>ref|XP_008465055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis melo]
Length=1000

 Score =   280 bits (716),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 192/246 (78%), Gaps = 2/246 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+ RL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  750  HGTGKKVKLDWEARLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  809

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ ST+++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVD+ES
Sbjct  810  IAKCIPTAKTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDDES  869

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+K  NN VME+VD E+S TC DL  V+K FQLALLCTK   SERP+MHEV+RV
Sbjct  870  NLHQLILSKIDNNTVMEAVDPEVSVTCIDLAHVRKTFQLALLCTKHNSSERPTMHEVSRV  929

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPS-MSTSDAQLFLKF  280
            L SL P+    + +  P+   L  A+      ++  L+  Q     S ++TSDA+ F++F
Sbjct  930  LISLQPAQPTVKRSSFPT-KTLDYAQYVIEKGQHRKLKGGQEEQQKSDVNTSDARWFVQF  988

Query  279  GEVISQ  262
            GEV S+
Sbjct  989  GEVTSE  994



>gb|AGT17158.1| ERECTA-like 2 [Saccharum hybrid cultivar R570]
Length=986

 Score =   280 bits (716),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 193/255 (76%), Gaps = 19/255 (7%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  741  HGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  800

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  801  IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNES  860

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH  IL+KA +N VME+VD+E+S TC D+  V+K FQLALLCTKR P +RP+MHEVARV
Sbjct  861  NLHQSILSKADDNTVMEAVDSEVSVTCTDMNLVRKAFQLALLCTKRHPVDRPTMHEVARV  920

Query  456  LGSLMPSSHPKQV--------NQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSD  301
            L SL+P+    +         + T  LA     K     D+  +            S+SD
Sbjct  921  LLSLLPAPPAAKPPATKAAAGDYTRFLATAADMKHGGLSDDIGD-----------NSSSD  969

Query  300  AQLFLKFGEVISQNS  256
             Q F++FGEVIS+++
Sbjct  970  EQWFVRFGEVISKHT  984



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score =   279 bits (713),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 192/247 (78%), Gaps = 15/247 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  686  HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  745

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSR+ EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  746  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEA  805

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  806  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  865

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL    S K    + +   +R P            +Q F++F 
Sbjct  866  LLSLVPSLQVAK--KLPSLD--HSTK---KLQQENEVRNPD--------AEASQWFVQFR  910

Query  276  EVISQNS  256
            EVIS++S
Sbjct  911  EVISKSS  917



>ref|XP_002975149.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
 gb|EFJ23934.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
Length=944

 Score =   279 bits (714),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 192/248 (77%), Gaps = 11/248 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  ++ KLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLD++F+AH++DFG
Sbjct  706  HGPVRKVKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDENFDAHISDFG  765

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+C +K++TST+++GTIGYIDPEYARTSRL EKSDVYSYGIVLLEL+TG KAVD+E 
Sbjct  766  IAKSICPTKTHTSTFVLGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELITGLKAVDDER  825

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH  +L+   NN VME +DAEI  TCQD+G V+K+ +LALLC ++Q ++RP+MH+VA V
Sbjct  826  NLHQWVLSHVNNNTVMEVIDAEIKDTCQDIGTVQKMIRLALLCAQKQAAQRPAMHDVANV  885

Query  456  LGSL--MPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            L SL  +P+   K V+  P+           Y+D+Y   +    L+  S + S   LF+K
Sbjct  886  LFSLSPVPALSKKSVSSNPNQRR--------YIDDYAESKHADNLSASS-TNSGGHLFMK  936

Query  282  FGEVISQN  259
            FGEVISQ+
Sbjct  937  FGEVISQD  944



>ref|XP_002977553.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
 gb|EFJ21557.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
Length=944

 Score =   279 bits (713),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 192/248 (77%), Gaps = 11/248 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  ++ KLDWDTRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLD++F+AH++DFG
Sbjct  706  HGPVRKVKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDENFDAHISDFG  765

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+C +K++TST+++GTIGYIDPEYARTSRL EKSDVYSYGIVLLEL+TG KAVD+E 
Sbjct  766  IAKSICPTKTHTSTFVLGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELITGLKAVDDER  825

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH  +L+   NN VME +DAEI  TCQD+G V+K+ +LALLC ++Q ++RP+MH+VA V
Sbjct  826  NLHQWVLSHVNNNTVMEVIDAEIKDTCQDIGTVQKMIRLALLCAQKQAAQRPAMHDVANV  885

Query  456  LGSL--MPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLK  283
            L SL  +P+   K V+  P+           Y+D+Y   +    L+  S + S   LF+K
Sbjct  886  LFSLSPVPALSKKSVSSNPNQRR--------YIDDYAESKHADNLSASS-TNSGGHLFMK  936

Query  282  FGEVISQN  259
            FGEVISQ+
Sbjct  937  FGEVISQD  944



>emb|CDX86913.1| BnaC03g51830D [Brassica napus]
Length=970

 Score =   279 bits (714),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 191/247 (77%), Gaps = 10/247 (4%)
 Frame = -3

Query  993  GATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGI  814
            G +K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++F AHL+DFGI
Sbjct  734  GTSKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFVAHLSDFGI  793

Query  813  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            AKS+ TSK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNESN
Sbjct  794  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  853

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVL  454
            LH LIL+KA +N VME+VD E++ TC DLG ++K F+LALLCTKR P ERP+M EV+RVL
Sbjct  854  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVL  913

Query  453  GSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGE  274
             SL+PS    +  + PS  P PS K   Y      +R  Q       S   +Q F +F E
Sbjct  914  LSLLPSMQVAK--KLPS--PDPSKKPTVY-----GVRDQQ-KQQQERSEEGSQWFDQFHE  963

Query  273  VISQNST  253
            VIS++S 
Sbjct  964  VISKSSV  970



>ref|NP_201029.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 sp|C0LGW6.1|ERL1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL1; AltName: Full=Protein ERECTA-like kinase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59401.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97583.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=966

 Score =   279 bits (714),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 152/247 (62%), Positives = 192/247 (78%), Gaps = 15/247 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  734  HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSR+ EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  794  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEA  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  854  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL    S K    + +   +R P            +Q F++F 
Sbjct  914  LLSLVPSLQVAK--KLPSLD--HSTK---KLQQENEVRNPD--------AEASQWFVQFR  958

Query  276  EVISQNS  256
            EVIS++S
Sbjct  959  EVISKSS  965



>ref|XP_008658489.1| PREDICTED: uncharacterized protein LOC100279811 isoform X1 [Zea 
mays]
 gb|AFW86035.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=985

