BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12414

Length=959
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011088114.1|  PREDICTED: regulator of nonsense transcripts...  89.4    2e-16   
gb|EYU33279.1|  hypothetical protein MIMGU_mgv1a009229mg              79.0    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_006389505.1|  hypothetical protein POPTR_0022s00460g           79.7    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002526435.1|  conserved hypothetical protein                   79.0    6e-13   
ref|XP_011047883.1|  PREDICTED: regulator of nonsense transcripts...  78.6    1e-12   Populus euphratica
ref|XP_011047885.1|  PREDICTED: regulator of nonsense transcripts...  78.2    1e-12   Populus euphratica
ref|XP_011047887.1|  PREDICTED: regulator of nonsense transcripts...  78.2    1e-12   Populus euphratica
ref|XP_011047886.1|  PREDICTED: regulator of nonsense transcripts...  78.2    1e-12   Populus euphratica
ref|XP_011028362.1|  PREDICTED: regulator of nonsense transcripts...  77.8    2e-12   Populus euphratica
ref|XP_011028363.1|  PREDICTED: regulator of nonsense transcripts...  77.4    2e-12   Populus euphratica
ref|XP_010657969.1|  PREDICTED: regulator of nonsense transcripts...  77.4    2e-12   
ref|XP_010657967.1|  PREDICTED: regulator of nonsense transcripts...  77.4    2e-12   Vitis vinifera
ref|XP_010657968.1|  PREDICTED: regulator of nonsense transcripts...  77.0    2e-12   
ref|XP_006349314.1|  PREDICTED: regulator of nonsense transcripts...  74.7    2e-11   Solanum tuberosum [potatoes]
ref|XP_004230442.1|  PREDICTED: regulator of nonsense transcripts...  73.9    3e-11   
ref|XP_011092289.1|  PREDICTED: regulator of nonsense transcripts...  73.9    3e-11   Sesamum indicum [beniseed]
gb|KDO41300.1|  hypothetical protein CISIN_1g0102242mg                71.6    4e-11   Citrus sinensis [apfelsine]
ref|XP_006385051.1|  hypothetical protein POPTR_0004s23450g           73.2    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009587502.1|  PREDICTED: regulator of nonsense transcripts...  72.4    1e-10   Nicotiana tomentosiformis
ref|XP_012066695.1|  PREDICTED: regulator of nonsense transcripts...  72.4    1e-10   
ref|XP_012066696.1|  PREDICTED: regulator of nonsense transcripts...  72.4    1e-10   Jatropha curcas
ref|XP_009587503.1|  PREDICTED: regulator of nonsense transcripts...  72.0    1e-10   Nicotiana tomentosiformis
ref|XP_006492554.1|  PREDICTED: regulator of nonsense transcripts...  71.6    2e-10   Citrus sinensis [apfelsine]
ref|XP_009775092.1|  PREDICTED: regulator of nonsense transcripts...  71.2    2e-10   Nicotiana sylvestris
ref|XP_009775100.1|  PREDICTED: regulator of nonsense transcripts...  71.2    2e-10   Nicotiana sylvestris
ref|XP_006431585.1|  hypothetical protein CICLE_v10000901mg           71.2    3e-10   Citrus clementina [clementine]
ref|XP_006339922.1|  PREDICTED: regulator of nonsense transcripts...  70.9    3e-10   Solanum tuberosum [potatoes]
ref|XP_006339925.1|  PREDICTED: regulator of nonsense transcripts...  70.9    3e-10   Solanum tuberosum [potatoes]
emb|CDO97628.1|  unnamed protein product                              69.3    1e-09   Coffea canephora [robusta coffee]
gb|EYU26454.1|  hypothetical protein MIMGU_mgv1a004529mg              69.3    1e-09   Erythranthe guttata [common monkey flower]
gb|EYU26453.1|  hypothetical protein MIMGU_mgv1a004529mg              69.3    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_006385052.1|  Smg-4/UPF3 family protein                        66.2    1e-08   
ref|XP_010327529.1|  PREDICTED: regulator of nonsense transcripts...  62.4    2e-07   Solanum lycopersicum
ref|XP_010327531.1|  PREDICTED: regulator of nonsense transcripts...  62.4    2e-07   Solanum lycopersicum
emb|CAN60293.1|  hypothetical protein VITISV_023400                   61.2    3e-07   Vitis vinifera
ref|XP_010327532.1|  PREDICTED: regulator of nonsense transcripts...  61.6    3e-07   Solanum lycopersicum
ref|XP_006598794.1|  PREDICTED: regulator of nonsense transcripts...  59.7    2e-06   Glycine max [soybeans]
ref|XP_004485448.1|  PREDICTED: regulator of nonsense transcripts...  59.3    2e-06   
ref|XP_010246763.1|  PREDICTED: regulator of nonsense transcripts...  58.2    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010246761.1|  PREDICTED: regulator of nonsense transcripts...  58.2    6e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010246764.1|  PREDICTED: regulator of nonsense transcripts...  58.2    6e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010246762.1|  PREDICTED: regulator of nonsense transcripts...  58.2    6e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010246760.1|  PREDICTED: regulator of nonsense transcripts...  58.2    6e-06   Nelumbo nucifera [Indian lotus]
gb|AES63158.2|  Smg-4/UPF3 family protein                             57.8    6e-06   Medicago truncatula
gb|AES63156.2|  Smg-4/UPF3 family protein                             57.4    8e-06   Medicago truncatula
ref|XP_006592654.1|  PREDICTED: regulator of nonsense transcripts...  57.0    1e-05   Glycine max [soybeans]
ref|XP_007148572.1|  hypothetical protein PHAVU_006G219800g           56.6    2e-05   Phaseolus vulgaris [French bean]
ref|XP_008219049.1|  PREDICTED: regulator of nonsense transcripts...  56.6    2e-05   Prunus mume [ume]
ref|XP_009362402.1|  PREDICTED: regulator of nonsense transcripts...  55.1    5e-05   Pyrus x bretschneideri [bai li]
ref|XP_009379185.1|  PREDICTED: regulator of nonsense transcripts...  55.1    5e-05   Pyrus x bretschneideri [bai li]
ref|XP_006858584.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-04   Amborella trichopoda
ref|XP_011628613.1|  PREDICTED: regulator of nonsense transcripts...  53.9    1e-04   Amborella trichopoda
gb|AES68284.2|  regulator of nonsense transcripts UPF3 protein        52.8    2e-04   Medicago truncatula
ref|XP_008368136.1|  PREDICTED: LOW QUALITY PROTEIN: regulator of...  52.4    4e-04   
ref|XP_007148607.1|  hypothetical protein PHAVU_005G000800g           51.6    7e-04   Phaseolus vulgaris [French bean]
ref|XP_007148608.1|  hypothetical protein PHAVU_005G000800g           51.2    8e-04   Phaseolus vulgaris [French bean]
ref|XP_004141560.1|  PREDICTED: regulator of nonsense transcripts...  51.2    8e-04   Cucumis sativus [cucumbers]
ref|XP_010912655.1|  PREDICTED: regulator of nonsense transcripts...  51.2    8e-04   Elaeis guineensis
ref|XP_011656113.1|  PREDICTED: regulator of nonsense transcripts...  51.2    9e-04   Cucumis sativus [cucumbers]



