BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12377

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758756.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            300   1e-94   Nicotiana sylvestris
ref|XP_009615220.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            299   2e-94   Nicotiana tomentosiformis
ref|XP_006338515.1|  PREDICTED: probable peptide/nitrate transpor...    294   2e-92   Solanum tuberosum [potatoes]
ref|XP_004232263.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       292   9e-92   
emb|CDP02164.1|  unnamed protein product                                282   6e-88   Coffea canephora [robusta coffee]
gb|KJB33723.1|  hypothetical protein B456_006G027600                    280   5e-87   Gossypium raimondii
ref|XP_011098534.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       275   3e-85   Sesamum indicum [beniseed]
gb|EYU44688.1|  hypothetical protein MIMGU_mgv1a026051mg                264   2e-84   Erythranthe guttata [common monkey flower]
ref|XP_008353485.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       271   3e-84   
ref|XP_010492315.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       273   4e-84   Camelina sativa [gold-of-pleasure]
ref|XP_008341498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            271   1e-83   
ref|XP_009121620.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       272   1e-83   Brassica rapa
ref|XP_009335771.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       271   1e-83   Pyrus x bretschneideri [bai li]
emb|CDY65044.1|  BnaA10g29780D                                          271   1e-83   Brassica napus [oilseed rape]
ref|XP_012082355.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       271   1e-83   Jatropha curcas
gb|KHG28522.1|  hypothetical protein F383_09980                         271   2e-83   Gossypium arboreum [tree cotton]
ref|XP_010420140.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       271   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010453622.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            269   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_003618370.1|  Peptide transporter family                         268   1e-82   
gb|AES74588.2|  peptide/nitrate transporter plant-like protein          268   1e-82   Medicago truncatula
ref|XP_008347950.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    268   3e-82   
emb|CDX91014.1|  BnaC02g05830D                                          265   5e-82   
ref|XP_006400015.1|  hypothetical protein EUTSA_v10013156mg             267   5e-82   Eutrema salsugineum [saltwater cress]
ref|XP_008230677.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            267   7e-82   Prunus mume [ume]
ref|XP_007032334.1|  Amino acid permease, putative isoform 3            261   8e-82   
gb|KHN34167.1|  Putative peptide/nitrate transporter                    266   1e-81   Glycine soja [wild soybean]
ref|XP_006287415.1|  hypothetical protein CARUB_v10000620mg             266   1e-81   Capsella rubella
ref|NP_196998.1|  probable peptide/nitrate transporter                  266   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|EYU44686.1|  hypothetical protein MIMGU_mgv1a004892mg                265   2e-81   Erythranthe guttata [common monkey flower]
ref|XP_007151152.1|  hypothetical protein PHAVU_004G022300g             266   2e-81   Phaseolus vulgaris [French bean]
ref|XP_002517413.1|  amino acid permease, putative                      265   2e-81   Ricinus communis
gb|KFK37592.1|  hypothetical protein AALP_AA3G003400                    266   2e-81   Arabis alpina [alpine rockcress]
ref|XP_002873698.1|  proton-dependent oligopeptide transport fami...    265   3e-81   Arabidopsis lyrata subsp. lyrata
gb|KHG25623.1|  hypothetical protein F383_02486                         264   4e-81   Gossypium arboreum [tree cotton]
ref|XP_011046084.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    262   6e-81   Populus euphratica
ref|XP_008348207.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    264   7e-81   
emb|CDX85576.1|  BnaA02g02370D                                          264   7e-81   
ref|XP_003554136.1|  PREDICTED: probable peptide/nitrate transpor...    264   8e-81   Glycine max [soybeans]
ref|XP_009126016.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            264   9e-81   Brassica rapa
ref|XP_010485501.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       264   1e-80   Camelina sativa [gold-of-pleasure]
gb|AFK43271.1|  unknown                                                 258   2e-80   Lotus japonicus
ref|XP_003633812.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            263   2e-80   Vitis vinifera
ref|XP_004296558.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       263   3e-80   Fragaria vesca subsp. vesca
ref|XP_011046083.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    262   3e-80   Populus euphratica
ref|XP_006372628.1|  proton-dependent oligopeptide transport fami...    262   4e-80   
gb|KJB75802.1|  hypothetical protein B456_012G058600                    262   4e-80   Gossypium raimondii
emb|CBI34989.3|  unnamed protein product                                262   4e-80   Vitis vinifera
ref|XP_008357888.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    261   1e-79   
ref|XP_007032333.1|  Amino acid permease, putative isoform 2            260   1e-79   
ref|XP_007032332.1|  Amino acid permease, putative isoform 1            260   2e-79   
ref|XP_003543540.1|  PREDICTED: probable peptide/nitrate transpor...    259   4e-79   Glycine max [soybeans]
emb|CDY37529.1|  BnaA05g33940D                                          259   8e-79   Brassica napus [oilseed rape]
ref|XP_007215636.1|  hypothetical protein PRUPE_ppa003862mg             258   9e-79   Prunus persica
ref|XP_004489344.1|  PREDICTED: probable peptide/nitrate transpor...    258   1e-78   Cicer arietinum [garbanzo]
dbj|BAE98864.1|  oligopeptide transporter - like protein                258   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010272076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       257   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010550101.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9 isof...    257   4e-78   Tarenaya hassleriana [spider flower]
ref|XP_010453501.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       258   4e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010550102.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    256   4e-78   Tarenaya hassleriana [spider flower]
ref|XP_010255307.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       256   5e-78   Nelumbo nucifera [Indian lotus]
emb|CDY49047.1|  BnaC05g48750D                                          257   6e-78   Brassica napus [oilseed rape]
ref|XP_002305027.1|  proton-dependent oligopeptide transport fami...    255   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011035394.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       255   2e-77   Populus euphratica
emb|CDY70256.1|  BnaCnng67440D                                          255   3e-77   Brassica napus [oilseed rape]
gb|KFK25622.1|  hypothetical protein AALP_AA8G138600                    255   3e-77   Arabis alpina [alpine rockcress]
ref|XP_010420013.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       252   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010498082.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like...    253   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010486758.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like...    253   3e-76   
ref|XP_010492181.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9-like       252   4e-76   
ref|XP_006299737.1|  hypothetical protein CARUB_v10015930mg             255   5e-76   
ref|XP_010696018.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    251   5e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008443465.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       252   5e-76   Cucumis melo [Oriental melon]
ref|XP_010696017.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    251   6e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010463532.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9            251   1e-75   Camelina sativa [gold-of-pleasure]
emb|CDY69851.1|  BnaCnng65650D                                          250   2e-75   Brassica napus [oilseed rape]
ref|XP_004147481.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       249   8e-75   Cucumis sativus [cucumbers]
ref|XP_010091949.1|  Putative peptide/nitrate transporter               248   1e-74   Morus notabilis
ref|XP_006408492.1|  hypothetical protein EUTSA_v10020393mg             247   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_006408493.1|  hypothetical protein EUTSA_v10020393mg             247   3e-74   Eutrema salsugineum [saltwater cress]
ref|NP_186784.1|  putative peptide/nitrate transporter                  246   8e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793798.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    244   9e-74   
ref|XP_008798051.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       245   1e-73   Phoenix dactylifera
ref|XP_008793797.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like...    245   1e-73   Phoenix dactylifera
ref|XP_010913459.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    244   2e-73   Elaeis guineensis
ref|XP_009147425.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.9            244   4e-73   Brassica rapa
ref|XP_010913458.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    244   6e-73   
ref|XP_010928216.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       242   2e-72   Elaeis guineensis
ref|XP_010033250.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            241   2e-72   Eucalyptus grandis [rose gum]
ref|XP_006446423.1|  hypothetical protein CICLE_v10014849mg             234   3e-69   Citrus clementina [clementine]
ref|XP_008365497.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       233   4e-69   
ref|XP_009413863.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    229   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413865.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8 isof...    228   2e-67   
ref|XP_009401528.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8-like       225   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ00312.1|  hypothetical protein OsI_22329                          225   1e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_003560866.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            223   4e-65   
ref|XP_002454309.1|  hypothetical protein SORBIDRAFT_04g028390          221   5e-65   
ref|XP_006656833.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...    222   8e-65   Oryza brachyantha
ref|XP_002438139.1|  hypothetical protein SORBIDRAFT_10g008670          218   2e-63   Sorghum bicolor [broomcorn]
ref|XP_006432899.1|  hypothetical protein CICLE_v10003886mg             215   1e-62   
ref|XP_004965110.1|  PREDICTED: probable peptide/nitrate transpor...    215   3e-62   Setaria italica
ref|NP_001057261.1|  Os06g0239500                                       215   3e-62   
gb|ABK25104.1|  unknown                                                 214   3e-61   Picea sitchensis
dbj|BAD37873.1|  putative oligopeptide transporter                      209   3e-60   Oryza sativa Japonica Group [Japonica rice]
gb|ERN18357.1|  hypothetical protein AMTR_s00055p00208320               207   2e-59   Amborella trichopoda
ref|XP_004953900.1|  PREDICTED: LOW QUALITY PROTEIN: putative pep...    206   4e-59   
ref|XP_011627979.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.8            207   8e-59   
gb|EPS62614.1|  hypothetical protein M569_12174                         203   3e-58   Genlisea aurea
ref|XP_011464751.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      205   4e-58   Fragaria vesca subsp. vesca
ref|XP_010665406.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    203   1e-57   
ref|XP_003634604.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    202   3e-57   
ref|XP_010665405.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    202   4e-57   Vitis vinifera
ref|XP_010665404.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    200   4e-57   
emb|CAN75422.1|  hypothetical protein VITISV_011767                     202   5e-57   Vitis vinifera
ref|XP_006416187.1|  hypothetical protein EUTSA_v10007248mg             196   1e-56   
ref|XP_010095904.1|  putative peptide/nitrate transporter               201   1e-56   Morus notabilis