 Score =   279 bits (714),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 191/249 (77%), Gaps = 3/249 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD  FEAHL+DFG
Sbjct  736  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDGSFEAHLSDFG  795

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +KS+ STY++GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGRKAVDNES
Sbjct  796  IAKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNES  855

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA ++ VME+VD E+S TC D+  V+K FQLALLCTKR P++RP+MHEVARV
Sbjct  856  NLHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARV  915

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL--TCPSMSTSDAQLFLK  283
            L SL+     K      + A   +     ++    +LR   +        S+SD Q F++
Sbjct  916  LLSLL-PPAAKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVR  974

Query  282  FGEVISQNS  256
            FGEVIS+++
Sbjct  975  FGEVISKHT  983



>gb|AGL91675.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=958

 Score =   279 bits (713),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 184/243 (76%), Gaps = 6/243 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD+ FEAHL+DFG
Sbjct  710  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDEHFEAHLSDFG  769

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG KAVDN+S
Sbjct  770  IAKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDS  829

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI+++A +N VME+VD+E+S TC D+G V+K FQLALLCTKR P +RP+MHEVARV
Sbjct  830  NLHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARV  889

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQL--LTCPSMSTSDAQLFLK  283
            L SLMP+    +    PS      A        Y     P          S+SD Q F++
Sbjct  890  LLSLMPAPAAAK----PSSYATTDASKKVDYTRYLAAAAPNADHDMGGDNSSSDEQWFVR  945

Query  282  FGE  274
            FGE
Sbjct  946  FGE  948



>gb|ERN19491.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
Length=977

 Score =   279 bits (713),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 196/248 (79%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWD RL IA+GAA+GLAYLHHDC+PRIIHRDVK+SNILLD++FEAHL+DFG
Sbjct  730  HGPSKKVKLDWDARLKIAVGAAQGLAYLHHDCSPRIIHRDVKTSNILLDENFEAHLSDFG  789

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++K++ STY+MGTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  790  IAKCISSAKTHASTYVMGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  849

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VMESVD+E+S TC D   ++K FQLALLCTK QPSERP+M EV+RV
Sbjct  850  NLHQLILSKADDNTVMESVDSEVSVTCTDHNLLRKTFQLALLCTKCQPSERPTMQEVSRV  909

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL-TCPSMSTSDAQLFLKF  280
            L SL+P         + + + L       Y+DEY++++   +       ST+D   F++F
Sbjct  910  LLSLLPPPPTSTTKPSSTSSRL-VMTYSQYIDEYSDVKKEAVAGNLTHNSTTDPHWFVRF  968

Query  279  GEVISQNS  256
            GEVISQN+
Sbjct  969  GEVISQNT  976



>ref|XP_002864777.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41036.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   278 bits (712),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 190/247 (77%), Gaps = 15/247 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  734  HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  794  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  854  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PS     S K P   +E  N                +Q F++F 
Sbjct  914  LLSLLPSLQVAK--KLPSHD--QSTKKPQQENEVRN-----------HDAEASQWFVQFR  958

Query  276  EVISQNS  256
            EVIS++S
Sbjct  959  EVISKSS  965



>ref|XP_009600406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Nicotiana tomentosiformis]
Length=967

 Score =   278 bits (712),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 189/247 (77%), Gaps = 10/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+  LDW+TRL IA+GAA+GLAYLHHDCN RIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  730  HGPSKKVMLDWETRLKIAVGAAQGLAYLHHDCNQRIIHRDVKSSNILLDENFEAHLSDFG  789

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ ST+++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K V N+ 
Sbjct  790  IAKCIPTAKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVHNDL  849

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA NN VME+VD E+S TC DL  V+K FQLALLCTKR P ERP+MHEV+RV
Sbjct  850  NLHQLILSKADNNTVMEAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVSRV  909

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P LAP  S     Y         PQ+    S ++SDAQ  ++F 
Sbjct  910  LVSLLPPPPTK-----PCLAPPKSID---YTKFVLGKGLPQVQQ--SENSSDAQWLVRFR  959

Query  276  EVISQNS  256
            E IS+N+
Sbjct  960  EAISKNT  966



>ref|XP_006858024.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Amborella trichopoda]
Length=971

 Score =   278 bits (712),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 154/248 (62%), Positives = 196/248 (79%), Gaps = 2/248 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWD RL IA+GAA+GLAYLHHDC+PRIIHRDVK+SNILLD++FEAHL+DFG
Sbjct  724  HGPSKKVKLDWDARLKIAVGAAQGLAYLHHDCSPRIIHRDVKTSNILLDENFEAHLSDFG  783

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + ++K++ STY+MGTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  784  IAKCISSAKTHASTYVMGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  843

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VMESVD+E+S TC D   ++K FQLALLCTK QPSERP+M EV+RV
Sbjct  844  NLHQLILSKADDNTVMESVDSEVSVTCTDHNLLRKTFQLALLCTKCQPSERPTMQEVSRV  903

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLL-TCPSMSTSDAQLFLKF  280
            L SL+P         + + + L       Y+DEY++++   +       ST+D   F++F
Sbjct  904  LLSLLPPPPTSTTKPSSTSSRL-VMTYSQYIDEYSDVKKEAVAGNLTHNSTTDPHWFVRF  962

Query  279  GEVISQNS  256
            GEVISQN+
Sbjct  963  GEVISQNT  970



>ref|XP_004496653.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Cicer arietinum]
Length=986

 Score =   278 bits (711),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 190/242 (79%), Gaps = 13/242 (5%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TR+ IA+GAAEGLAYLHHDC PRI+HRD+KSSNILLD++FEAHL+DFG AK +
Sbjct  757  KVKLDWETRMRIAVGAAEGLAYLHHDCIPRIVHRDIKSSNILLDENFEAHLSDFGTAKCI  816

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
              ++++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+SNLHHL
Sbjct  817  PATRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSNLHHL  876

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA NN +ME+VD E+S TC DL  VKK F+LALLCTK+ PSERP+MHEVARVL S +
Sbjct  877  ILSKAENNTIMEAVDPEVSITCIDLAHVKKTFRLALLCTKKNPSERPTMHEVARVLISQL  936

Query  441  PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQ  262
            P+         PS     +AK   Y  +   L+ PQ    P  + S+AQ F++FG+ IS+
Sbjct  937  PAP--------PSKVVAAAAKSFDYNQKVDGLQ-PQ----PDNNASNAQWFVRFGDDISK  983

Query  261  NS  256
            ++
Sbjct  984  ST  985



>ref|XP_009757534.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nicotiana sylvestris]
Length=967