>ref|XP_011088114.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=515

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = -3

Query  954  DSAEGSLVEVKN-GLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTS-  781
            DSAEG+ VE K+  L ARG E++P+GSGR SH SVDNG+YR+ GRRG+A+N KDAD +S 
Sbjct  426  DSAEGTHVEKKHEMLVARGSEYRPSGSGRGSHYSVDNGSYRHGGRRGSAYNVKDADVSSN  485

Query  780  FgegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R    GYG+HEKQVWVQKSSSG+
Sbjct  486  VEGKSLKRGASSGYGSHEKQVWVQKSSSGT  515



>gb|EYU33279.1| hypothetical protein MIMGU_mgv1a009229mg [Erythranthe guttata]
Length=348

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFg  775
            DSAE   +E+   LS RGG+ +  GSGR SHSSVDNG+YR+ GRRG+A+N KD DG+S  
Sbjct  263  DSAEDLKIEM---LSVRGGDQRYVGSGRGSHSSVDNGSYRHGGRRGSAYNMKDTDGSSVV  319

Query  774  egr-psrrggpgyGTHEKQVWVQKSSSGS  691
            + +   R GG GYG++EK+VWVQKSSSGS
Sbjct  320  DAKFSKRGGGSGYGSNEKRVWVQKSSSGS  348



>ref|XP_006389505.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
 gb|ERP48419.1| hypothetical protein POPTR_0022s00460g [Populus trichocarpa]
Length=511

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -3

Query  915  LSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrggpgyG  736
            L+ R GE K  GSGRS+HSS+DNG++++SGRRG  H  +DADG++       R G  GYG
Sbjct  437  LNLRSGEVKALGSGRSNHSSLDNGSHKHSGRRGPPHPVRDADGSTVEGKSLKRGGASGYG  496

Query  735  THEKQVWVQKSSSGS  691
            +HEKQVWVQKSSSGS
Sbjct  497  SHEKQVWVQKSSSGS  511



>ref|XP_002526435.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35930.1| conserved hypothetical protein [Ricinus communis]
Length=472

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = -3

Query  957  QDSAEGSLVEVK-NGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTS  781
            QDS++G+L ++K +  ++R G+ K  GSGRSSHSS+DNG++++ GRRG +H  +DADG+S
Sbjct  382  QDSSQGNLGDIKVDSSNSRSGDVKTLGSGRSSHSSLDNGSHKHFGRRGPSHTVRDADGSS  441

Query  780  Fg-egrpsrrggpgyGTHEKQVWVQKSSSGS  691
               +      G  GYG+HEKQVWVQKSSSGS
Sbjct  442  LEGKPSKRGGGASGYGSHEKQVWVQKSSSGS  472



>ref|XP_011047883.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
 ref|XP_011047884.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=518

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  915  LSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrggpgyG  736
            L+ R GE K  GSGRS+HSS+DNG+ ++SGRRG  H  +DADG++       R G  GYG
Sbjct  444  LNLRSGEVKALGSGRSNHSSLDNGSQKHSGRRGPPHPVRDADGSTVEGKTVKRGGASGYG  503

Query  735  THEKQVWVQKSSSGS  691
            +HEKQVWVQKSSSGS
Sbjct  504  SHEKQVWVQKSSSGS  518



>ref|XP_011047885.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=517

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  915  LSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrggpgyG  736
            L+ R GE K  GSGRS+HSS+DNG+ ++SGRRG  H  +DADG++       R G  GYG
Sbjct  443  LNLRSGEVKALGSGRSNHSSLDNGSQKHSGRRGPPHPVRDADGSTVEGKTVKRGGASGYG  502

Query  735  THEKQVWVQKSSSGS  691
            +HEKQVWVQKSSSGS
Sbjct  503  SHEKQVWVQKSSSGS  517



>ref|XP_011047887.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Populus euphratica]
Length=510