ref|XP_010683110.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      201   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004499763.1|  PREDICTED: probable peptide/nitrate transpor...    200   2e-56   Cicer arietinum [garbanzo]
ref|NP_001169556.1|  uncharacterized protein LOC100383435               198   2e-56   Zea mays [maize]
dbj|BAK01715.1|  predicted protein                                      199   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94556.1|  predicted protein                                      199   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010245117.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    199   2e-56   Nelumbo nucifera [Indian lotus]
gb|KHN47085.1|  Putative peptide/nitrate transporter                    200   3e-56   Glycine soja [wild soybean]
emb|CBI39334.3|  unnamed protein product                                202   3e-56   Vitis vinifera
ref|XP_003523479.1|  PREDICTED: probable peptide/nitrate transpor...    199   3e-56   Glycine max [soybeans]
ref|XP_002265311.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    200   3e-56   Vitis vinifera
ref|XP_008658869.1|  PREDICTED: uncharacterized protein LOC100383...    199   4e-56   Zea mays [maize]
ref|XP_010245116.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    199   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010245115.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    199   5e-56   Nelumbo nucifera [Indian lotus]
gb|KDO43629.1|  hypothetical protein CISIN_1g042477mg                   197   9e-56   Citrus sinensis [apfelsine]
ref|XP_006416186.1|  hypothetical protein EUTSA_v10007248mg             196   1e-55   
gb|KEH16161.1|  proton-dependent oligopeptide transport family pr...    198   1e-55   Medicago truncatula
ref|XP_010062425.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      198   2e-55   
ref|XP_012084632.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      197   2e-55   Jatropha curcas
gb|KEH29311.1|  proton-dependent oligopeptide transport family pr...    194   2e-55   Medicago truncatula
ref|XP_010477514.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      197   3e-55   Camelina sativa [gold-of-pleasure]
gb|KEH29310.1|  proton-dependent oligopeptide transport family pr...    195   4e-55   Medicago truncatula
ref|XP_006416188.1|  hypothetical protein EUTSA_v10007248mg             196   7e-55   Eutrema salsugineum [saltwater cress]
emb|CAN71099.1|  hypothetical protein VITISV_000973                     196   8e-55   Vitis vinifera
ref|XP_010498728.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           196   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010322772.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    194   9e-55   
ref|XP_011464750.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      195   1e-54   Fragaria vesca subsp. vesca
ref|XP_010683224.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      196   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010460012.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      195   1e-54   Camelina sativa [gold-of-pleasure]
dbj|BAF02114.1|  peptide transporter like protein                       189   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665397.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      195   1e-54   Vitis vinifera
ref|XP_003597990.1|  Peptide transporter PTR3-A                         195   2e-54   Medicago truncatula
ref|XP_009788012.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      195   2e-54   Nicotiana sylvestris
gb|KEH29309.1|  proton-dependent oligopeptide transport family pr...    194   2e-54   Medicago truncatula
ref|XP_006356504.1|  PREDICTED: probable peptide/nitrate transpor...    195   2e-54   Solanum tuberosum [potatoes]
gb|ACJ85853.1|  unknown                                                 194   3e-54   Medicago truncatula
ref|XP_004241845.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    194   3e-54   Solanum lycopersicum
ref|XP_011001076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      194   5e-54   Populus euphratica
gb|AFK47483.1|  unknown                                                 189   5e-54   Medicago truncatula
gb|KEH29305.1|  proton-dependent oligopeptide transport family pr...    192   7e-54   Medicago truncatula
gb|KEH29314.1|  peptide/nitrate transporter plant-like protein          191   8e-54   Medicago truncatula
emb|CDY04807.1|  BnaC05g17820D                                          192   1e-53   
ref|XP_007204887.1|  hypothetical protein PRUPE_ppa003472mg             193   1e-53   Prunus persica
gb|KFK44349.1|  hypothetical protein AALP_AA1G246100                    192   1e-53   Arabis alpina [alpine rockcress]
ref|XP_010245114.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      192   2e-53   Nelumbo nucifera [Indian lotus]
gb|KEH29306.1|  proton-dependent oligopeptide transport family pr...    192   2e-53   Medicago truncatula
ref|XP_006307141.1|  hypothetical protein CARUB_v10008731mg             192   2e-53   Capsella rubella
emb|CDY21370.1|  BnaA09g30570D                                          192   3e-53   Brassica napus [oilseed rape]
ref|XP_006295948.1|  hypothetical protein CARUB_v10025090mg             190   3e-53   
ref|XP_006376225.1|  hypothetical protein POPTR_0013s11120g             192   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009115625.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           191   5e-53   Brassica rapa
ref|XP_008240575.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      191   5e-53   Prunus mume [ume]
ref|XP_002890519.1|  proton-dependent oligopeptide transport fami...    191   6e-53   
ref|NP_173670.2|  probable peptide/nitrate transporter                  191   6e-53   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27212.1|  hypothetical protein MIMGU_mgv1a017651mg                190   7e-53   Erythranthe guttata [common monkey flower]
gb|AAF18524.1|AC006551_10  Similar to peptide transporter               191   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009613182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      191   8e-53   Nicotiana tomentosiformis
emb|CDP10688.1|  unnamed protein product                                191   9e-53   Coffea canephora [robusta coffee]
ref|NP_974129.1|  putative peptide/nitrate transporter                  187   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177359.1|  putative peptide/nitrate transporter                  190   1e-52   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43310.1|  putative peptide transporter PTR2-B                    190   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683004.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      190   2e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK41643.1|  hypothetical protein AALP_AA2G154400                    189   2e-52   Arabis alpina [alpine rockcress]
ref|XP_010428077.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      188   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002887414.1|  hypothetical protein ARALYDRAFT_316182             188   3e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_010911895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      188   5e-52   Elaeis guineensis
gb|AAV84496.1|  At3g54450                                               183   5e-52   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42330.1|  putative peptide transporter PTR2-B                    187   5e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68284.1|  BnaA07g23240D                                          181   5e-52   
ref|XP_009783108.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      189   6e-52   Nicotiana sylvestris
ref|XP_006301502.1|  hypothetical protein CARUB_v10021928mg             186   6e-52   
ref|XP_010415947.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      188   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002887417.1|  proton-dependent oligopeptide transport fami...    188   6e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_006856672.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           188   7e-52   Amborella trichopoda
ref|NP_177358.2|  putative peptide/nitrate transporter                  187   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665402.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      188   9e-52   Vitis vinifera
ref|XP_010428068.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    186   9e-52   Camelina sativa [gold-of-pleasure]
ref|XP_012084631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      188   1e-51   Jatropha curcas
gb|ERM97847.1|  hypothetical protein AMTR_s00118p00123380               184   1e-51   Amborella trichopoda
ref|XP_006302084.1|  hypothetical protein CARUB_v10020071mg             187   1e-51   Capsella rubella
ref|XP_010414835.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      187   1e-51   Camelina sativa [gold-of-pleasure]
gb|KFK35753.1|  hypothetical protein AALP_AA4G032000                    185   1e-51   Arabis alpina [alpine rockcress]
ref|XP_010428074.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14           187   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010471232.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12           187   2e-51   Camelina sativa [gold-of-pleasure]
gb|EMT32230.1|  Peptide transporter PTR2                                184   2e-51   
ref|XP_007133765.1|  hypothetical protein PHAVU_011G207100g             187   2e-51   Phaseolus vulgaris [French bean]
ref|XP_010521166.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      187   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_009593536.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      187   2e-51   Nicotiana tomentosiformis
ref|XP_009127904.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12           186   3e-51   Brassica rapa
ref|XP_010428067.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    186   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010272857.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      186   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_006403574.1|  hypothetical protein EUTSA_v10010667mg             178   3e-51   
ref|XP_010534099.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           186   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_004511030.1|  PREDICTED: probable peptide/nitrate transpor...    186   4e-51   Cicer arietinum [garbanzo]
ref|XP_011096252.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      186   4e-51   Sesamum indicum [beniseed]
emb|CDY03656.1|  BnaA02g15810D                                          186   4e-51   
ref|XP_009362428.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      186   5e-51   Pyrus x bretschneideri [bai li]
ref|NP_177357.2|  putative peptide/nitrate transporter                  186   6e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82183.1|  BnaC02g21070D                                          185   6e-51   
gb|AAL57662.1|  At1g72120/F28P5_2                                       185   6e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAN63511.1|  hypothetical protein VITISV_031692                     185   6e-51   Vitis vinifera
gb|ERM97848.1|  hypothetical protein AMTR_s00118p00128710               178   7e-51   Amborella trichopoda
ref|XP_009362432.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      185   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_009104872.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      184   8e-51   Brassica rapa
gb|AAG51788.1|AC067754_4  peptide transporter PTR2-B, putative; 1...    187   9e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783395.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      185   1e-50   Phoenix dactylifera
gb|KHG19841.1|  hypothetical protein F383_03296                         185   1e-50   Gossypium arboreum [tree cotton]
ref|XP_009593533.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      185   1e-50   Nicotiana tomentosiformis
ref|XP_006387190.1|  hypothetical protein POPTR_1576s00200g             178   1e-50   
dbj|BAD82718.1|  oligopeptide transporter-like protein                  179   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006376230.1|  hypothetical protein POPTR_0013s11170g             183   1e-50   
gb|EYU22787.1|  hypothetical protein MIMGU_mgv1a003626mg                184   1e-50   Erythranthe guttata [common monkey flower]
gb|KHN37667.1|  Putative peptide/nitrate transporter                    184   2e-50   Glycine soja [wild soybean]