 Score =   277 bits (709),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 188/247 (76%), Gaps = 10/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCN RIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  730  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNQRIIHRDVKSSNILLDENFEAHLSDFG  789

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ ST+++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K V N+ 
Sbjct  790  IAKCIPTAKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVHNDL  849

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA NN VME+VD E+S TC DL  V+K FQLALLCTKR P ERP+MHEVARV
Sbjct  850  NLHQLILSKADNNTVMEAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARV  909

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P L P  S     Y         PQ     + ++SDAQ  ++F 
Sbjct  910  LVSLLPPPPTK-----PCLDPPKSID---YTKFVLGKGLPQ--AQQNDNSSDAQWLVRFR  959

Query  276  EVISQNS  256
            E IS+N+
Sbjct  960  EAISKNT  966



>ref|XP_009757535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nicotiana sylvestris]
Length=964

 Score =   277 bits (709),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 188/247 (76%), Gaps = 10/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCN RIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  727  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNQRIIHRDVKSSNILLDENFEAHLSDFG  786

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ ST+++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K V N+ 
Sbjct  787  IAKCIPTAKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVHNDL  846

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA NN VME+VD E+S TC DL  V+K FQLALLCTKR P ERP+MHEVARV
Sbjct  847  NLHQLILSKADNNTVMEAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARV  906

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P L P  S     Y         PQ     + ++SDAQ  ++F 
Sbjct  907  LVSLLPPPPTK-----PCLDPPKSID---YTKFVLGKGLPQ--AQQNDNSSDAQWLVRFR  956

Query  276  EVISQNS  256
            E IS+N+
Sbjct  957  EAISKNT  963



>ref|XP_006606082.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X1 [Glycine max]
Length=993

 Score =   277 bits (709),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 190/245 (78%), Gaps = 10/245 (4%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD+ FEAHL+DFG AK +
Sbjct  756  KVKLDWETRLRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDETFEAHLSDFGTAKCI  815

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
             T++++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNESNLH L
Sbjct  816  STTRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQL  875

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA +N VME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARVL SL+
Sbjct  876  ILSKADSNTVMETVDPEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLL  935

Query  441  PSSHPKQVNQTPSLAPLPSAKVP---CYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            PS   K       LAP P+ K       +++    +  +          +AQ F++FG+V
Sbjct  936  PSPLSK------ILAP-PAKKFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDV  988

Query  270  ISQNS  256
            IS+++
Sbjct  989  ISKST  993



>ref|XP_006606083.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X2 [Glycine max]
Length=989

 Score =   277 bits (709),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 190/245 (78%), Gaps = 10/245 (4%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD+ FEAHL+DFG AK +
Sbjct  752  KVKLDWETRLRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDETFEAHLSDFGTAKCI  811

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
             T++++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNESNLH L
Sbjct  812  STTRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQL  871

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA +N VME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARVL SL+
Sbjct  872  ILSKADSNTVMETVDPEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLL  931

Query  441  PSSHPKQVNQTPSLAPLPSAKVP---CYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            PS   K       LAP P+ K       +++    +  +          +AQ F++FG+V
Sbjct  932  PSPLSK------ILAP-PAKKFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDV  984

Query  270  ISQNS  256
            IS+++
Sbjct  985  ISKST  989



>gb|KHN15712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   277 bits (709),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 190/245 (78%), Gaps = 10/245 (4%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA+GAAEGLAYLHHDCNPRI+HRD+KSSNILLD+ FEAHL+DFG AK +
Sbjct  756  KVKLDWETRLRIAVGAAEGLAYLHHDCNPRIVHRDIKSSNILLDETFEAHLSDFGTAKCI  815

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
             T++++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNESNLH L
Sbjct  816  STTRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQL  875

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            IL+KA +N VME+VD E+S TC DL  VKK FQLALLCTK+ PSERP+MHEVARVL SL+
Sbjct  876  ILSKADSNTVMEAVDPEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVLVSLL  935

Query  441  PSSHPKQVNQTPSLAPLPSAKVP---CYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            PS   K       LAP P+ K       +++    +  +          +AQ F++FG+V
Sbjct  936  PSPLSK------ILAP-PAKKFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDV  988

Query  270  ISQNS  256
            IS+++
Sbjct  989  ISKST  993



>gb|AAP69763.1| ERECTA-like kinase 1 [Arabidopsis thaliana]
Length=966

 Score =   276 bits (707),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 191/247 (77%), Gaps = 15/247 (6%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KL W+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  734  HGSLKKVKLGWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  793

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSR+ EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  794  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEA  853

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  854  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  913

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL    S K    + +   +R P            +Q F++F 
Sbjct  914  LLSLVPSLQVAK--KLPSLD--HSTK---KLQQENEVRNPD--------AEASQWFVQFR  958

Query  276  EVISQNS  256
            EVIS++S
Sbjct  959  EVISKSS  965



>ref|XP_010458423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=1007

 Score =   276 bits (705),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 178/216 (82%), Gaps = 4/216 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  732  HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  791

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  792  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  851

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E++ TC DLG ++K FQLALLCTK  P ERP+M EV+RV
Sbjct  852  NLHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKLNPLERPTMLEVSRV  911

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTN  349
            L SL+PS    +  + PSL   PS K P   +E  N
Sbjct  912  LLSLLPSLQVAK--KLPSLD--PSTKKPQQENEVRN  943



>ref|XP_002322426.1| PTH-1 family protein [Populus trichocarpa]
 gb|EEF06553.1| PTH-1 family protein [Populus trichocarpa]
Length=870

 Score =   274 bits (701),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 184/247 (74%), Gaps = 35/247 (14%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL +A+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL DFG
Sbjct  658  HGPSKKVKLDWETRLKVAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLCDFG  717

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK + T+K++ ST++MGTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KAVDNES
Sbjct  718  IAKCIPTTKTHASTFVMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNES  777

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  LIL++A +N VME+VD E+S TC DL  VKK FQLALLCTKR PSERP+M +V+R 
Sbjct  778  NLQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSR-  836

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
                          Q P+                  L  PQLL     ++SDA  F++F 
Sbjct  837  --------------QQPT------------------LHQPQLLQ--ENNSSDAHWFMRFK  862

Query  276  EVISQNS  256
            EV+S+N+
Sbjct  863  EVVSKNT  869



>ref|XP_006348051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X1 [Solanum tuberosum]
Length=975

 Score =   275 bits (704),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 189/247 (77%), Gaps = 9/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNIL+D++FEAHL+DFG
Sbjct  737  HGPSKKVKLDWETRLRIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILVDENFEAHLSDFG  796