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  915  LSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrggpgyG  736
            L+ R GE K  GSGRS+HSS+DNG+ ++SGRRG  H  +DADG++       R G  GYG
Sbjct  436  LNLRSGEVKALGSGRSNHSSLDNGSQKHSGRRGPPHPVRDADGSTVEGKTVKRGGASGYG  495

Query  735  THEKQVWVQKSSSGS  691
            +HEKQVWVQKSSSGS
Sbjct  496  SHEKQVWVQKSSSGS  510



>ref|XP_011047886.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Populus euphratica]
Length=511

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  915  LSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrggpgyG  736
            L+ R GE K  GSGRS+HSS+DNG+ ++SGRRG  H  +DADG++       R G  GYG
Sbjct  437  LNLRSGEVKALGSGRSNHSSLDNGSQKHSGRRGPPHPVRDADGSTVEGKTVKRGGASGYG  496

Query  735  THEKQVWVQKSSSGS  691
            +HEKQVWVQKSSSGS
Sbjct  497  SHEKQVWVQKSSSGS  511



>ref|XP_011028362.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Populus euphratica]
Length=521

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -3

Query  954  DSAEGSLVEVK-NGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS++G+  +VK + L+ R GE K  GSGRS+HSS+DNG++++ GRRG +H  +DA+G++ 
Sbjct  433  DSSQGNHGDVKVDNLNLRSGEVKVLGSGRSNHSSLDNGSHKHFGRRGPSHIVRDAEGSAV  492

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                P R G  GYG+HEKQVWVQKS+SGS
Sbjct  493  EAKTPKRGGASGYGSHEKQVWVQKSTSGS  521



>ref|XP_011028363.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Populus euphratica]
Length=520

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -3

Query  954  DSAEGSLVEVK-NGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS++G+  +VK + L+ R GE K  GSGRS+HSS+DNG++++ GRRG +H  +DA+G++ 
Sbjct  432  DSSQGNHGDVKVDNLNLRSGEVKVLGSGRSNHSSLDNGSHKHFGRRGPSHIVRDAEGSAV  491

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                P R G  GYG+HEKQVWVQKS+SGS
Sbjct  492  EAKTPKRGGASGYGSHEKQVWVQKSTSGS  520



>ref|XP_010657969.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Vitis vinifera]
Length=514

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  E+++ +S AR GE K  GSGR  HS++DNG++++SGRRG  H+ KDADG+S 
Sbjct  424  DFPEGSHGEMRSDMSNARSGEVKALGSGRGGHSALDNGSHKHSGRRGPTHSVKDADGSSI  483

Query  777  gegrpsrrggpgy--GTHEKQVWVQKSSSG  694
                   + G     G+HEKQVWVQKSSSG
Sbjct  484  VSEGKHSKRGSAPGYGSHEKQVWVQKSSSG  513



>ref|XP_010657967.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Vitis vinifera]
 emb|CBI29694.3| unnamed protein product [Vitis vinifera]
Length=519

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  E+++ +S AR GE K  GSGR  HS++DNG++++SGRRG  H+ KDADG+S 
Sbjct  429  DFPEGSHGEMRSDMSNARSGEVKALGSGRGGHSALDNGSHKHSGRRGPTHSVKDADGSSI  488

Query  777  gegrpsrrggpgy--GTHEKQVWVQKSSSG  694
                   + G     G+HEKQVWVQKSSSG
Sbjct  489  VSEGKHSKRGSAPGYGSHEKQVWVQKSSSG  518



>ref|XP_010657968.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Vitis vinifera]
Length=515

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 3/90 (3%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  E+++ +S AR GE K  GSGR  HS++DNG++++SGRRG  H+ KDADG+S 
Sbjct  425  DFPEGSHGEMRSDMSNARSGEVKALGSGRGGHSALDNGSHKHSGRRGPTHSVKDADGSSI  484

Query  777  gegrpsrrggpgy--GTHEKQVWVQKSSSG  694
                   + G     G+HEKQVWVQKSSSG
Sbjct  485  VSEGKHSKRGSAPGYGSHEKQVWVQKSSSG  514



>ref|XP_006349314.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Solanum 
tuberosum]
Length=483

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 59/90 (66%), Gaps = 7/90 (8%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  E K+GL+ ARG EF+P GSGR+S+SS DNGTY++ GRRG        DG S 
Sbjct  399  DFVEGSQGETKHGLANARGAEFRPMGSGRNSYSSFDNGTYKHGGRRGMRD-----DGISV  453

Query  777  -gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R G   YGTHEKQVWVQKSSSG+
Sbjct  454  GEGKPLRRGGPSSYGTHEKQVWVQKSSSGT  483



>ref|XP_004230442.1| PREDICTED: regulator of nonsense transcripts UPF3 [Solanum lycopersicum]
Length=485

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  E K+GL +AR  EF+P GSGR+SHSS DNGTY++ GRRG        DG S 
Sbjct  401  DFVEGSPGETKHGLVNARVAEFRPMGSGRNSHSSFDNGTYKHGGRRGMRD-----DGISV  455

Query  777  -gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R G   Y THEKQVWVQKSSSG+
Sbjct  456  GEGKPLRRGGPSSYNTHEKQVWVQKSSSGT  485



>ref|XP_011092289.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092290.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
 ref|XP_011092291.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Sesamum 
indicum]
Length=518

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 61/90 (68%), Gaps = 7/90 (8%)
 Frame = -3