emb|CBI39325.3|  unnamed protein product                                190   2e-50   Vitis vinifera
ref|XP_010418901.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      184   2e-50   
ref|XP_010095905.1|  putative peptide/nitrate transporter               184   2e-50   
emb|CDX68281.1|  BnaA07g23210D                                          184   2e-50   
ref|XP_009104873.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      184   2e-50   Brassica rapa
ref|XP_007131295.1|  hypothetical protein PHAVU_011G001900g             184   2e-50   Phaseolus vulgaris [French bean]
ref|XP_007131296.1|  hypothetical protein PHAVU_011G002000g             184   2e-50   Phaseolus vulgaris [French bean]
ref|XP_006302093.1|  hypothetical protein CARUB_v10020083mg             184   3e-50   Capsella rubella
ref|NP_974431.2|  probable peptide/nitrate transporter                  184   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542826.1|  PREDICTED: probable peptide/nitrate transpor...    184   3e-50   Glycine max [soybeans]
gb|KFK41632.1|  hypothetical protein AALP_AA2G152900                    178   4e-50   Arabis alpina [alpine rockcress]
dbj|BAJ86454.1|  predicted protein                                      183   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010427147.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       183   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_012075471.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      183   5e-50   Jatropha curcas
ref|XP_002266023.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           183   5e-50   Vitis vinifera
ref|XP_010665401.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      183   6e-50   Vitis vinifera
ref|XP_008339153.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    184   6e-50   
dbj|BAE99752.1|  oligopeptide like transporter                          180   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002265992.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      183   6e-50   Vitis vinifera
gb|ABR17733.1|  unknown                                                 183   7e-50   Picea sitchensis
gb|KHG04630.1|  hypothetical protein F383_29596                         183   7e-50   Gossypium arboreum [tree cotton]
gb|KHF99635.1|  hypothetical protein F383_18770                         183   7e-50   Gossypium arboreum [tree cotton]
gb|EYU28220.1|  hypothetical protein MIMGU_mgv1a020668mg                182   8e-50   Erythranthe guttata [common monkey flower]
ref|XP_007020112.1|  Major facilitator superfamily protein              182   8e-50   
ref|XP_009104871.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      182   9e-50   Brassica rapa
emb|CBI39329.3|  unnamed protein product                                182   1e-49   Vitis vinifera
emb|CDM85180.1|  unnamed protein product                                182   1e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010521163.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      182   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_007020110.1|  Major facilitator superfamily protein              182   1e-49   
ref|XP_008246054.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       182   1e-49   Prunus mume [ume]
ref|XP_008437711.1|  PREDICTED: uncharacterized protein LOC103483057    186   1e-49   
ref|XP_006850438.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            182   1e-49   Amborella trichopoda
ref|XP_007020108.1|  Major facilitator superfamily protein, putat...    186   1e-49   
emb|CBI39331.3|  unnamed protein product                                186   1e-49   Vitis vinifera
gb|ABK24896.1|  unknown                                                 182   2e-49   Picea sitchensis
ref|XP_010665459.1|  PREDICTED: uncharacterized protein LOC100854586    185   2e-49   
ref|XP_009104876.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      181   2e-49   Brassica rapa
ref|XP_004514886.1|  PREDICTED: probable peptide/nitrate transpor...    181   2e-49   Cicer arietinum [garbanzo]
ref|XP_002297740.2|  hypothetical protein POPTR_0001s06440g             182   2e-49   Populus trichocarpa [western balsam poplar]
emb|CDP10687.1|  unnamed protein product                                182   2e-49   Coffea canephora [robusta coffee]
ref|XP_002456710.1|  hypothetical protein SORBIDRAFT_03g041190          181   2e-49   
emb|CDY58920.1|  BnaCnng33940D                                          181   2e-49   Brassica napus [oilseed rape]
ref|XP_002304796.2|  hypothetical protein POPTR_0003s19700g             175   2e-49   
gb|AAG51131.1|AC069273_2  oligopeptide transporter, putative            183   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515972.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            181   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009361960.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       181   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_010504249.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            181   3e-49   Camelina sativa [gold-of-pleasure]
gb|KFK40118.1|  hypothetical protein AALP_AA3G332900                    181   3e-49   Arabis alpina [alpine rockcress]
gb|KFK40119.1|  hypothetical protein AALP_AA3G332900                    181   4e-49   Arabis alpina [alpine rockcress]
ref|XP_003540022.1|  PREDICTED: probable peptide/nitrate transpor...    181   4e-49   Glycine max [soybeans]
ref|XP_006420719.1|  hypothetical protein CICLE_v10006572mg             181   4e-49   
ref|XP_008437003.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      181   4e-49   Cucumis melo [Oriental melon]
ref|NP_001117585.1|  putative peptide/nitrate transporter               181   4e-49   
ref|XP_006470865.1|  PREDICTED: probable peptide/nitrate transpor...    181   4e-49   
gb|KFK41633.1|  hypothetical protein AALP_AA2G153000                    184   5e-49   
ref|XP_002456711.1|  hypothetical protein SORBIDRAFT_03g041200          180   5e-49   
ref|XP_007220562.1|  hypothetical protein PRUPE_ppa003298mg             181   5e-49   
ref|XP_010665403.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      180   7e-49   
ref|XP_003627833.1|  Peptide transporter PTR1                           180   8e-49   
emb|CDP10685.1|  unnamed protein product                                178   8e-49   
ref|XP_003598531.1|  Peptide transporter PTR5                           180   8e-49   
ref|XP_007011003.1|  Major facilitator superfamily protein              180   8e-49   
ref|XP_002521809.1|  oligopeptide transporter, putative                 183   8e-49   
gb|KJB29709.1|  hypothetical protein B456_005G116000                    178   8e-49   
gb|KEH29312.1|  proton-dependent oligopeptide transport family pr...    179   9e-49   
ref|XP_010233562.1|  PREDICTED: uncharacterized protein LOC100831418    184   9e-49   
gb|KJB74997.1|  hypothetical protein B456_012G017800                    180   1e-48   
emb|CAN63512.1|  hypothetical protein VITISV_031693                     180   1e-48   
dbj|BAK01134.1|  predicted protein                                      177   1e-48   
ref|XP_002876254.1|  hypothetical protein ARALYDRAFT_348537             179   1e-48   
emb|CDY58918.1|  BnaCnng33930D                                          179   1e-48   
ref|XP_001784091.1|  predicted protein                                  180   1e-48   
ref|XP_011464749.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    179   1e-48   
ref|XP_011000563.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       179   1e-48   
ref|XP_010521165.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      179   1e-48   
ref|XP_003546719.1|  PREDICTED: probable peptide/nitrate transpor...    179   1e-48   
ref|XP_006390699.1|  hypothetical protein EUTSA_v10019829mg             178   2e-48   
ref|XP_009621141.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       179   2e-48   
ref|XP_006434673.1|  hypothetical protein CICLE_v10000719mg             179   2e-48   
gb|KJB29710.1|  hypothetical protein B456_005G116000                    178   2e-48   
ref|XP_004301425.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    179   2e-48   
ref|XP_010428072.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-like      178   2e-48   
ref|XP_008437001.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      179   2e-48   
dbj|BAB86548.1|  OSJNBb0008G24.20                                       178   2e-48   
ref|XP_008459724.1|  PREDICTED: uncharacterized protein LOC103498766    182   2e-48   
ref|XP_011464752.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      178   3e-48   
gb|EAY76648.1|  hypothetical protein OsI_04604                          178   3e-48   
gb|KHG09768.1|  hypothetical protein F383_13158                         179   3e-48   
gb|EMT00830.1|  Peptide transporter PTR2                                178   3e-48   
gb|AAK32755.1|AF361587_1  AT3g53960/F5K20_260                           173   3e-48   
ref|XP_010428076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      178   3e-48   
gb|AFW78190.1|  hypothetical protein ZEAMMB73_551902                    178   3e-48   
ref|NP_001044939.2|  Os01g0871600                                       177   3e-48   
ref|XP_002887413.1|  proton-dependent oligopeptide transport fami...    182   3e-48   
ref|XP_002887416.1|  proton-dependent oligopeptide transport fami...    177   3e-48   
dbj|BAB86542.1|  OSJNBb0008G24.12                                       178   3e-48   
gb|ACL52999.1|  unknown                                                 178   3e-48   
ref|XP_011464753.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      178   3e-48   
gb|KJB73105.1|  hypothetical protein B456_011G215200                    178   3e-48   
ref|XP_006390695.1|  hypothetical protein EUTSA_v10018388mg             177   4e-48   
ref|XP_011656123.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      178   4e-48   
ref|XP_009782735.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      178   4e-48   
ref|XP_006292507.1|  hypothetical protein CARUB_v10018737mg             177   4e-48   
ref|XP_002513061.1|  Peptide transporter, putative                      178   4e-48   
ref|XP_008375319.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            178   4e-48   
gb|ABR17798.1|  unknown                                                 175   4e-48   
ref|XP_012069210.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    178   4e-48   
gb|AGT17133.1|  peptide/nitrate transporter                             177   5e-48   
gb|AGT17393.1|  hypothetical protein SHCRBa_189_K21_R_20                177   5e-48   
gb|KDP40528.1|  hypothetical protein JCGZ_24527                         178   5e-48   
dbj|BAK03342.1|  predicted protein                                      177   5e-48   
ref|XP_010428075.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      177   5e-48   
ref|XP_009363640.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       177   5e-48   
gb|KJB29708.1|  hypothetical protein B456_005G116000                    178   5e-48   
ref|XP_009771569.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       178   5e-48   
ref|XP_002444787.1|  hypothetical protein SORBIDRAFT_07g028040          177   6e-48   
ref|XP_009116130.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            177   6e-48   
ref|XP_006339008.1|  PREDICTED: probable peptide/nitrate transpor...    177   6e-48   
emb|CDY66692.1|  BnaC04g53060D                                          177   7e-48   
ref|XP_008245631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       177   7e-48   
emb|CDM85179.1|  unnamed protein product                                177   7e-48   
ref|XP_009104877.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      177   7e-48   
gb|ABR32185.1|  peptide transporter                                     177   7e-48   
ref|XP_011629429.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           177   7e-48   
ref|XP_006473248.1|  PREDICTED: probable peptide/nitrate transpor...    177   8e-48   
emb|CDX78237.1|  BnaA09g34320D                                          177   8e-48   
gb|AAG51133.1|AC069273_4  oligopeptide transporter, putative            181   8e-48   
ref|XP_009415773.1|  PREDICTED: uncharacterized protein LOC103996574    180   8e-48   
gb|KCW69569.1|  hypothetical protein EUGRSUZ_F02995                     174   1e-47   
dbj|BAK07796.1|  predicted protein                                      175   1e-47   
ref|XP_006390700.1|  hypothetical protein EUTSA_v10018035mg             180   1e-47   