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            +AK + ++K++ ST ++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ 
Sbjct  797  VAKCIPSAKTHASTLVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDL  856

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++KA +N VM++VD E+S TC DL  V+K FQLALLCTKR P ERP+MHEVARV
Sbjct  857  NLHQLIMSKADDNTVMDAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARV  916

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P L P P  K   Y         PQ+       +S+AQ  ++F 
Sbjct  917  LVSLLPPPPTK-----PCLDPPP--KSIDYTKFVIGKGLPQVQQ--GDDSSEAQWLVRFQ  967

Query  276  EVISQNS  256
            E IS+NS
Sbjct  968  EAISKNS  974



>ref|XP_006348052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X2 [Solanum tuberosum]
Length=973

 Score =   275 bits (704),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 189/247 (77%), Gaps = 9/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNIL+D++FEAHL+DFG
Sbjct  735  HGPSKKVKLDWETRLRIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILVDENFEAHLSDFG  794

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            +AK + ++K++ ST ++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ 
Sbjct  795  VAKCIPSAKTHASTLVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDL  854

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++KA +N VM++VD E+S TC DL  V+K FQLALLCTKR P ERP+MHEVARV
Sbjct  855  NLHQLIMSKADDNTVMDAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARV  914

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P L P P  K   Y         PQ+       +S+AQ  ++F 
Sbjct  915  LVSLLPPPPTK-----PCLDPPP--KSIDYTKFVIGKGLPQVQQ--GDDSSEAQWLVRFQ  965

Query  276  EVISQNS  256
            E IS+NS
Sbjct  966  EAISKNS  972



>ref|XP_004234153.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Solanum lycopersicum]
Length=976

 Score =   275 bits (704),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 189/247 (77%), Gaps = 9/247 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNIL+D++FEAHL+DFG
Sbjct  738  HGPSKKVKLDWETRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILVDENFEAHLSDFG  797

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            +AK + T+K++ ST ++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ 
Sbjct  798  VAKCIPTAKTHASTLVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDL  857

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++KA +N VM++VD E+S TC DL  V+K FQLALLC KR P ERP+MHEVARV
Sbjct  858  NLHQLIMSKADDNTVMDAVDPEVSVTCMDLMHVRKTFQLALLCAKRFPCERPTMHEVARV  917

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+P    K     P L P P  K   Y         PQ+      ++S+AQ  ++F 
Sbjct  918  LVSLLPPPPTK-----PCLDPPP--KSIDYTKFVIGKGLPQVQQ--GDNSSEAQWLVRFQ  968

Query  276  EVISQNS  256
            E IS+NS
Sbjct  969  EAISKNS  975



>gb|KFK27954.1| hypothetical protein AALP_AA8G452900 [Arabis alpina]
Length=975

 Score =   275 bits (703),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/247 (61%), Positives = 190/247 (77%), Gaps = 7/247 (3%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  735  HGPLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  794

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLE+LTG+KAVDNE+
Sbjct  795  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLEILTGKKAVDNEA  854

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI++K  +N VME+VD E++ TC DLG +KK F+LALLCTKR P ERP+M EV+RV
Sbjct  855  NLHQLIMSKTDDNTVMEAVDPEVTVTCMDLGHIKKTFKLALLCTKRNPLERPTMLEVSRV  914

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL   PS K P    +Y   +  +           +Q F++F 
Sbjct  915  LLSLVPSLQVAK--KLPSLD--PSTKKPI---DYVVGQQQEKSEAQDREAEASQWFVQFH  967

Query  276  EVISQNS  256
            E IS++S
Sbjct  968  EDISKSS  974



>gb|AGL91674.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=981

 Score =   275 bits (703),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 188/249 (76%), Gaps = 17/249 (7%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCN RI+HRDVKSSNILLD+ FEAHL+DFG
Sbjct  712  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNLRIVHRDVKSSNILLDEHFEAHLSDFG  771

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG KAVDN+S
Sbjct  772  IAKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDS  831

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI+++A +N VME+VD+E+S TC D+G V+K FQLALLCTKR P +RP+MHEVARV
Sbjct  832  NLHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARV  891

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSM--------STSD  301
            L SLMP+  P     +   A   S KV     +YT  R       P+         S+ D
Sbjct  892  LLSLMPA--PAAAKPSSYAATDASKKV-----DYT--RYLAAAAAPNTEHDMGGDNSSPD  942

Query  300  AQLFLKFGE  274
             Q F++FGE
Sbjct  943  EQWFVRFGE  951



>gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea]
Length=941

 Score =   274 bits (700),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 183/242 (76%), Gaps = 13/242 (5%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDWDTRL IA+GA++GLAYLHHDCNPRIIHRDVKSSNILLD+DFEAHL+DFGIAK L
Sbjct  713  KVKLDWDTRLKIAVGASQGLAYLHHDCNPRIIHRDVKSSNILLDEDFEAHLSDFGIAKCL  772

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
              +K++ STY++GTIGYIDP+YARTSRLTEKSDVYS+GIVL+ELLTG+KAVDN+ NLH L
Sbjct  773  APAKTHASTYVLGTIGYIDPDYARTSRLTEKSDVYSFGIVLMELLTGKKAVDNDLNLHQL  832

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            +L KA  N +ME+VD E+S TC D   +KKVFQLALLCTKR PSERP+M++V+ VL S++
Sbjct  833  VLAKADGNTLMETVDPEVSVTCMDSSHIKKVFQLALLCTKRLPSERPTMNDVSSVLKSML  892

Query  441  PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQ  262
            P+  P Q  Q        S + P   D         L     M     + +++FGEVIS+
Sbjct  893  PA--PPQKKQL-------SVQQPHCKDAAAGGHEEDL----QMKRDAEEWYVRFGEVISK  939

Query  261  NS  256
            NS
Sbjct  940  NS  941



>ref|XP_010423244.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Camelina sativa]
Length=852

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  622  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  681

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  682  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  741

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D G +KK FQLALLCTKR P ERP+M EVARV
Sbjct  742  NLHQMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKRNPLERPTMQEVARV  801

Query  456  LGSLM  442
            L SL 
Sbjct  802  LLSLF  806



>ref|XP_010555314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Tarenaya hassleriana]
Length=986

 Score =   272 bits (696),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 168/190 (88%), Gaps = 3/190 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G++K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  733  HGSSKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  ++++ STY++GTIGYIDPEYA TSRL EKSD+YS+GIVLLELLTG+KAVDNES
Sbjct  793  IAKCIPATRTHASTYVLGTIGYIDPEYACTSRLNEKSDIYSFGIVLLELLTGKKAVDNES  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL++A +N VME+VD E+S TC DLG ++K FQLALLCTKR PSERP+MHEV+RV
Sbjct  853  NLHQLILSRADDNTVMEAVDPEVSVTCMDLGHIRKTFQLALLCTKRNPSERPTMHEVSRV  912