Query  954  DSAEGSLVEVKN-GLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTS-  781
            D AE    +VKN  L ARGGE++  GSGR  H SVDNG++R+ GRR +A+N KD DG+S 
Sbjct  434  DPAE----DVKNEMLVARGGEYRQIGSGRGGHYSVDNGSFRH-GRRSSAYNIKDVDGSSV  488

Query  780  FgegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R G  GYG HEKQVWVQKSSSGS
Sbjct  489  LEGKPSRRGGSSGYGPHEKQVWVQKSSSGS  518



>gb|KDO41300.1| hypothetical protein CISIN_1g0102242mg, partial [Citrus sinensis]
 gb|KDO41301.1| hypothetical protein CISIN_1g0102242mg, partial [Citrus sinensis]
Length=253

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS+EG+L + K  LS  R GE K  G GRSSHSSVDNG++R+ GRRG  H   D      
Sbjct  165  DSSEGNLGDGKFDLSNMRSGEVKAVGGGRSSHSSVDNGSHRHIGRRGPTHVKDDGSPVMS  224

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                  R G  GYG+HEKQVWVQKSSSGS
Sbjct  225  EGKPLRRGGASGYGSHEKQVWVQKSSSGS  253



>ref|XP_006385051.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
 gb|ERP62848.1| hypothetical protein POPTR_0004s23450g [Populus trichocarpa]
Length=520

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = -3

Query  954  DSAEGSLVEVK-NGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS++G+  +VK + L+ R GE K  GSGR +HSS+DNG++++ GRRG +H  +DADG++ 
Sbjct  433  DSSQGNHGDVKVDSLNLRSGEVKVLGSGRGNHSSLDNGSHKHFGRRGPSHIVRDADGSTV  492

Query  777  gegrpsrrggpgyGTHEKQVWVQKSS  700
                P R G  GYG+HEKQVWVQKS+
Sbjct  493  EAKTPKRGGSSGYGSHEKQVWVQKST  518



>ref|XP_009587502.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=517

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 56/90 (62%), Gaps = 10/90 (11%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS EGS  E KN L + RGGEF+P GSGR+SHSS DNGTY+  G R         DG S 
Sbjct  436  DSLEGSQGETKNDLPNVRGGEFRPMGSGRNSHSSFDNGTYKRRGMRD--------DGISV  487

Query  777  -gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R G   YGTHEKQVWVQKSSSG+
Sbjct  488  GEGKPLRRGGPSNYGTHEKQVWVQKSSSGT  517



>ref|XP_012066695.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Jatropha curcas]
 gb|KDP42459.1| hypothetical protein JCGZ_00256 [Jatropha curcas]
Length=510

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS++G+L ++K   S +R GE K T +GR SHSS+DNG++++ GRRG +H  +DADG+S 
Sbjct  423  DSSQGNLGDLKVDPSNSRSGEVK-TLTGRGSHSSLDNGSHKHFGRRGPSHPVRDADGSSG  481

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                  R G  GYG+HEKQVWVQKSSSGS
Sbjct  482  EGKASKRGGASGYGSHEKQVWVQKSSSGS  510



>ref|XP_012066696.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Jatropha curcas]
Length=509

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 2/89 (2%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS++G+L ++K   S +R GE K T +GR SHSS+DNG++++ GRRG +H  +DADG+S 
Sbjct  422  DSSQGNLGDLKVDPSNSRSGEVK-TLTGRGSHSSLDNGSHKHFGRRGPSHPVRDADGSSG  480

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                  R G  GYG+HEKQVWVQKSSSGS
Sbjct  481  EGKASKRGGASGYGSHEKQVWVQKSSSGS  509



>ref|XP_009587503.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=508

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 56/90 (62%), Gaps = 10/90 (11%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS EGS  E KN L + RGGEF+P GSGR+SHSS DNGTY+  G R         DG S 
Sbjct  427  DSLEGSQGETKNDLPNVRGGEFRPMGSGRNSHSSFDNGTYKRRGMRD--------DGISV  478

Query  777  -gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R G   YGTHEKQVWVQKSSSG+
Sbjct  479  GEGKPLRRGGPSNYGTHEKQVWVQKSSSGT  508



>ref|XP_006492554.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Citrus 
sinensis]
Length=514

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS+EG+L + K  LS  R GE K  G GRSSHSSVDNG++R+ GRRG  H   D+     
Sbjct  426  DSSEGNLGDGKFDLSNMRSGEVKAVGGGRSSHSSVDNGSHRHIGRRGPTHVKDDSSPVMS  485

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                  R G  GYG+HEKQVWVQKSSSGS
Sbjct  486  EGKPLRRGGASGYGSHEKQVWVQKSSSGS  514



>ref|XP_009775092.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Nicotiana sylvestris]
Length=517

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 56/90 (62%), Gaps = 10/90 (11%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS EG+  E KN L + RGGEF+P GSGR+SHSS DNGTY+  G R         DG S 
Sbjct  436  DSLEGTQGETKNDLPNVRGGEFRPMGSGRNSHSSFDNGTYKRRGMRD--------DGISV  487

Query  777  -gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R G   YGTHEKQVWVQKSSSG+
Sbjct  488  GEGKPLRRGGPSNYGTHEKQVWVQKSSSGT  517



>ref|XP_009775100.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Nicotiana sylvestris]
Length=508

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 56/90 (62%), Gaps = 10/90 (11%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS EG+  E KN L + RGGEF+P GSGR+SHSS DNGTY+  G R         DG S 
Sbjct  427  DSLEGTQGETKNDLPNVRGGEFRPMGSGRNSHSSFDNGTYKRRGMRD--------DGISV  478