ref|XP_011031497.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      176   1e-47   
ref|XP_002325970.2|  proton-dependent oligopeptide transport fami...    177   1e-47   
ref|XP_008781528.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      176   2e-47   
gb|KFK41627.1|  hypothetical protein AALP_AA2G152300                    176   2e-47   
ref|XP_008375473.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       173   2e-47   
ref|XP_010272859.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      176   2e-47   
gb|EEC71883.1|  hypothetical protein OsI_04614                          176   2e-47   
ref|XP_006376224.1|  hypothetical protein POPTR_0013s11100g             176   3e-47   
ref|XP_009357420.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       176   3e-47   
ref|XP_007218088.1|  hypothetical protein PRUPE_ppa006469mg             173   3e-47   
ref|XP_010256764.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            176   3e-47   
ref|NP_001147980.1|  LOC100281589                                       176   3e-47   
ref|XP_011656158.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      178   3e-47   
gb|EMT03675.1|  Peptide transporter PTR2                                173   3e-47   
ref|XP_009127903.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    172   3e-47   
ref|NP_001055628.2|  Os05g0431700                                       169   3e-47   
gb|KFK41628.1|  hypothetical protein AALP_AA2G152500                    175   4e-47   
ref|XP_008339154.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    176   4e-47   
dbj|BAJ94112.1|  predicted protein                                      175   4e-47   
tpg|DAA56612.1|  TPA: hypothetical protein ZEAMMB73_385814              174   4e-47   
gb|EYU22786.1|  hypothetical protein MIMGU_mgv11b021031mg               174   5e-47   
emb|CBI39330.3|  unnamed protein product                                175   5e-47   
ref|XP_002319378.2|  hypothetical protein POPTR_0013s11110g             175   5e-47   
ref|XP_010269378.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    175   6e-47   
ref|XP_010062427.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      174   6e-47   
ref|XP_006339007.1|  PREDICTED: probable peptide/nitrate transpor...    175   7e-47   
emb|CDX68280.1|  BnaA07g23200D                                          174   7e-47   
ref|XP_010269377.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    174   7e-47   
ref|XP_007020107.1|  Major facilitator superfamily protein isoform 2    174   7e-47   
ref|XP_011096129.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      174   7e-47   
ref|XP_010312293.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       174   7e-47   
ref|XP_009104874.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      174   8e-47   
ref|XP_007020106.1|  Major facilitator superfamily protein isoform 1    174   8e-47   
gb|ABR32184.1|  peptide transporter                                     174   8e-47   
ref|XP_010276617.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       174   9e-47   
ref|XP_010532218.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            174   1e-46   
ref|XP_011020391.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            174   1e-46   
ref|XP_009799129.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       174   1e-46   
gb|EMT01235.1|  Peptide transporter PTR2                                172   1e-46   
ref|XP_008343637.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like       174   1e-46   
ref|XP_008375318.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       172   1e-46   
ref|XP_011654841.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    172   1e-46   
ref|XP_010251739.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       173   2e-46   
ref|XP_010911915.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    175   2e-46   
gb|KFK34685.1|  hypothetical protein AALP_AA5G178100                    166   2e-46   
ref|XP_008233850.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            174   2e-46   
ref|XP_010088558.1|  Putative peptide/nitrate transporter               173   2e-46   
ref|XP_007220558.1|  hypothetical protein PRUPE_ppa003244mg             173   2e-46   
ref|XP_009127902.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    172   2e-46   
emb|CDY12523.1|  BnaC07g13630D                                          173   2e-46   
ref|XP_011654839.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    173   2e-46   
ref|XP_010312294.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       173   3e-46   
gb|KEH23046.1|  peptide/nitrate transporter plant                       172   3e-46   
ref|XP_010665396.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      172   3e-46   
ref|XP_009363836.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like       173   3e-46   
emb|CDY03659.1|  BnaA02g15780D                                          172   3e-46   
ref|XP_009127900.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    171   3e-46   
ref|XP_008339202.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      172   4e-46   
ref|XP_009361961.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       172   4e-46   
emb|CDX96376.1|  BnaA07g29870D                                          172   4e-46   
ref|XP_002441154.1|  hypothetical protein SORBIDRAFT_09g021330          172   4e-46   
ref|XP_009369254.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    172   5e-46   
ref|XP_007218954.1|  hypothetical protein PRUPE_ppa003507mg             172   5e-46   
ref|XP_009620626.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            172   5e-46   
ref|XP_009127898.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    171   5e-46   
ref|XP_010515906.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    172   5e-46   
ref|XP_008369322.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            172   6e-46   
ref|XP_008347002.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       170   6e-46   
ref|XP_010515905.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    172   6e-46   
ref|XP_003623153.1|  Peptide transporter PTR3-B                         172   6e-46   
ref|XP_006645088.1|  PREDICTED: probable peptide/nitrate transpor...    170   7e-46   
ref|XP_002877949.1|  proton-dependent oligopeptide transport fami...    172   8e-46   
ref|XP_010505782.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like...    171   8e-46   
ref|XP_011031498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      171   9e-46   
ref|XP_011654838.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      171   9e-46   
ref|XP_010504184.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       172   9e-46   
gb|KFK41630.1|  hypothetical protein AALP_AA2G152700                    175   1e-45   
emb|CDY25743.1|  BnaA07g10390D                                          171   1e-45   
ref|XP_006376229.1|  proton-dependent oligopeptide transport fami...    171   1e-45   
ref|NP_190964.2|  probable peptide/nitrate transporter                  171   1e-45   
ref|XP_010505781.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1-like...    171   1e-45   
emb|CAB88358.1|  transporter-like protein                               172   1e-45   
ref|XP_010665398.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      171   1e-45   
dbj|BAJ96362.1|  predicted protein                                      171   1e-45   
ref|XP_010508858.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...    171   1e-45   
emb|CDY65668.1|  BnaCnng48110D                                          170   1e-45   
ref|XP_011001079.1|  PREDICTED: uncharacterized protein LOC105108458    174   1e-45   
ref|XP_004308589.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       171   1e-45   
ref|XP_010419160.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      171   2e-45   
ref|XP_010095893.1|  putative peptide/nitrate transporter               171   2e-45   
ref|XP_010415943.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    171   2e-45   
gb|EMT01236.1|  Peptide transporter PTR1                                171   2e-45   
ref|XP_004963750.1|  PREDICTED: uncharacterized protein LOC101758083    174   2e-45   
ref|XP_008785490.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       171   2e-45   
gb|AAT47044.1|  hypothetical protein                                    169   2e-45   
ref|XP_010508857.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1 isof...    171   2e-45   
ref|XP_009590467.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       171   2e-45   
ref|XP_006340981.1|  PREDICTED: probable peptide/nitrate transpor...    171   2e-45   
ref|XP_004970733.1|  PREDICTED: probable peptide/nitrate transpor...    170   2e-45   
ref|XP_011036947.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       171   2e-45   
ref|XP_009361962.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       170   2e-45   
ref|XP_006434674.1|  hypothetical protein CICLE_v10000738mg             170   2e-45   
gb|ACN26535.1|  unknown                                                 166   3e-45   
ref|XP_002879871.1|  predicted protein                                  170   3e-45   
gb|KEH28963.1|  peptide/nitrate transporter plant                       170   3e-45   
ref|XP_004506379.1|  PREDICTED: probable peptide/nitrate transpor...    170   3e-45   
ref|XP_009772498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       170   3e-45   
ref|XP_007140460.1|  hypothetical protein PHAVU_008G114200g             170   3e-45   
ref|XP_009103231.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.16-like      170   3e-45   
emb|CDY58917.1|  BnaCnng33920D                                          169   4e-45   
ref|XP_002972300.1|  hypothetical protein SELMODRAFT_97069              169   4e-45   
ref|XP_009380625.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    170   4e-45   
gb|KFK36927.1|  hypothetical protein AALP_AA4G190800                    170   4e-45   
ref|XP_010504182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7            170   4e-45   
gb|KHN05104.1|  Putative peptide/nitrate transporter                    169   4e-45   
ref|XP_008781659.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    172   4e-45   
ref|XP_011656159.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      169   4e-45   
ref|XP_006602614.1|  PREDICTED: putative peptide/nitrate transpor...    170   4e-45   
ref|XP_010515904.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       170   5e-45   
ref|XP_006293896.1|  hypothetical protein CARUB_v10022889mg             169   5e-45   
gb|KHN06992.1|  Putative peptide/nitrate transporter                    169   5e-45   
gb|ACF84448.1|  unknown                                                 167   6e-45   
ref|XP_003529111.1|  PREDICTED: putative peptide/nitrate transpor...    169   6e-45   
gb|KHN22623.1|  Putative peptide/nitrate transporter                    166   6e-45   
gb|KDO84009.1|  hypothetical protein CISIN_1g008632mg                   167   6e-45   
gb|KCW69566.1|  hypothetical protein EUGRSUZ_F02995                     169   6e-45   
gb|KCW69567.1|  hypothetical protein EUGRSUZ_F02995                     169   7e-45   
ref|XP_010427058.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       169   7e-45   
ref|XP_010062426.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      169   7e-45   
ref|XP_006843060.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           169   7e-45   
ref|XP_008231698.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       169   7e-45   
ref|XP_011083317.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       169   8e-45   
gb|ACR38185.1|  unknown                                                 167   9e-45   
ref|XP_006411309.1|  hypothetical protein EUTSA_v10016426mg             169   9e-45   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176             169   9e-45   
ref|XP_006829376.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            169   9e-45   
ref|XP_004516135.1|  PREDICTED: probable peptide/nitrate transpor...    169   9e-45   
emb|CDY07568.1|  BnaC06g14960D                                          169   1e-44   
gb|EYU22785.1|  hypothetical protein MIMGU_mgv1a004125mg                168   1e-44   
ref|XP_004507202.1|  PREDICTED: probable peptide/nitrate transpor...    169   1e-44   
ref|XP_002984211.1|  hypothetical protein SELMODRAFT_119838             168   1e-44   
ref|XP_001781231.1|  predicted protein                                  169   1e-44   