Query  456  LGSLMPSSHP  427
            L SL+   HP
Sbjct  913  LHSLL---HP  919



>ref|XP_011076300.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Sesamum indicum]
Length=949

 Score =   271 bits (692),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 193/247 (78%), Gaps = 2/247 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL +A+GAA+GL+YLHHDCNP+IIHRDVKSSNILLD++FEAHL+DFG
Sbjct  704  HGPSKKVKLDWETRLKVAVGAAQGLSYLHHDCNPKIIHRDVKSSNILLDENFEAHLSDFG  763

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T+K++ STY++GTIGYIDPEYA TS LTEKSDVYS+GIV+LELLTG+KAVDN+ 
Sbjct  764  IAKCLPTAKTHASTYVVGTIGYIDPEYATTSWLTEKSDVYSFGIVILELLTGKKAVDNDL  823

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  L+L+KA N+ +ME+VD E+S TC D+  V+K FQLALLCTKR PSERP+MHEV+R 
Sbjct  824  NLLQLVLSKAENDTLMETVDPEVSVTCMDVSHVRKTFQLALLCTKRNPSERPTMHEVSRF  883

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGSL+P     +   +     +   +      +  +L+ PQ       ++SDAQ +++FG
Sbjct  884  LGSLLPPP--PKKPCSTPPKNIDYTQFVIGKGQQPHLQIPQQQLQQDNNSSDAQWYVRFG  941

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  942  EVISKNT  948



>ref|XP_011076298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Sesamum indicum]
Length=993

 Score =   271 bits (693),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 193/247 (78%), Gaps = 2/247 (1%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+TRL +A+GAA+GL+YLHHDCNP+IIHRDVKSSNILLD++FEAHL+DFG
Sbjct  748  HGPSKKVKLDWETRLKVAVGAAQGLSYLHHDCNPKIIHRDVKSSNILLDENFEAHLSDFG  807

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T+K++ STY++GTIGYIDPEYA TS LTEKSDVYS+GIV+LELLTG+KAVDN+ 
Sbjct  808  IAKCLPTAKTHASTYVVGTIGYIDPEYATTSWLTEKSDVYSFGIVILELLTGKKAVDNDL  867

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL  L+L+KA N+ +ME+VD E+S TC D+  V+K FQLALLCTKR PSERP+MHEV+R 
Sbjct  868  NLLQLVLSKAENDTLMETVDPEVSVTCMDVSHVRKTFQLALLCTKRNPSERPTMHEVSRF  927

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LGSL+P     +   +     +   +      +  +L+ PQ       ++SDAQ +++FG
Sbjct  928  LGSLLPPP--PKKPCSTPPKNIDYTQFVIGKGQQPHLQIPQQQLQQDNNSSDAQWYVRFG  985

Query  276  EVISQNS  256
            EVIS+N+
Sbjct  986  EVISKNT  992



>ref|XP_010423243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Camelina sativa]
Length=967

 Score =   271 bits (692),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  737  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  796

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  797  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  856

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D G +KK FQLALLCTKR P ERP+M EVARV
Sbjct  857  NLHQMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKRNPLERPTMQEVARV  916

Query  456  LGSLM  442
            L SL 
Sbjct  917  LLSLF  921



>ref|XP_006399198.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
 gb|ESQ40651.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
Length=935

 Score =   270 bits (691),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDWDTRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  705  HGPGKKVKLDWDTRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  764

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK+Y STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDNE+
Sbjct  765  IAKSIPASKTYASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNEA  824

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHH+IL+KA +N VME+VDAE+S TC D G +KK FQLALLCTK+ P ERP+M EV+RV
Sbjct  825  NLHHMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKQNPLERPTMQEVSRV  884



>emb|CAB87274.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=932

 Score =   270 bits (690),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  702  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  761

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  762  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  821

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D G +KK FQLALLCTKR P ERP+M EV+RV
Sbjct  822  NLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRV  881

Query  456  LGSLM  442
            L SL+
Sbjct  882  LLSLV  886



>ref|NP_196335.2| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
 sp|Q6XAT2.1|ERL2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL2; AltName: Full=Protein ERECTA-like kinase 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP69764.1| ERECTA-like kinase 2 [Arabidopsis thaliana]
 gb|ACN59363.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91118.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
Length=967

 Score =   270 bits (691),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  737  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  796

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  797  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  856

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D G +KK FQLALLCTKR P ERP+M EV+RV
Sbjct  857  NLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRV  916

Query  456  LGSLM  442
            L SL+
Sbjct  917  LLSLV  921



>gb|AAO26312.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=719

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 189/254 (74%), Gaps = 25/254 (10%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD++FEAHL+DFG
Sbjct  483  HGPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDENFEAHLSDFG  542

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG+KAVDN+S
Sbjct  543  IAKCIPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDS  602

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LIL+KA +N VME+VD E+ +     G  +K FQLA +C +R  S+RP+MHEVARV
Sbjct  603  NLHQLILSKADDNTVMEAVDFEVRSPAWIWG-CQKAFQLA-ICAQR--SDRPTMHEVARV  658

Query  456  LGSLM--PSSHPKQVNQTPS-----LAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDA  298
            L SL+  PS  P  V Q P      LA  P  K+    D+               S+SD 
Sbjct  659  LVSLLPVPSLKPGLVPQKPMDYAHYLAAGPDVKIKRTHDDN--------------SSSDG  704

Query  297  QLFLKFGEVISQNS  256
            Q FL+FGEVIS+N+
Sbjct  705  QWFLRFGEVISKNT  718



>gb|EMS58253.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Triticum 
urartu]
Length=933

 Score =   269 bits (687),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD+ FEAHL+DFG
Sbjct  705  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDEHFEAHLSDFG  764

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG KAVDN+S
Sbjct  765  IAKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDS  824

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH LI+++A +N VME+VD+E+S TC D+G V+K FQLALLCTKR P +RP+MHEVAR 
Sbjct  825  NLHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARG  884

Query  456  LGSLM  442
            L SL+
Sbjct  885  LLSLV  889



>dbj|BAA97187.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=938

 Score =   268 bits (684),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 188/247 (76%), Gaps = 19/247 (8%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G+ K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD++FEAHL+DFG
Sbjct  710  HGSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDENFEAHLSDFG  769

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  SK++ STY++GTIGYIDPEYARTSR+ EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  770  IAKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEA  829