Query  777  -gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   R G   YGTHEKQVWVQKSSSG+
Sbjct  479  GEGKPLRRGGPSNYGTHEKQVWVQKSSSGT  508



>ref|XP_006431585.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
 gb|ESR44825.1| hypothetical protein CICLE_v10000901mg [Citrus clementina]
Length=514

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS+EG+L + K  LS  R GE K  G GRSSHSSVDNG++R+ GRRG  H   D      
Sbjct  426  DSSEGNLGDGKFDLSNMRSGEVKAVGGGRSSHSSVDNGSHRHIGRRGPTHVKDDGSPVMS  485

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                  R G  GYG+HEKQVWVQKSSSGS
Sbjct  486  EGKPLRRGGASGYGSHEKQVWVQKSSSGS  514



>ref|XP_006339922.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006339923.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006339924.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Solanum tuberosum]
Length=508

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = -3

Query  948  AEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF-g  775
             EG   E+KN L  ARG EF+P GSGR+SHSS DNG Y++ GRRG     +D  GTS   
Sbjct  425  VEGGQGELKNDLPIARGTEFRPIGSGRNSHSSADNGNYKHGGRRG----LRDVAGTSIGE  480

Query  774  egrpsrrggpgyGTHEKQVWVQKSSSGS  691
                 + G   Y + EKQVWVQKSSSGS
Sbjct  481  GKPVKKGGTSAYSSLEKQVWVQKSSSGS  508



>ref|XP_006339925.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum tuberosum]
Length=482

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = -3

Query  948  AEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF-g  775
             EG   E+KN L  ARG EF+P GSGR+SHSS DNG Y++ GRRG     +D  GTS   
Sbjct  399  VEGGQGELKNDLPIARGTEFRPIGSGRNSHSSADNGNYKHGGRRG----LRDVAGTSIGE  454

Query  774  egrpsrrggpgyGTHEKQVWVQKSSSGS  691
                 + G   Y + EKQVWVQKSSSGS
Sbjct  455  GKPVKKGGTSAYSSLEKQVWVQKSSSGS  482



>emb|CDO97628.1| unnamed protein product [Coffea canephora]
Length=517

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 3/90 (3%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D+ EG+ +E+K+ +S ARGGEF+  GSGR S SS DNG+YR+ GRRG+AH  KD+DG+S 
Sbjct  429  DATEGTQLEMKSDMSSARGGEFRHGGSGRGSQSSTDNGSYRHGGRRGSAH-VKDSDGSSL  487

Query  777  ge-grpsrrggpgyGTHEKQVWVQKSSSGS  691
             +     R G  G+G+HEKQVWVQKSSSGS
Sbjct  488  VDGKPLRRGGSSGFGSHEKQVWVQKSSSGS  517



>gb|EYU26454.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=521

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTS-  781
            D AEG+ VE K+ +  ARGG+++ TGSGR ++ S DNG+YR  GRRG+A+  KDADG S 
Sbjct  434  DPAEGTRVERKHDMPVARGGDYRSTGSGRGNNYSADNGSYR--GRRGSAYIVKDADGYST  491

Query  780  FgegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   + G   YG +EK+VWVQKS SGS
Sbjct  492  VEGKPLKKVGASVYGPNEKRVWVQKSGSGS  521



>gb|EYU26453.1| hypothetical protein MIMGU_mgv1a004529mg [Erythranthe guttata]
Length=522

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTS-  781
            D AEG+ VE K+ +  ARGG+++ TGSGR ++ S DNG+YR  GRRG+A+  KDADG S 
Sbjct  435  DPAEGTRVERKHDMPVARGGDYRSTGSGRGNNYSADNGSYR--GRRGSAYIVKDADGYST  492

Query  780  FgegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   + G   YG +EK+VWVQKS SGS
Sbjct  493  VEGKPLKKVGASVYGPNEKRVWVQKSGSGS  522



>ref|XP_006385052.1| Smg-4/UPF3 family protein [Populus trichocarpa]
 gb|ERP62849.1| Smg-4/UPF3 family protein [Populus trichocarpa]
Length=527

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 63/93 (68%), Gaps = 8/93 (9%)
 Frame = -3

Query  954  DSAEGSLVEVK-NGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS++G+  +VK + L+ R GE K  GSGR +HSS+DNG++++ GRRG +H  +DADG++ 
Sbjct  433  DSSQGNHGDVKVDSLNLRSGEVKVLGSGRGNHSSLDNGSHKHFGRRGPSHIVRDADGSTV  492

Query  777  gegrpsrrggpgyGTHE-------KQVWVQKSS  700
                P R G  GYG+HE       KQVWVQKS+
Sbjct  493  EAKTPKRGGSSGYGSHEVCSLDSQKQVWVQKST  525



>ref|XP_010327529.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010327530.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Solanum lycopersicum]
Length=508

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 51/88 (58%), Gaps = 6/88 (7%)
 Frame = -3

Query  948  AEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF-g  775
             EG   E KN L  ARG EF+P G GR ++SS DNG Y++ GR    H  +D D TS   
Sbjct  425  VEGGQGETKNDLPIARGSEFRPIGIGRHTNSSTDNGNYKHGGR----HGLRDVDDTSIGE  480

Query  774  egrpsrrggpgyGTHEKQVWVQKSSSGS  691
                 R G   Y + EKQVWVQKSSSGS
Sbjct  481  GKPVRRGGTSAYNSLEKQVWVQKSSSGS  508



>ref|XP_010327531.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Solanum lycopersicum]
Length=507

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 51/88 (58%), Gaps = 6/88 (7%)
 Frame = -3