>ref|XP_009758756.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Nicotiana sylvestris]
 ref|XP_009758757.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Nicotiana sylvestris]
Length=538

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 182/207 (88%), Gaps = 1/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TMKR+IG NF+IPPAALQS+IT+SIILLMPLYD +FIP VRVFT N+KG+TV QR
Sbjct  325  TKQGVTMKRNIGNNFRIPPAALQSSITISIILLMPLYDTFFIPFVRVFTRNEKGITVMQR  384

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLSVIAM+IAA T+ KRL+ISRN    SSETVPMSIFWLLPQYILLGISDIFTVV
Sbjct  385  MGIGMFLSVIAMIIAAVTERKRLDISRNLVT-SSETVPMSIFWLLPQYILLGISDIFTVV  443

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP NMRTLGIALYTSVFG GSFFSS LIS++E+ TS+   +  WFSDDM++
Sbjct  444  GMQEFFYSEVPTNMRTLGIALYTSVFGCGSFFSSFLISVIENLTSTRGAKQNWFSDDMRK  503

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            AR DNYYWFLA+ SA S  LF++FC+F
Sbjct  504  ARFDNYYWFLALSSAASFLLFMVFCRF  530



>ref|XP_009615220.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Nicotiana tomentosiformis]
Length=538

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TMKR+IG NF+IPPAALQS+IT+SIILLMPLYD +FIP VRVFT N+KG+TV QR
Sbjct  325  TKQGVTMKRNIGNNFRIPPAALQSSITISIILLMPLYDTFFIPFVRVFTRNEKGITVMQR  384

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLSVIAM+IAA T+ KRLEISRN    SSETVPMSIFWLLPQYILLGISDIFTVV
Sbjct  385  MGIGMFLSVIAMIIAAVTERKRLEISRNLVT-SSETVPMSIFWLLPQYILLGISDIFTVV  443

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP NMRTLGIALYTSVFG GSFFSS LIS++E  TS+   +  WF+DDM++
Sbjct  444  GMQEFFYSEVPINMRTLGIALYTSVFGCGSFFSSFLISVIEKLTSTRGAKQNWFADDMRK  503

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            AR DNYYWFLA+ SA S  LF++FC+F
Sbjct  504  ARFDNYYWFLALSSAASFLLFMVFCRF  530



>ref|XP_006338515.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Solanum tuberosum]
Length=534

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 179/209 (86%), Gaps = 2/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM R+IG NF+IPPAALQS+IT+SIILLMPLYD  FIP +RV T N+KG+TV QR
Sbjct  319  TKQGMTMTRNIGSNFRIPPAALQSSITISIILLMPLYDTCFIPFIRVLTRNEKGITVMQR  378

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMFLSVIAM+IAA T+ KRL+I+RN   L+S  E +PMSIFWLLPQYILLGISDIFT
Sbjct  379  MGIGMFLSVIAMIIAAVTERKRLDIARNLATLTSEFEALPMSIFWLLPQYILLGISDIFT  438

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP NMRTLGIALYTSVFG GSFFSS LI+++EH TSS   +  WF+DDM
Sbjct  439  VVGMQEFFYSEVPINMRTLGIALYTSVFGCGSFFSSFLITVIEHLTSSIGEKQNWFADDM  498

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             +ARLDNYYWFLA+ SA S  +F++FC+F
Sbjct  499  SKARLDNYYWFLALSSATSFLMFMVFCRF  527



>ref|XP_004232263.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Solanum lycopersicum]
 ref|XP_010316272.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Solanum lycopersicum]
 ref|XP_010316273.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Solanum lycopersicum]
Length=537

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 179/209 (86%), Gaps = 2/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG +F+IPPAALQS+IT+SIILLMPLYD  FIP +RV T N+KG+TV QR
Sbjct  322  TKQGMTMRRNIGSSFRIPPAALQSSITISIILLMPLYDTCFIPFIRVLTRNEKGITVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMFLSVIAM+IAA T+ KRL+I+RN   L+S  E +PMSIFWLLPQYILLGISDIFT
Sbjct  382  MGIGMFLSVIAMIIAAVTERKRLDIARNVGTLTSEFEALPMSIFWLLPQYILLGISDIFT  441

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP NMRTLGIALYTSVFG GSFFSS LI+++EH TSS   +  WF+DDM
Sbjct  442  VVGMQEFFYSEVPINMRTLGIALYTSVFGCGSFFSSFLITVIEHLTSSIGEKQNWFADDM  501

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
              ARLDNYYWFLA+ SA S  +F++FC+F
Sbjct  502  SRARLDNYYWFLALSSAASFMMFMVFCRF  530



>emb|CDP02164.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 177/212 (83%), Gaps = 2/212 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG  FKIPPAALQSAITVSIILLMPLYD  FIPL R+ T N+KG++V QR
Sbjct  321  TKQGMTMKRNIGSKFKIPPAALQSAITVSIILLMPLYDILFIPLTRILTQNEKGISVIQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRN--PENLSSETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMFLSVIAMV AA T+ KRLE+SR     +L SETVP+SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFLSVIAMVTAALTERKRLELSRQMVASDLPSETVPLSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP   RT+GIALYTSVFG GSF S+LLIS+VE FTSS   ++ WF+DDM
Sbjct  441  VVGMQEFFYSEVPLRFRTMGIALYTSVFGVGSFLSALLISLVECFTSSGGRENSWFNDDM  500

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKFNGS  119
            + +RLD+YYW LA+L +VS   FVIF +F+ S
Sbjct  501  RNSRLDSYYWLLAILDSVSFVGFVIFFRFHKS  532



>gb|KJB33723.1| hypothetical protein B456_006G027600 [Gossypium raimondii]
 gb|KJB33724.1| hypothetical protein B456_006G027600 [Gossypium raimondii]
Length=542

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAIT+SIILLMPLYDK FIP+ ++ T N+KG++V QR
Sbjct  324  TKQGMTMKRNIGKNFKIPPATLQSAITLSIILLMPLYDKVFIPITKMVTRNEKGISVMQR  383

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GMFLSVIAM+IAA  +TKRLEISR      SETVP+SIFWLLPQY+LLGISDIFTVV
Sbjct  384  MGVGMFLSVIAMIIAAVVETKRLEISRETGVQESETVPLSIFWLLPQYVLLGISDIFTVV  443

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+IS++E FT SS  +H WFSDDM+E
Sbjct  444  GMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALMISVIEAFT-SSGGRHSWFSDDMRE  502

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
             RLD  YW LA+ SA+SL  + I CK
Sbjct  503  DRLDKLYWLLAIASALSLLFYAICCK  528



>ref|XP_011098534.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Sesamum indicum]
Length=528

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG  FKIPPAALQSAITVSII+LMP YD +FIPL+R  T N+KG++V QR
Sbjct  318  TKQGMTMKRNIGSKFKIPPAALQSAITVSIIILMPWYDMFFIPLIRNITRNEKGISVMQR  377

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLSVIAM+IAA T+ +RLEI RN + +SSE VP SIFWLLPQYILLGISDIFTVV
Sbjct  378  MGIGMFLSVIAMIIAAITERRRLEIGRNMK-VSSEDVPFSIFWLLPQYILLGISDIFTVV  436

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP  MRT+GIALYTSVFG GSF S+ LIS++E+ TSS   Q  WFSDDM +
Sbjct  437  GMQEFFYSEVPVRMRTMGIALYTSVFGVGSFLSAFLISVIEYLTSSRGKQDSWFSDDMTK  496

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLD YYWFLA+ S++SL  FV FC++
Sbjct  497  ARLDKYYWFLALSSSISLLAFVTFCRY  523



>gb|EYU44688.1| hypothetical protein MIMGU_mgv1a026051mg, partial [Erythranthe 
guttata]
Length=262

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 170/208 (82%), Gaps = 6/208 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGP-NFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQ  572
            TKQGM MKR+IG   F+IPPAALQS+ITVSII+LMP YD +F+PLVR+FT N+KG++V Q
Sbjct  55   TKQGMAMKRNIGNFKFEIPPAALQSSITVSIIVLMPWYDTFFVPLVRIFTRNEKGISVMQ  114

Query  571  RMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            RMGIGMFLSVIAM+IAA T+ KR+EI +N     +    +SI+WLLPQYILLGISDIFTV
Sbjct  115  RMGIGMFLSVIAMIIAAITEQKRMEIGKN-----NGQELLSIYWLLPQYILLGISDIFTV  169

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQE+FYSEVP  MRT+GIALYTS+FG GSF S+LLIS++E  T+S      WFSDDM 
Sbjct  170  VGMQEYFYSEVPVRMRTMGIALYTSIFGVGSFLSALLISVIECLTTSKETYDNWFSDDMS  229

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            +ARLD YYWFLA  SA+SL  FVIFC+F
Sbjct  230  KARLDKYYWFLAFTSAISLLAFVIFCRF  257



>ref|XP_008353485.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like, partial [Malus 
domestica]
Length=481

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 169/214 (79%), Gaps = 3/214 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAIT+SIILLMPLYDK  IP+ R+ T ++KG++V QR
Sbjct  259  TKQGMTMKRNIGSNFKIPPATLQSAITLSIILLMPLYDKIMIPITRLVTCSEKGISVMQR  318

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAM IAA  +TKRL+ISR  E     SETVP+SIFWLLPQYILLGISDIFT
Sbjct  319  MGIGMFVSVIAMAIAAVVETKRLKISREMEMRGSQSETVPLSIFWLLPQYILLGISDIFT  378

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP  MRT+  ALYTSVFG GS+ S+ LI+ VE  TSS   Q  WFSDDM
Sbjct  379  VVGMQEFFYSEVPGRMRTMAFALYTSVFGVGSYLSTFLIATVEAVTSSEGRQS-WFSDDM  437