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH L    A +N VME+VD E++ TC DLG ++K FQLALLCTKR P ERP+M EV+RV
Sbjct  830  NLHQL----ADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRV  885

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            L SL+PS    +  + PSL    S K    + +   +R P            +Q F++F 
Sbjct  886  LLSLVPSLQVAK--KLPSLD--HSTK---KLQQENEVRNPD--------AEASQWFVQFR  930

Query  276  EVISQNS  256
            EVIS++S
Sbjct  931  EVISKSS  937



>gb|EYU25015.1| hypothetical protein MIMGU_mgv1a000865mg [Erythranthe guttata]
Length=955

 Score =   268 bits (684),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 191/251 (76%), Gaps = 5/251 (2%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDW+ RL +A+GAA+GLAYLHHDCNPRIIHRDVKSSNILLD +FEAHL+DFG
Sbjct  705  HGPSKKVKLDWEMRLKVAVGAAQGLAYLHHDCNPRIIHRDVKSSNILLDGNFEAHLSDFG  764

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK L T+K++  TY++GTIGYIDPEYART RLTEKSDVYS+GIVLLELLTG+KA+DN+ 
Sbjct  765  IAKCLPTTKTHAFTYVLGTIGYIDPEYARTIRLTEKSDVYSFGIVLLELLTGKKAIDNDL  824

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH L+ +KA ++ +M++VD E+S TC DL  V+K FQLALLCTK+ P+ RP+MHEV  V
Sbjct  825  NLHQLMQSKADDDTLMDAVDPEVSITCTDLSHVRKAFQLALLCTKQHPTARPTMHEVRNV  884

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDE----YTNLRTPQLLTCPSMSTSDAQLF  289
            L SL+PS  PK    + +   +  A+     ++        +  Q L   + S+SDAQ +
Sbjct  885  LVSLLPSP-PKNTTCSTNTKSVDYAQFVVGKEQQPHHLQTPQQQQQLQQDNSSSSDAQWY  943

Query  288  LKFGEVISQNS  256
            ++FGEVIS N+
Sbjct  944  VRFGEVISNNT  954



>ref|XP_002873299.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49558.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   267 bits (682),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  736  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  795

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  796  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  855

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D G +KK FQLALLCTKR P ERP+M EV+RV
Sbjct  856  NLHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRV  915



>ref|XP_006289323.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
 gb|EOA22221.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
Length=967

 Score =   266 bits (681),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  737  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  796

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  797  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  856

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D G +KK FQLALLCTKR P ERP+M EV+RV
Sbjct  857  NLHQMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKRNPLERPTMQEVSRV  916



>gb|EMT12712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=961

 Score =   266 bits (680),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G +K+ KLDWDTRL IA+GAA+GLAYLHHDCNPRI+HRDVKSSNILLD+ FEAHL+DFG
Sbjct  773  HGPSKKVKLDWDTRLRIAVGAAQGLAYLHHDCNPRIVHRDVKSSNILLDEHFEAHLSDFG  832

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK +  +K++ STY++GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG KAVDN+S
Sbjct  833  IAKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDS  892

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVAR  460
            NLH LI+++A +N VME+VD+E+S TC D+G V+K FQLALLCTKR P +RP+MHEVAR
Sbjct  893  NLHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVAR  951



>ref|XP_010491322.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Camelina sativa]
Length=961

 Score =   265 bits (678),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  731  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDGNFEARLSDFG  790

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  791  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  850

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D   +KK FQLALLCTKR P ERP+M EVARV
Sbjct  851  NLHQMILSKADDNTVMEAVDAEVSVTCVDSAHIKKTFQLALLCTKRNPLERPTMQEVARV  910



>ref|XP_010452673.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERL2 [Camelina sativa]
Length=923

 Score =   265 bits (676),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRD+KSSNILLD +FEA L+DFG
Sbjct  733  HGPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDIKSSNILLDXEFEARLSDFG  792

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+  +K+Y STY++GTIGYIDPEYARTSRL EKSD+YS+GIVLLELLTG+KAVDNE+
Sbjct  793  IAKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEA  852

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH +IL+KA +N VME+VDAE+S TC D   +KK FQLALLCTKR P ERP+M EVARV
Sbjct  853  NLHQMILSKADDNTVMEAVDAEVSVTCVDSAHIKKTFQLALLCTKRNPLERPTMQEVARV  912



>ref|XP_010474472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=796

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 148/181 (82%), Gaps = 5/181 (3%)
 Frame = -3

Query  798  TSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLI  619
             SK++TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD+ESNLHHLI
Sbjct  620  VSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLI  679

Query  618  LTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLMP  439
            ++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQPS+RP+MH+V RVLGS M 
Sbjct  680  MSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFML  739

Query  438  SSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVISQN  259
            S  P  V  T   A L  +   CY+DEY NL+TP  + C SMS SDAQLFL+FG+VISQN
Sbjct  740  SEQPPAVTDTS--AALAGS---CYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  794

Query  258  S  256
            S
Sbjct  795  S  795



>ref|XP_002981099.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
 gb|EFJ17800.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
Length=976

 Score =   251 bits (640),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 185/254 (73%), Gaps = 10/254 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  ++  LDWD RL+IALGAA+GL YLHH+C+PRIIHRDVKSSNILLD+ FE HL+DFG
Sbjct  723  HGPVRKVTLDWDARLIIALGAAQGLEYLHHNCSPRIIHRDVKSSNILLDERFEVHLSDFG  782

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+C++ ++TSTY+MGTIGYIDPEYARTSRL EKSDVYS+GIVLLEL+T +KAVD+E 
Sbjct  783  IAKSICSASTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELITRQKAVDDEK  842

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH  +L+   N +VME VD E+  TC D   ++K+ +LALLC ++ P++RP+MH+V  V
Sbjct  843  NLHQWVLSHVNNKSVMEIVDQEVKDTCTDPNAIQKLIRLALLCAQKFPAQRPTMHDVVNV  902

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPC---------YMDEYTNLRTPQLLTCPSMSTS  304
            + +L+P    K+ +   + A   +A             Y+D+Y + +    L+  S +TS
Sbjct  903  ILTLLPPPTVKKSSAGAANAAANAAVDSSANAGGANRRYVDDYVDSKHRDNLSASS-TTS  961

Query  303  DAQLFLKFGEVISQ  262
               LF+KFGEVISQ
Sbjct  962  GGHLFVKFGEVISQ  975



>ref|XP_002982573.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
 gb|EFJ16326.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
Length=977