Query  948  AEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF-g  775
             EG   E KN L  ARG EF+P G GR ++SS DNG Y++ GR    H  +D D TS   
Sbjct  424  VEGGQGETKNDLPIARGSEFRPIGIGRHTNSSTDNGNYKHGGR----HGLRDVDDTSIGE  479

Query  774  egrpsrrggpgyGTHEKQVWVQKSSSGS  691
                 R G   Y + EKQVWVQKSSSGS
Sbjct  480  GKPVRRGGTSAYNSLEKQVWVQKSSSGS  507



>emb|CAN60293.1| hypothetical protein VITISV_023400 [Vitis vinifera]
Length=304

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  E+++ +S AR GE K  GSGR  HS++DNG++++SGRRG  H+ KDADG+S 
Sbjct  174  DFPEGSHGEMRSDMSNARSGEVKALGSGRGGHSALDNGSHKHSGRRGPTHSVKDADGSSI  233



>ref|XP_010327532.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Solanum lycopersicum]
Length=495

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 49/82 (60%), Gaps = 6/82 (7%)
 Frame = -3

Query  930  EVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF-gegrpsr  757
            E KN L  ARG EF+P G GR ++SS DNG Y++ GR    H  +D D TS        R
Sbjct  418  ETKNDLPIARGSEFRPIGIGRHTNSSTDNGNYKHGGR----HGLRDVDDTSIGEGKPVRR  473

Query  756  rggpgyGTHEKQVWVQKSSSGS  691
             G   Y + EKQVWVQKSSSGS
Sbjct  474  GGTSAYNSLEKQVWVQKSSSGS  495



>ref|XP_006598794.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006598795.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN39677.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=512

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = -3

Query  954  DSAEGSLVEVK-NGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  ++K +  +AR GE K  GS R+SHSS +NG  ++ GRRG +H  KD DG S 
Sbjct  423  DPLEGSHADLKHDTPNARSGEVKSLGSVRTSHSS-ENGFNKHFGRRGPSHGVKDVDGYSV  481

Query  777  gegrpsrrggpgyG--THEKQVWVQKSSSGS  691
                   R        ++EKQVWVQK+SSG+
Sbjct  482  SSEGKHPRRSSTSAYGSNEKQVWVQKASSGT  512



>ref|XP_004485448.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Cicer arietinum]
 ref|XP_004485449.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X3 [Cicer arietinum]
 ref|XP_004485450.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X4 [Cicer arietinum]
Length=510

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EG   E+K+   SAR GE K  GS R+SHSS +NG  ++ GRRG  H  KD DG S 
Sbjct  421  DPLEGGHAELKHDTRSARSGEVKSFGSLRASHSS-ENGFNKHFGRRGPIHGVKDVDGYSV  479

Query  777  gegrpsrrggpgyG--THEKQVWVQKSSSGS  691
                   R        ++EKQVWVQK+SSG+
Sbjct  480  SSEGKHPRKPSSSAYGSNEKQVWVQKASSGT  510



>ref|XP_010246763.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X4 
[Nelumbo nucifera]
Length=580

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  930  EVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrr  754
            EVK+ +  A  GE K  GSGRS+ SS +NG++R   RRG+ H  KD DG S         
Sbjct  497  EVKSEIHHASKGEVKTIGSGRSNFSSAENGSHRQFSRRGSVHGGKDIDGNSLSTSDGKPS  556

Query  753  ggpgyG---THEKQVWVQKSSSGS  691
                     +HEKQVWVQK  SGS
Sbjct  557  KRGNATGYGSHEKQVWVQKLGSGS  580



>ref|XP_010246761.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Nelumbo nucifera]
Length=602

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  930  EVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrr  754
            EVK+ +  A  GE K  GSGRS+ SS +NG++R   RRG+ H  KD DG S         
Sbjct  519  EVKSEIHHASKGEVKTIGSGRSNFSSAENGSHRQFSRRGSVHGGKDIDGNSLSTSDGKPS  578

Query  753  ggpgyG---THEKQVWVQKSSSGS  691
                     +HEKQVWVQK  SGS
Sbjct  579  KRGNATGYGSHEKQVWVQKLGSGS  602



>ref|XP_010246764.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X5 
[Nelumbo nucifera]
Length=575

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  930  EVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrr  754
            EVK+ +  A  GE K  GSGRS+ SS +NG++R   RRG+ H  KD DG S         
Sbjct  492  EVKSEIHHASKGEVKTIGSGRSNFSSAENGSHRQFSRRGSVHGGKDIDGNSLSTSDGKPS  551

Query  753  ggpgyG---THEKQVWVQKSSSGS  691
                     +HEKQVWVQK  SGS
Sbjct  552  KRGNATGYGSHEKQVWVQKLGSGS  575



>ref|XP_010246762.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X3 
[Nelumbo nucifera]
Length=585

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  930  EVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrr  754
            EVK+ +  A  GE K  GSGRS+ SS +NG++R   RRG+ H  KD DG S         
Sbjct  502  EVKSEIHHASKGEVKTIGSGRSNFSSAENGSHRQFSRRGSVHGGKDIDGNSLSTSDGKPS  561

Query  753  ggpgyG---THEKQVWVQKSSSGS  691
                     +HEKQVWVQK  SGS
Sbjct  562  KRGNATGYGSHEKQVWVQKLGSGS  585



>ref|XP_010246760.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Nelumbo nucifera]
Length=612

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  930  EVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrr  754
            EVK+ +  A  GE K  GSGRS+ SS +NG++R   RRG+ H  KD DG S         
Sbjct  529  EVKSEIHHASKGEVKTIGSGRSNFSSAENGSHRQFSRRGSVHGGKDIDGNSLSTSDGKPS  588