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKFNGS*K  113
             EARLD YYWFLA LSA+S   +VI   F  S K
Sbjct  438  GEARLDKYYWFLASLSALSFVFYVILSTFYTSKK  471



>ref|XP_010492315.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Camelina sativa]
Length=550

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  T N+KG++V +R
Sbjct  331  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPIAKKLTKNEKGISVMER  390

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL IS+  +  S +  PMSI WLLPQYILLGISDIFTVV
Sbjct  391  MGIGMFLSIIAIVIAALVERKRLRISKMMKT-SPDPDPMSILWLLPQYILLGISDIFTVV  449

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LIS++E +TSSS  +H WF+DDM E
Sbjct  450  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISVIESYTSSSGGKHNWFADDMSE  509

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  +++I CK
Sbjct  510  ARLDNYYWLLAFTSAISFLMYIIICK  535



>ref|XP_008341498.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Malus domestica]
Length=543

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 169/214 (79%), Gaps = 3/214 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAIT+SIILLMPLYDK  IP+ R+ T ++KG++V QR
Sbjct  321  TKQGMTMKRNIGSNFKIPPATLQSAITLSIILLMPLYDKIMIPITRLVTCSEKGISVMQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAM IAA  +TKRL+ISR  E     SETVP+SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFVSVIAMAIAAVVETKRLKISREMEMRGSQSETVPLSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP  MRT+  ALYTSVFG GS+ S+ LI+ VE  TSS   Q  WFSDDM
Sbjct  441  VVGMQEFFYSEVPGRMRTMAFALYTSVFGVGSYLSTFLIATVEAVTSSEGRQS-WFSDDM  499

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKFNGS*K  113
             EARLD YYWFLA LSA+S   +VI   F  S K
Sbjct  500  GEARLDKYYWFLASLSALSFVFYVILSTFYTSKK  533



>ref|XP_009121620.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Brassica rapa]
Length=562

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 167/207 (81%), Gaps = 0/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  + N+KG+TV  R
Sbjct  340  TKQGMAMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPMAKKISKNEKGITVMTR  399

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL+IS+  +   +   P+SIFWLLPQYILLGISDIFTVV
Sbjct  400  MGIGMFLSIIAIVIAALVERKRLKISKEMKTSPNSLEPLSIFWLLPQYILLGISDIFTVV  459

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS++E +T S   +H WF+DDM E
Sbjct  460  GMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVIETYTKSRGGEHNWFADDMSE  519

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLDNYYW LA+ SA+S  ++++ CK+
Sbjct  520  ARLDNYYWLLALTSAISFLMYIVICKY  546



>ref|XP_009335771.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Pyrus x bretschneideri]
Length=543

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 169/208 (81%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFK+PPA LQSAIT+SIILLMPLYDK  IP+ R+ T N+KG++V QR
Sbjct  321  TKQGMTMKRNIGSNFKVPPATLQSAITLSIILLMPLYDKIMIPITRLVTSNEKGISVMQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAMVIAA  +TKRL+ISR  E L S  ETVP SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFVSVIAMVIAAVVETKRLKISREMEMLGSQPETVPFSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFYSEVP  MRT+  ALYTSVFG GS+ S+LLI+ VE  TSS   Q  WFSDDM
Sbjct  441  VVGIQEFFYSEVPRRMRTMAFALYTSVFGVGSYMSTLLIATVEAVTSSGGRQS-WFSDDM  499

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             EARLD YYWFLA LSA+S   +VI  +
Sbjct  500  NEARLDKYYWFLASLSALSFVFYVILSR  527



>emb|CDY65044.1| BnaA10g29780D [Brassica napus]
Length=558

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 167/207 (81%), Gaps = 0/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  + N+KG+TV  R
Sbjct  336  TKQGMAMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPMAKKISKNEKGITVMTR  395

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL+IS+  +   +   P+SIFWLLPQYILLGISDIFTVV
Sbjct  396  MGIGMFLSIIAIVIAALVERKRLKISKEMKTSPNSLEPLSIFWLLPQYILLGISDIFTVV  455

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS++E +T S   +H WF+DDM E
Sbjct  456  GMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVIETYTKSRGGEHNWFADDMSE  515

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLDNYYW LA+ SA+S  ++++ CK+
Sbjct  516  ARLDNYYWLLALTSAISFLMYIVICKY  542



>ref|XP_012082355.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Jatropha curcas]
 gb|KDP45420.1| hypothetical protein JCGZ_09669 [Jatropha curcas]
Length=538

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 172/207 (83%), Gaps = 3/207 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+R+IG NFKIPPA LQSAITVSIILLMP YD  FIP+ R+ T ++KG+ V QR
Sbjct  322  TKQGVTMERTIGSNFKIPPATLQSAITVSIILLMPFYDTIFIPITRIITRDEKGINVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IAMVIAA  + KRLE+ +   N  SETVP+SIFWLLPQYILLGISDIFTVV
Sbjct  382  MGIGMFLSIIAMVIAALVEMKRLEMIQKMPN--SETVPISIFWLLPQYILLGISDIFTVV  439

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP+ M+T+GIAL TSVFG GSF S+ LI+++E FTSS   +  WFSDDMKE
Sbjct  440  GMQEFFYSEVPSRMKTMGIALNTSVFGVGSFVSAFLITLIEIFTSSRGKKS-WFSDDMKE  498

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLD YYW LA+LSAVS+  +V+ C+F
Sbjct  499  ARLDKYYWLLAILSAVSMFFYVVLCRF  525



>gb|KHG28522.1| hypothetical protein F383_09980 [Gossypium arboreum]
Length=542

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF IPPA LQSAIT+SIILLMPLYDK FIP+ ++ T N+KG++V QR
Sbjct  324  TKQGMTMKRNIGKNFMIPPATLQSAITLSIILLMPLYDKVFIPITKMVTRNEKGISVMQR  383

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GMFLSVIAM+IAA  +TKRLEISR      SETVP+SIFWLLPQY+LLGISDIFTVV
Sbjct  384  MGVGMFLSVIAMIIAAVVETKRLEISRETGVQESETVPLSIFWLLPQYVLLGISDIFTVV  443

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+IS++E FTSS   Q  WFSDDM+E
Sbjct  444  GMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALMISVIEAFTSSGGRQS-WFSDDMRE  502

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
             RLD  Y  LA+ SA+SL  + I CK
Sbjct  503  DRLDKLYCLLAIASALSLLFYAICCK  528



>ref|XP_010420140.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Camelina sativa]
Length=550

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  T N+KG++V +R
Sbjct  331  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPIAKKLTKNEKGISVMER  390

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL IS+  +  S +  PMSI WLLPQYILLGISDIFTVV
Sbjct  391  MGIGMFLSIIAIVIAALVERKRLRISKMMKT-SPDPDPMSILWLLPQYILLGISDIFTVV  449

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LIS++E +TSS   +H WF+DDM E
Sbjct  450  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISVIESYTSSRGGKHNWFADDMSE  509

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  +++I CK
Sbjct  510  ARLDNYYWLLAFTSAISFLMYIIICK  535



>ref|XP_010453622.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Camelina sativa]
Length=550

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +    N+KG++V +R
Sbjct  331  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPIAKKLAKNEKGISVMER  390

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL IS+  +  S +  PMSI WLLPQYILLGISDIFTVV
Sbjct  391  MGIGMFLSIIAIVIAALVERKRLSISKMMKT-SPDPDPMSILWLLPQYILLGISDIFTVV  449

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LIS++E +TSS   +H WF+DDM E
Sbjct  450  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISVIESYTSSRGGKHNWFADDMSE  509

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  +++I CK
Sbjct  510  ARLDNYYWLLAFTSAISFLMYIIICK  535



>ref|XP_003618370.1| Peptide transporter family [Medicago truncatula]
Length=538

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAIT+SIILLMPLY++ FIP  ++ T  +KG+ V QR
Sbjct  322  TKQGMTMKRNIGSNFKIPPATLQSAITLSIILLMPLYNRIFIPFAQLITRQEKGINVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRN--PENLSSETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAM+IAA  + KRL I R    E L SE VP+SIFWLLPQYILLGISDIFT
Sbjct  382  MGIGMVLSIIAMIIAALVEMKRLAIGRQMRSEGLLSEIVPISIFWLLPQYILLGISDIFT  441

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP NMRT+GIALYTSVFG GSF S+L+I++VE +TSS      WFSDDM
Sbjct  442  VVGMQEFFYGEVPKNMRTMGIALYTSVFGVGSFVSALMITLVEVYTSSKGTPS-WFSDDM  500

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLDNYYW LA LS++SL L+ + CK+
Sbjct  501  VEARLDNYYWLLAWLSSISLLLYTLLCKY  529



>gb|AES74588.2| peptide/nitrate transporter plant-like protein [Medicago truncatula]
Length=541

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAIT+SIILLMPLY++ FIP  ++ T  +KG+ V QR
Sbjct  325  TKQGMTMKRNIGSNFKIPPATLQSAITLSIILLMPLYNRIFIPFAQLITRQEKGINVMQR  384

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRN--PENLSSETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAM+IAA  + KRL I R    E L SE VP+SIFWLLPQYILLGISDIFT
Sbjct  385  MGIGMVLSIIAMIIAALVEMKRLAIGRQMRSEGLLSEIVPISIFWLLPQYILLGISDIFT  444

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP NMRT+GIALYTSVFG GSF S+L+I++VE +TSS      WFSDDM
Sbjct  445  VVGMQEFFYGEVPKNMRTMGIALYTSVFGVGSFVSALMITLVEVYTSSKGTPS-WFSDDM  503

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLDNYYW LA LS++SL L+ + CK+
Sbjct  504  VEARLDNYYWLLAWLSSISLLLYTLLCKY  532



>ref|XP_008347950.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.8-like 
[Malus domestica]
Length=543