 Score =   251 bits (640),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 185/254 (73%), Gaps = 10/254 (4%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G  ++  LDWD RL+IALGAA+GL YLHH+C+PRIIHRDVKSSNILLD+ FE HL+DFG
Sbjct  724  HGPVRKVTLDWDARLIIALGAAQGLEYLHHNCSPRIIHRDVKSSNILLDERFEVHLSDFG  783

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKS+C++ ++TSTY+MGTIGYIDPEYARTSRL EKSDVYS+GIVLLEL+T +KAVD+E 
Sbjct  784  IAKSICSASTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELITRQKAVDDEK  843

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLH  +L+   N +VME VD E+  TC D   ++K+ +LALLC ++ P++RP+MH+V  V
Sbjct  844  NLHQWVLSHVNNKSVMEIVDQEVKDTCTDPNAIQKLIRLALLCAQKFPAQRPTMHDVVNV  903

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPC---------YMDEYTNLRTPQLLTCPSMSTS  304
            + +L+P    K+ +   + A   +A             Y+D+Y + +    L+  S +TS
Sbjct  904  ILTLLPPPSVKKSSAGAANAAANAAVDSAANAGGANRRYVDDYVDSKHRDNLSASS-TTS  962

Query  303  DAQLFLKFGEVISQ  262
               LF+KFGEVISQ
Sbjct  963  GGHLFVKFGEVISQ  976



>ref|XP_009122365.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brassica rapa]
Length=963

 Score =   249 bits (636),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            A K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRDVKSSNILLD +FEA L+DFGIA
Sbjct  738  AGKKAKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDVKSSNILLDGNFEARLSDFGIA  797

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KS+  +K+Y STY++GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTG+KAVDNE+NL
Sbjct  798  KSIAAAKAYASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGKKAVDNEANL  857

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            H LIL+KA +N VM++VDAE+S TC D G +KK FQLAL+CTKR P ERP+M EVARV
Sbjct  858  HQLILSKADDNTVMDAVDAEVSVTCVDSGHIKKTFQLALMCTKRNPMERPTMQEVARV  915



>emb|CDX70013.1| BnaA10g23620D [Brassica napus]
Length=963

 Score =   247 bits (631),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            A K+ KLDW+TRL IA+GAA+GLAYLHHDC PRIIHRDVKSSNILLD +FEA L+DFGIA
Sbjct  738  AGKKAKLDWETRLKIAVGAAQGLAYLHHDCTPRIIHRDVKSSNILLDGNFEARLSDFGIA  797

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            KS+  +K+Y STY++GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTG+KAVDNE+NL
Sbjct  798  KSIAAAKAYASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGKKAVDNEANL  857

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            H LIL+KA +N VM++VDAE+S TC D G +KK FQLAL+C KR P ERP+M EVARV
Sbjct  858  HQLILSKADDNTVMDAVDAEVSVTCVDSGHIKKTFQLALMCAKRNPMERPTMQEVARV  915



>gb|ABR08864.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08865.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08866.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08867.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08868.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08869.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08870.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08871.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08872.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08873.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08874.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08876.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08877.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08878.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08879.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08880.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08881.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08882.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08883.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08884.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08885.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08886.1| erecta, partial [Arabidopsis thaliana]
Length=145

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -3

Query  825  DFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  646
            DFGIAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD
Sbjct  1    DFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVD  60

Query  645  NESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEV  466
            +ESNLHHLI++K  NN VME  D +I++TC+DLG VKKVFQLALLCTKRQP++RP+MH+V
Sbjct  61   DESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQV  120

Query  465  ARVLGSLMPSSHPKQVNQT  409
             RVLGS M S  P     T
Sbjct  121  TRVLGSFMLSEQPPAATDT  139



>gb|ABR08875.1| erecta, partial [Arabidopsis thaliana]
Length=145

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -3

Query  825  DFGIAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVD  646
            DFGIAKSLC SKS+TSTY+MGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLT RKAVD
Sbjct  1    DFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVD  60

Query  645  NESNLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEV  466
            +ESNLHHLI++K  NN VME  D +I++TC+DLG +KKVFQLALLCTKRQP++RP+MH+V
Sbjct  61   DESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVMKKVFQLALLCTKRQPNDRPTMHQV  120

Query  465  ARVLGSLMPSSHPKQVNQT  409
             RVLGS M S  P     T
Sbjct  121  TRVLGSFMLSEQPPAATDT  139



>emb|CDX99001.1| BnaC09g48340D [Brassica napus]
Length=964

 Score =   239 bits (611),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            A K+ KLDW+TRL IA+GAA GLAYLHHDC PRIIHRDVKSSNILLD +FEA L+DFGIA
Sbjct  735  AGKKAKLDWETRLKIAVGAAHGLAYLHHDCTPRIIHRDVKSSNILLDGNFEARLSDFGIA  794

Query  810  KSLCTSKSYTS-TYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  634
            KS+  +K+Y S TY++GTIGYIDPEYART+RL EKSDVYS+G+VLLELLTG+KAVD+E+N
Sbjct  795  KSIAAAKAYASSTYVLGTIGYIDPEYARTTRLNEKSDVYSFGVVLLELLTGKKAVDDEAN  854

Query  633  LHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            LH LIL+KA +N VM++VD E+S TC D G +KK FQLALLCTKR P ERP+M EVARV
Sbjct  855  LHQLILSKADDNTVMDAVDPEVSVTCVDSGHIKKTFQLALLCTKRNPMERPTMQEVARV  913



>gb|AAL50210.1| ER1-like receptor kinase, partial [Camelina sativa]
Length=144

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = -3

Query  738  YARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILTKAANNAVMESVDAEISAT  559
            YARTSRLTEKSDVYSYGIVLLELLT RKAVD+ESNLHHLI++K  NN VME  D +I++T
Sbjct  1    YARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITST  60

Query  558  CQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLMPSSHPKQVNQTPSLAPLPSAK  379
            C+DLG VKKVFQLALLCTKRQPS+RP+MH+V RVLGS M S  P  V  T   A L  + 
Sbjct  61   CKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMLSEQPPAVTDTS--AALAGS-  117

Query  378  VPCYMDEYTNLRTPQLLTCPSMSTSDAQL  292
              CY+DEY NL+TP  + C SMS SDAQL
Sbjct  118  --CYVDEYANLKTPHSVNCSSMSASDAQL  144



>ref|XP_001783127.1| ERL1a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ52064.1| ERL1a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=946

 Score =   218 bits (554),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 171/248 (69%), Gaps = 13/248 (5%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G   + +LDW+TRL IA GAA+GLAYLH DC P+++HRDVKS NILLD D EAH+ DFG
Sbjct  705  HGHVSKTELDWNTRLRIATGAAQGLAYLHRDCKPQVVHRDVKSCNILLDADMEAHVADFG  764