Query  753  ggpgyG---THEKQVWVQKSSSGS  691
                     +HEKQVWVQK  SGS
Sbjct  589  KRGNATGYGSHEKQVWVQKLGSGS  612



>gb|AES63158.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=540

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EG   E+K+   SAR GE K  GS R+SHSS +NG  ++ GRRG  +  KD DG S 
Sbjct  451  DPLEGGHTELKHDTPSARSGEVKSLGSFRASHSS-ENGFSKHFGRRGPIYGVKDVDGYSI  509

Query  777  gegrpsrrggpgyG--THEKQVWVQKSSSGS  691
                   R        ++EKQVWVQK+SSG+
Sbjct  510  LSEGKHPRKSSTSAYGSNEKQVWVQKASSGT  540



>gb|AES63156.2| Smg-4/UPF3 family protein [Medicago truncatula]
Length=510

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EG   E+K+   SAR GE K  GS R+SHSS +NG  ++ GRRG  +  KD DG S 
Sbjct  421  DPLEGGHTELKHDTPSARSGEVKSLGSFRASHSS-ENGFSKHFGRRGPIYGVKDVDGYSI  479

Query  777  gegrpsrrggpgyG--THEKQVWVQKSSSGS  691
                   R        ++EKQVWVQK+SSG+
Sbjct  480  LSEGKHPRKSSTSAYGSNEKQVWVQKASSGT  510



>ref|XP_006592654.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X1 [Glycine max]
 ref|XP_006592655.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Glycine max]
 gb|KHN31598.1| Regulator of nonsense transcripts 3A [Glycine soja]
Length=514

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  ++K+ + +AR  E K  GS R+SHSS +NG  ++ GRRG ++  KD DG S 
Sbjct  425  DPLEGSQADLKHDMPNARSVEVKSFGSVRTSHSS-ENGFNKHFGRRGPSYGVKDVDGYSV  483

Query  777  gegrpsrrggpgyG--THEKQVWVQKSSSGS  691
                   R        ++EKQVWVQK+SSGS
Sbjct  484  SSEGKHPRRSSTSAYGSNEKQVWVQKASSGS  514



>ref|XP_007148572.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 ref|XP_007148573.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20566.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
 gb|ESW20567.1| hypothetical protein PHAVU_006G219800g [Phaseolus vulgaris]
Length=513

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -3

Query  954  DSAEGSLVEVKNGL-SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            D  EGS  ++K+ + + R GE K  G  R+SHSS +NG  ++ GRRG  H  KD DG S 
Sbjct  424  DPLEGSHADLKHDMPNTRSGEVKSLGGVRTSHSS-ENGFNKHFGRRGPTHGVKDVDGYSV  482

Query  777  gegrpsrrggpgyG--THEKQVWVQKSSSGS  691
                   R        ++EKQVWVQK+SSG+
Sbjct  483  SSEGKHPRRSGTTAYGSNEKQVWVQKASSGT  513



>ref|XP_008219049.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219050.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
 ref|XP_008219051.1| PREDICTED: regulator of nonsense transcripts UPF3 [Prunus mume]
Length=528

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 60/90 (67%), Gaps = 3/90 (3%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS--ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTS  781
            DS E S  EVK+  S  +R GE     SGR+S S V+NG+ R+ GRRG+AHN KD    +
Sbjct  440  DSFEVSHGEVKDDTSYGSRTGEVINPTSGRNS-SHVENGSQRHFGRRGSAHNIKDDGSIN  498

Query  780  FgegrpsrrggpgyGTHEKQVWVQKSSSGS  691
              EG+PS+RG   +G  EKQVWVQKSSSGS
Sbjct  499  VSEGKPSKRGATVHGAPEKQVWVQKSSSGS  528



>ref|XP_009362402.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362403.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009362404.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=522

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -3

Query  909  ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrggpgyGTH  730
            +R GE     SGR+S S VDNG++R+ GR G+AHN KD    + GEG+PS+RG   +GT 
Sbjct  451  SRTGEVINPTSGRNS-SHVDNGSHRHFGRHGSAHNMKDDGSVNVGEGKPSKRGASVHGTP  509

Query  729  EKQVWVQKSSSGS  691
            EKQVWVQKSSSGS
Sbjct  510  EKQVWVQKSSSGS  522



>ref|XP_009379185.1| PREDICTED: regulator of nonsense transcripts UPF3-like isoform 
X2 [Pyrus x bretschneideri]
Length=523

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 60/90 (67%), Gaps = 3/90 (3%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS--ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTS  781
            DS EG   E K+  S  +R GE     SGR+S S V+NG++R+ GRRGT HN KD    +
Sbjct  435  DSIEGPYGEGKDDSSYGSRTGEVINPTSGRNS-SHVENGSHRHFGRRGTGHNMKDDGSQN  493

Query  780  FgegrpsrrggpgyGTHEKQVWVQKSSSGS  691
             GEG+PS+RG  G G  EKQVWVQKSSSGS
Sbjct  494  VGEGKPSKRGATGQGAPEKQVWVQKSSSGS  523



>ref|XP_006858584.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Amborella trichopoda]
 gb|ERN20051.1| hypothetical protein AMTR_s00071p00188270 [Amborella trichopoda]
Length=599

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = -3

Query  912  SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrg--gpgy  739
            ++R  E K  G+GRSS  SV+NG++R++GRR ++   KDADG+         +    P Y
Sbjct  524  ASRSLEMKTQGTGRSSTVSVENGSHRHAGRRSSSTGLKDADGSMNLPDGKPVKRGGIPSY  583