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 173/223 (78%), Gaps = 3/223 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFK PPA LQSAIT+SIILLMPLYDK  IP+ R+ T N+KG++V QR
Sbjct  321  TKQGMTMKRNIGSNFKXPPATLQSAITLSIILLMPLYDKIMIPITRLVTSNEKGISVMQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAMVIAA  + KRL+ISR  E L   SETVP SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFVSVIAMVIAAVVEAKRLKISREMEMLGSQSETVPFSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFYSEVP  MRT+  ALYTSVFG GS+ S+LLI+ VE  TSS   Q  WFSDDM
Sbjct  441  VVGIQEFFYSEVPRRMRTMAFALYTSVFGVGSYLSTLLIATVEAVTSSGGRQS-WFSDDM  499

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKFNGS*KLISIWILLC  86
             EARLD YYWFLA LSA+S   +VI  +   S K + +   +C
Sbjct  500  NEARLDKYYWFLASLSALSFVFYVILSRCYTSTKDLDLEDEIC  542



>emb|CDX91014.1| BnaC02g05830D [Brassica napus]
Length=462

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 163/206 (79%), Gaps = 0/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MKR+IG NFKIPPA LQS IT+SIILLMPLYDK  IP+ +  T N+KG+ V +R
Sbjct  246  TKQGMAMKRNIGSNFKIPPATLQSTITLSIILLMPLYDKILIPIAKKITKNEKGIPVMER  305

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL IS+  +   + + P+SIFWLLPQYILLG+SDIFTVV
Sbjct  306  MGIGMFLSIIAIVIAALVEKKRLMISKKMKTSPNSSDPLSIFWLLPQYILLGVSDIFTVV  365

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS++E +T S   +H WF+DDM E
Sbjct  366  GMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVIESYTKSRGEKHNWFADDMSE  425

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  S +S  ++++ CK
Sbjct  426  ARLDNYYWLLAFTSGISFLMYIVICK  451



>ref|XP_006400015.1| hypothetical protein EUTSA_v10013156mg [Eutrema salsugineum]
 gb|ESQ41468.1| hypothetical protein EUTSA_v10013156mg [Eutrema salsugineum]
Length=554

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +    N+KG++V +R
Sbjct  335  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPIAKKILKNEKGISVMER  394

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL+IS+  + +S    P+SIFWLLPQYILLGISDIFTVV
Sbjct  395  MGIGMFLSIIAIVIAALVERKRLKISKKMK-ISPNLDPLSIFWLLPQYILLGISDIFTVV  453

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LISI+E +T S   +H WF+DDM E
Sbjct  454  GMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISIIESYTRSRGGKHNWFADDMSE  513

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA+ SA+S  ++ + CK
Sbjct  514  ARLDNYYWLLALTSAISFLMYFVICK  539



>ref|XP_008230677.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Prunus mume]
 ref|XP_008230678.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Prunus mume]
Length=542

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 166/206 (81%), Gaps = 3/206 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG  FKIPPA LQSAIT+SIILLMPLYDK  IP+ R+ T ++KG+TV QR
Sbjct  320  TKQGMTMKRNIGSQFKIPPATLQSAITLSIILLMPLYDKIMIPITRLVTCHEKGITVMQR  379

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAM  AA  +T+RL ISR  E L   SETVP SIFWLLPQYILLGISDIFT
Sbjct  380  MGIGMFISVIAMASAAVVETRRLRISREMEALGAHSETVPFSIFWLLPQYILLGISDIFT  439

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP  MRT+  ALYTSVFG GS+ SSLLI+ VE  TSS+  Q  WFSDDM
Sbjct  440  VVGMQEFFYSEVPVRMRTMAFALYTSVFGVGSYLSSLLIATVEAVTSSNGRQS-WFSDDM  498

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIF  137
             EARLD YYWFLA LSA+S  L+V+ 
Sbjct  499  SEARLDKYYWFLASLSALSFLLYVLL  524



>ref|XP_007032334.1| Amino acid permease, putative isoform 3 [Theobroma cacao]
 ref|XP_007032335.1| Amino acid permease, putative isoform 3 [Theobroma cacao]
 gb|EOY03260.1| Amino acid permease, putative isoform 3 [Theobroma cacao]
 gb|EOY03261.1| Amino acid permease, putative isoform 3 [Theobroma cacao]
Length=359

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG NFKIPPA LQSAIT+SIILLMPLYDK  IP+ ++ T N KG++V QR
Sbjct  141  TKQGMTMERNIGRNFKIPPATLQSAITLSIILLMPLYDKVLIPITQIVTCNRKGISVMQR  200

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GMFLS+IAM+IAA  + KRLEIS+N   L SETVP+SIFWLLPQY+LLGISDIFTVV
Sbjct  201  MGVGMFLSIIAMIIAAVVEMKRLEISKNIGVLESETVPLSIFWLLPQYVLLGISDIFTVV  260

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+ISI+E FTSS   Q  WFSDDM+E
Sbjct  261  GMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALMISIIEAFTSSKGRQS-WFSDDMRE  319

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
              LD YYW LA+ SA+SL L+ I CK
Sbjct  320  DGLDKYYWLLALASALSLLLYAILCK  345



>gb|KHN34167.1| Putative peptide/nitrate transporter [Glycine soja]
Length=540

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 170/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQSAIT+SIILLMPLYDK FIP+ +V T  DKG++V QR
Sbjct  322  TKQGMTMKRNIGADFKIPPATLQSAITLSIILLMPLYDKIFIPMTQVITRQDKGISVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAM+IAA  + +RL+I R   +    SETVP+SIFWLLPQYILLGISDIFT
Sbjct  382  MGIGMVLSIIAMIIAALVEMRRLDIGRQMRSAGSQSETVPLSIFWLLPQYILLGISDIFT  441

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP NMRT+GIALYTSVFG GSF S+LLI++VE +TSS      WF DDM
Sbjct  442  VVGMQEFFYGEVPRNMRTMGIALYTSVFGVGSFVSALLITLVEVYTSSKGIP-SWFCDDM  500

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLD+YYW LA LS VSL L+ + C++
Sbjct  501  VEARLDSYYWLLAWLSTVSLLLYALLCRY  529



>ref|XP_006287415.1| hypothetical protein CARUB_v10000620mg [Capsella rubella]
 gb|EOA20313.1| hypothetical protein CARUB_v10000620mg [Capsella rubella]
Length=553

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 169/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMP YDK  IP+ +  T N+KG++V +R
Sbjct  334  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPFYDKILIPIAKKLTKNEKGISVMER  393

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL+IS+  + +S +  P++I WLLPQYILLGISDIFTVV
Sbjct  394  MGIGMFLSIIAIVIAALVERKRLKISKMMK-ISPDLDPLNILWLLPQYILLGISDIFTVV  452

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LIS++E +TSS   +H WF+DDM E
Sbjct  453  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISVIESYTSSEGGKHNWFADDMSE  512

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  ++++ CK
Sbjct  513  ARLDNYYWLLAFTSAISFLMYLVICK  538



>ref|NP_196998.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9LFR1.1|PTR50_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.8; Short=AtNPF5.8 [Arabidopsis 
thaliana]
 emb|CAC01813.1| oligopeptide transporter-like protein [Arabidopsis thaliana]
 gb|AED92094.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=552

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMP YDK  IP+ +  T N+KG++V++R
Sbjct  332  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPFYDKILIPIAKKLTKNEKGISVKER  391

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL+IS+  +  +    P+SI WLLPQYILLGISDIFTVV
Sbjct  392  MGIGMFLSIIAIVIAALVERKRLKISKMMKT-TPNLDPVSILWLLPQYILLGISDIFTVV  450

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LISI+E +TSS   +H WF+DDM E
Sbjct  451  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISIIETYTSSRGGKHNWFADDMSE  510

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  ++++ CK
Sbjct  511  ARLDNYYWLLAFTSAISFLMYIVICK  536



>gb|EYU44686.1| hypothetical protein MIMGU_mgv1a004892mg [Erythranthe guttata]
Length=505

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 172/208 (83%), Gaps = 6/208 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGP-NFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQ  572
            TKQGM MKR+IG   F+IPPAALQS+ITVSII+LMP YD +F+PLVR+FT N+KG++V Q
Sbjct  298  TKQGMAMKRNIGNFKFEIPPAALQSSITVSIIVLMPWYDTFFVPLVRIFTRNEKGISVMQ  357

Query  571  RMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            RMGIGMFLSV+AM+IAA T+ KR+EI +N    + E + +SI+WLLPQYILLGISDIFTV
Sbjct  358  RMGIGMFLSVVAMIIAAITERKRMEIGKN----NGEQL-LSIYWLLPQYILLGISDIFTV  412

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQE+FYSEVP  MRT+GIALYTS+FG GSF S+LLIS++E  T+S      WFSDDM 
Sbjct  413  VGMQEYFYSEVPVRMRTMGIALYTSIFGVGSFLSALLISVIEFLTTSKETHDNWFSDDMS  472

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            +ARLD YYWFLA  SA+SL  FVIFC+F
Sbjct  473  KARLDKYYWFLAFTSAISLLAFVIFCRF  500



>ref|XP_007151152.1| hypothetical protein PHAVU_004G022300g [Phaseolus vulgaris]
 gb|ESW23146.1| hypothetical protein PHAVU_004G022300g [Phaseolus vulgaris]
Length=541

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 171/209 (82%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQSAIT+SIILLMPLYDK FIP+ +V T  DKG++V QR
Sbjct  323  TKQGMTMKRNIGADFKIPPATLQSAITLSIILLMPLYDKIFIPMTQVITRQDKGISVLQR  382

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRN--PENLSSETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAM+IAA  +TKRLEI R      L SETVP+SIFWLLPQYILLGISDIFT
Sbjct  383  MGIGMVLSIIAMIIAAVVETKRLEIGRQMRSAGLHSETVPLSIFWLLPQYILLGISDIFT  442

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP  MRT+GIALYTSVFG GSF S+LLI+ VE +TSS      WF DDM
Sbjct  443  VVGMQEFFYGEVPRTMRTMGIALYTSVFGVGSFVSALLITTVEVYTSSKGIP-SWFCDDM  501