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAK++  ++++TST+I+GTIGYIDPEYA+TSRL  KSDVYS+GIVLLELLT + AVD+E 
Sbjct  765  IAKNIQAARTHTSTHILGTIGYIDPEYAQTSRLNVKSDVYSFGIVLLELLTNKMAVDDEV  824

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NL   +++K     + + +   + ATCQDL  ++K  +LALLC+K  PS RPSM++V++V
Sbjct  825  NLLDWVMSKLEGKTIQDVIHPHVRATCQDLDALEKTLKLALLCSKLNPSHRPSMYDVSQV  884

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPC----YMDEYTNLRTPQLLTCPSMSTSDAQLF  289
            L SL+P        Q+ +  P+  + +P     Y+D Y+   T  +    S S+S   L 
Sbjct  885  LLSLLPM-------QSETDDPMSKSSLPANQRRYIDMYSTKHTEAI--SLSNSSSGDTLL  935

Query  288  LKFGEVIS  265
             +F EVIS
Sbjct  936  YQFKEVIS  943



>ref|XP_001770079.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ65061.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=948

 Score =   216 bits (551),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 169/239 (71%), Gaps = 6/239 (3%)
 Frame = -3

Query  981  RKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSL  802
            + KLDW+TRL IA GAA+GLAYLH DC P+++HRDVKS NILLD D E H+ DFGIAK++
Sbjct  701  KNKLDWNTRLKIASGAAQGLAYLHKDCKPQVVHRDVKSCNILLDADMEPHVADFGIAKNI  760

Query  801  CTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHL  622
              ++++TST++MGTIGYIDPEYA+TSRL EKSDVYS+GI+LLE+LT +KAVD+E NL + 
Sbjct  761  QPARTHTSTHVMGTIGYIDPEYAQTSRLNEKSDVYSFGILLLEILTNKKAVDDEVNLLNW  820

Query  621  ILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLGSLM  442
            ++++     +   +D  ++ATCQDL  ++K  +LALLC+K  PS RPSM++V++VL SL+
Sbjct  821  VMSRLEGKTMQNVIDPYVTATCQDLDSLEKTLKLALLCSKDNPSHRPSMYDVSQVLLSLL  880

Query  441  PSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEVIS  265
            P  +    + + S    PS +   Y+D Y+   T       S ++S   L  +F E IS
Sbjct  881  PPQYSDDFHTSNS---FPSTQRR-YVDMYSTKHTESF--SLSKTSSGDTLLYQFKEAIS  933



>ref|XP_006372044.1| hypothetical protein POPTR_0018s08390g, partial [Populus trichocarpa]
 gb|ERP49841.1| hypothetical protein POPTR_0018s08390g, partial [Populus trichocarpa]
Length=384

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 150/247 (61%), Gaps = 70/247 (28%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+KK DW TRL IALGAA+GLAYLHHDC+PRIIHRDVKSSNILLD+DFEAHLTDFG
Sbjct  207  HGLTKKKKADWYTRLQIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDEDFEAHLTDFG  266

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            I K LC SKSYTS                            YGIVLLEL T RKAVDNE 
Sbjct  267  IPKRLCVSKSYTSI---------------------------YGIVLLELPTRRKAVDNEC  299

Query  636  NLHHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARV  457
            NLHHLIL+K A NA ME+VD EIS                                  ++
Sbjct  300  NLHHLILSKTAYNAAMETVDPEISPV--------------------------------KI  327

Query  456  LGSLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFG  277
            LG         +    P+L  LPS KVPCYMDE+ N++   +L CPSMSTS+A+LFLKFG
Sbjct  328  LG---------RTAAPPAL--LPSNKVPCYMDEHANIKNAHILHCPSMSTSEAELFLKFG  376

Query  276  EVISQNS  256
            EVISQNS
Sbjct  377  EVISQNS  383



>ref|XP_001770421.1| ERL2b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ64758.1| ERL2b AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=947

 Score =   209 bits (532),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 172/242 (71%), Gaps = 6/242 (2%)
 Frame = -3

Query  990  ATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFGIA  811
            A + KK+DW+TRL IALG+A+GLAYLH DC P++IHRDVKS NILL+ + +AHL DFG+A
Sbjct  708  AKRSKKMDWNTRLKIALGSAQGLAYLHQDCTPQVIHRDVKSCNILLNANMDAHLCDFGLA  767

Query  810  KSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNL  631
            K++  ++++TST+++GTIGYIDPEYA+TSRL EKSDVYS+GIVLLELL G+KAVD+E NL
Sbjct  768  KNIQPTRTHTSTFVLGTIGYIDPEYAQTSRLNEKSDVYSFGIVLLELLMGKKAVDDEVNL  827

Query  630  HHLILTKAANNAVMESVDAEISATCQDLGDVKKVFQLALLCTKRQPSERPSMHEVARVLG  451
               + +K     ++E VD  + +TC  +  ++K  +LALLC K+ PS+RP+M++VA+VL 
Sbjct  828  LDWVRSKIEQKNLLEFVDPYVRSTCPSMDHLEKALKLALLCAKQTPSQRPTMYDVAQVLS  887

Query  450  SLMPSSHPKQVNQTPSLAPLPSAKVPCYMDEYTNLRTPQLLTCPSMSTSDAQLFLKFGEV  271
            SL+P   P++    P   P P +K   Y+D Y+    P      S STS   L  +F  V
Sbjct  888  SLLPVVSPRK----PPSYPSPGSKHRRYVDTYS--AKPAEGMIASSSTSGGDLLDQFENV  941

Query  270  IS  265
            I+
Sbjct  942  IN  943



>gb|KFK22048.1| hypothetical protein AALP_AAs71129U000200 [Arabis alpina]
Length=240

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -3

Query  996  YGATKRKKLDWDTRllialgaaeglayLHHDCNPRIIHRDVKSSNILLDKDFEAHLTDFG  817
            +G TK+K LDWDTRL IA GAA+GLAYLHHDC+PRIIHRDVKSSNILLDK+ EA LTDFG
Sbjct  104  HGPTKKKILDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKELEARLTDFG  163

Query  816  IAKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNES  637
            IAKSLC SKS+TSTY+MGTIGYIDPE ARTS LTEKSDVYSYGIVLLELLT RKAVD++S
Sbjct  164  IAKSLCVSKSHTSTYVMGTIGYIDPENARTSHLTEKSDVYSYGIVLLELLTRRKAVDDDS  223

Query  636  NLHHLI  619
            NLHHL+
Sbjct  224  NLHHLV  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2516173509835