Query  738  GTHEKQVWVQKSSSGS  691
            G HEKQ+WVQKS +G+
Sbjct  584  GAHEKQIWVQKSGTGT  599



>ref|XP_011628613.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Amborella trichopoda]
Length=600

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = -3

Query  912  SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrg--gpgy  739
            ++R  E K  G+GRSS  SV+NG++R++GRR ++   KDADG+         +    P Y
Sbjct  525  ASRSLEMKTQGTGRSSTVSVENGSHRHAGRRSSSTGLKDADGSMNLPDGKPVKRGGIPSY  584

Query  738  GTHEKQVWVQKSSSGS  691
            G HEKQ+WVQKS +G+
Sbjct  585  GAHEKQIWVQKSGTGT  600



>gb|AES68284.2| regulator of nonsense transcripts UPF3 protein [Medicago truncatula]
Length=540

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 50/89 (56%), Gaps = 5/89 (6%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLSA-RGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            +S EG + E  N  S  R GEF  +  GRSS  SV+NG+ R   RRG  +  KD DG   
Sbjct  456  ESVEGEVKE--NAYSGNRSGEFSASAGGRSS-PSVENGSQRIFTRRGAPYIVKD-DGAVS  511

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   + G G  THEKQVWVQKSSSG+
Sbjct  512  SSEGKLSKKGVGNSTHEKQVWVQKSSSGT  540



>ref|XP_008368136.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 
UPF3-like [Malus domestica]
Length=575

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = -3

Query  909  ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSFgegrpsrrggpgyGTH  730
            +R GE     SGR+S S V+NG++R+ GR G+AHN KD    + GEG+PS+RG   +GT 
Sbjct  504  SRTGEVINPTSGRNS-SHVENGSHRHFGRHGSAHNMKDDXSVNVGEGKPSKRGASVHGTP  562

Query  729  EKQVWVQKSSSGS  691
            EKQVWVQK SSGS
Sbjct  563  EKQVWVQKXSSGS  575



>ref|XP_007148607.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20601.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=539

 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 5/89 (6%)
 Frame = -3

Query  954  DSAEGSLVE-VKNGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            +SAEG L E V +G   RG EF  +  GR  + S++NG+ R   RRG ++  KD DG   
Sbjct  455  ESAEGELKENVTSG--NRGSEFSASAGGRG-NPSIENGSQRNFARRGASYVVKD-DGAVS  510

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   +   G+  HEKQVWVQKSSSGS
Sbjct  511  ISEGKPSKKSVGHSAHEKQVWVQKSSSGS  539



>ref|XP_007148608.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
 gb|ESW20602.1| hypothetical protein PHAVU_005G000800g [Phaseolus vulgaris]
Length=529

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 5/89 (6%)
 Frame = -3

Query  954  DSAEGSLVE-VKNGLSARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            +SAEG L E V +G   RG EF  +  GR +  S++NG+ R   RRG ++  KD DG   
Sbjct  445  ESAEGELKENVTSG--NRGSEFSASAGGRGN-PSIENGSQRNFARRGASYVVKD-DGAVS  500

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                   +   G+  HEKQVWVQKSSSGS
Sbjct  501  ISEGKPSKKSVGHSAHEKQVWVQKSSSGS  529



>ref|XP_004141560.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X2 
[Cucumis sativus]
Length=506

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 49/89 (55%), Gaps = 5/89 (6%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS E    E+K  +  +R G+     SGR  +SSV+NG+ R+ GRRG  H  KD DG S 
Sbjct  422  DSVEAFRGEMKEDIHGSRTGDVTTIVSGR--NSSVENGSVRHVGRRGAGHVMKD-DG-SL  477

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                         G HEKQVWVQKSSSGS
Sbjct  478  NPNEGKPSKRGVAGGHEKQVWVQKSSSGS  506



>ref|XP_010912655.1| PREDICTED: regulator of nonsense transcripts UPF3-like [Elaeis 
guineensis]
Length=562

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -3

Query  912  SARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDAD-GTSFgegrpsrrggpgyG  736
            ++R  E K  G GR S S ++NG++R+ GRRG A  +KDA+  +S  EG+ S+RG   YG
Sbjct  488  ASRTEEMKSHGGGRVSLSMLENGSHRHVGRRGPARASKDAESSSSISEGKHSKRGSSSYG  547

Query  735  THEKQVWVQKSSSG  694
            +HE+QVWVQKS S 
Sbjct  548  SHERQVWVQKSGSA  561



>ref|XP_011656113.1| PREDICTED: regulator of nonsense transcripts UPF3 isoform X1 
[Cucumis sativus]
 gb|KGN52703.1| hypothetical protein Csa_5G650630 [Cucumis sativus]
Length=513

 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 49/89 (55%), Gaps = 5/89 (6%)
 Frame = -3

Query  954  DSAEGSLVEVKNGLS-ARGGEFKPTGSGRSSHSSVDNGTYRYSGRRGTAHNTKDADGTSF  778
            DS E    E+K  +  +R G+     SGR  +SSV+NG+ R+ GRRG  H  KD DG S 
Sbjct  429  DSVEAFRGEMKEDIHGSRTGDVTTIVSGR--NSSVENGSVRHVGRRGAGHVMKD-DG-SL  484

Query  777  gegrpsrrggpgyGTHEKQVWVQKSSSGS  691
                         G HEKQVWVQKSSSGS
Sbjct  485  NPNEGKPSKRGVAGGHEKQVWVQKSSSGS  513



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2323260538540