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLD+YYW LA LSAVSL L+++ CK+
Sbjct  502  VEARLDSYYWLLAWLSAVSLLLYLLLCKY  530



>ref|XP_002517413.1| amino acid permease, putative [Ricinus communis]
 gb|EEF44955.1| amino acid permease, putative [Ricinus communis]
Length=536

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 171/210 (81%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+RSIG   KIPPA LQS+ITVSIILLMPLYD  FIP+ R+ T + KG+ V QR
Sbjct  320  TKQGVTMERSIGSKLKIPPATLQSSITVSIILLMPLYDTIFIPITRLITRDKKGINVMQR  379

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGM LS+IAM+IAA  + KR+ ISR  E   SETVP+SIFWLLPQYILLGISDIFTVV
Sbjct  380  MGIGMVLSIIAMIIAAVVERKRIMISR--EMPHSETVPLSIFWLLPQYILLGISDIFTVV  437

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  M+T+GIALYTSVFG GSFFS+ LIS++E FTSS   +  WF+DDM+E
Sbjct  438  GMQEFFYNEVPVRMKTMGIALYTSVFGVGSFFSAFLISVIEAFTSSRGTKS-WFTDDMRE  496

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKFNGS  119
            ARLDNYYW LA LSA+S+  +VI CKF  S
Sbjct  497  ARLDNYYWLLAFLSALSMLFYVILCKFYSS  526



>gb|KFK37592.1| hypothetical protein AALP_AA3G003400 [Arabis alpina]
Length=567

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  341  TKQGMTMKRNIGSNFKIPPATLQSTITLSIILLMPLYDKILIPITKRIKNNSKGISVMER  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+N + L     ETVPMSIFWLLPQYILLGISDIF
Sbjct  401  MGVGMFLSIIAIVIAALVERKRLDISQNMKTLPDYDPETVPMSIFWLLPQYILLGISDIF  460

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LI+IVE ++ S+  +  WF+DD
Sbjct  461  TVVGMQEFFYSEVPVQMRTMGFALYTSVFGVGSFVSATLITIVEAYSCSTGERQNWFADD  520

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M +ARLD YYW L++ S +S  +++I CKF
Sbjct  521  MSKARLDKYYWLLSLTSTISFVVYIILCKF  550



>ref|XP_002873698.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49957.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=554

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 168/206 (82%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMP YDK  IP+ +  T N+KG++V++R
Sbjct  334  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPFYDKILIPIAKKLTKNEKGISVKER  393

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL+IS+  +  +    P+SI WLLPQYILLGISDIFTVV
Sbjct  394  MGIGMFLSIIAIVIAALVERKRLKISKMMKT-TPNLDPLSILWLLPQYILLGISDIFTVV  452

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LISI+E ++SS   +H WF+DDM E
Sbjct  453  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISIIETYSSSRGGKHNWFADDMTE  512

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  ++++ CK
Sbjct  513  ARLDNYYWLLAFTSAISFLMYIVICK  538



>gb|KHG25623.1| hypothetical protein F383_02486 [Gossypium arboreum]
Length=519

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 171/207 (83%), Gaps = 1/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF+IPPA LQSAIT+SIIL+MPLYDK  IP+ ++ T N KG+TV QR
Sbjct  301  TKQGMTMKRNIGRNFRIPPATLQSAITLSIILMMPLYDKVLIPITQIVTRNQKGITVMQR  360

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GMFLS+IAM+IAA  +TKRLEI+R   +L SETV +SIFWLLPQY+LLGISDIFTVV
Sbjct  361  MGVGMFLSIIAMIIAAVVETKRLEINRKTSSLESETVELSIFWLLPQYVLLGISDIFTVV  420

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+IS++E FTSS   Q  WFSDDM+E
Sbjct  421  GMQEFFYNEVPVRMRTMGFALYTSVFGLGSFLSALMISVIEAFTSSGGRQS-WFSDDMRE  479

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
              LD YYW LA+ S +SL  + IFCKF
Sbjct  480  DGLDKYYWLLALASTLSLLFYAIFCKF  506



>ref|XP_011046084.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X2 [Populus 
euphratica]
Length=453

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR++G +FKIPPA LQSAITVSIILLMP YD   IP  R+ T N KG++V QR
Sbjct  232  TKQGMTMKRNVGSSFKIPPATLQSAITVSIILLMPFYDALLIPFTRLITRNKKGISVTQR  291

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE---TVPMSIFWLLPQYILLGISDIF  398
            MGIGM LS+IAMVIAA  +TKRLEISR  + L  +    VP+SIFWLLPQYILLGISDIF
Sbjct  292  MGIGMVLSIIAMVIAALVETKRLEISRKMDVLDPKLETEVPLSIFWLLPQYILLGISDIF  351

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+GIALYTSVFG GSF S+LLIS+VE+FTSS      WFSDD
Sbjct  352  TVVGMQEFFYSEVPVRMRTMGIALYTSVFGVGSFLSALLISLVEYFTSSRGKGRSWFSDD  411

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            M+EAR D YYW LA LS +SL  +VIFCK
Sbjct  412  MREARFDKYYWLLASLSVLSLVFYVIFCK  440



>ref|XP_008348207.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.8-like 
[Malus domestica]
Length=543

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 172/223 (77%), Gaps = 3/223 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFK PPA LQSAIT+SIILLMPLYDK  IP+ R+ T N+KG++V QR
Sbjct  321  TKQGMTMKRNIGSNFKXPPATLQSAITLSIILLMPLYDKIMIPITRLVTSNEKGISVMQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAMVIAA  + KRL+ISR  E L   SETVP SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFVSVIAMVIAAVVEAKRLKISREMEMLGSQSETVPFSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFYSEVP  MRT+  ALYTSVFG GS+ S+LLI+ VE  TSS   Q  WFSDDM
Sbjct  441  VVGIQEFFYSEVPRRMRTMAFALYTSVFGVGSYLSTLLIATVEAVTSSGGXQS-WFSDDM  499

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKFNGS*KLISIWILLC  86
             EARLD  YWFLA LSA+S   +VI  +   S K + +   +C
Sbjct  500  NEARLDKXYWFLASLSALSFVFYVILSRCYTSTKDLDLEDEIC  542



>emb|CDX85576.1| BnaA02g02370D [Brassica napus]
Length=543

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  T N+KG+ V +R
Sbjct  327  TKQGMAMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPIAKKITKNEKGIPVMER  386

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL IS+  +   + + P+SIFWLLPQYILLG+SDIFTVV
Sbjct  387  MGIGMFLSIIAIVIAALVERKRLMISKKMKTSPNSSDPLSIFWLLPQYILLGVSDIFTVV  446

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LIS++E  T S   +  WF+DDM E
Sbjct  447  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISVIESCTKSRGERQNWFADDMSE  506

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  ++++ CK
Sbjct  507  ARLDNYYWLLAFTSAISFLMYIVICK  532



>ref|XP_003554136.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Glycine max]
Length=540

 Score =   264 bits (674),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQSAIT+SIILLMPLYDK FIP+ +V T  DKG++V QR
Sbjct  322  TKQGMTMKRNIGADFKIPPATLQSAITLSIILLMPLYDKIFIPMTQVITRQDKGISVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAM+IAA  + +RL+I R   +    SETVP+SIFWLLPQYILLGISDIFT
Sbjct  382  MGIGMVLSIIAMIIAALVEMRRLDIGRQMRSAGSQSETVPLSIFWLLPQYILLGISDIFT  441

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP NMRT+GIALYTSVFG GSF S+LLI++VE +TSS      WF DDM
Sbjct  442  VVGMQEFFYGEVPRNMRTMGIALYTSVFGVGSFVSALLITLVEVYTSSKGIP-SWFCDDM  500

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EA LD+YYW LA LS VSL L+ + C++
Sbjct  501  VEAHLDSYYWLLAWLSTVSLLLYALLCRY  529



>ref|XP_009126016.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brassica rapa]
Length=544

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  T N+KG+ V +R
Sbjct  328  TKQGMAMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPIAKKITKNEKGIPVMER  387

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL IS+  +   + + P+SIFWLLPQYILLG+SDIFTVV
Sbjct  388  MGIGMFLSIIAIVIAALVERKRLMISKKMKTSPNSSDPLSIFWLLPQYILLGVSDIFTVV  447

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LIS++E  T S   +  WF+DDM E
Sbjct  448  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISVIESCTKSRGERQNWFADDMSE  507

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLDNYYW LA  SA+S  ++++ CK
Sbjct  508  ARLDNYYWLLAFTSAISFLMYIVICK  533



>ref|XP_010485501.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=568

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF+IPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  343  TKQGMTMKRNIGTNFRIPPATLQSTITLSIILLMPLYDKILIPITKRIKKNGKGISVMER  402

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+V AA  + KRL+IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  403  MGVGMFLSIIAIVRAAIVERKRLDISQKMKTLPDYDPETVPLSIFWLLPQYILLGISDIF  462

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS+VE ++SS+ +   WF+DD
Sbjct  463  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVVEAYSSSTGDCQNWFADD  522

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M +ARLDNYYW LAV S +S  ++++ CKF
Sbjct  523  MSKARLDNYYWLLAVTSTISFVVYIVLCKF  552



>gb|AFK43271.1| unknown [Lotus japonicus]
Length=371

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 168/209 (80%), Gaps = 4/209 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQSAIT+SIILLMPLYD+ F+P+ ++ T  DKG++V QR
Sbjct  154  TKQGMTMKRNIG-DFKIPPATLQSAITMSIILLMPLYDRIFMPIAQMITRQDKGISVMQR  212

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAMVIAA  + +RL+I R      L SETVP+SIFWLLPQYILLGISDI T
Sbjct  213  MGIGMVLSIIAMVIAALVEMRRLDIGREMRIAGLQSETVPLSIFWLLPQYILLGISDIST  272

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP  MRT+GIALYTSVFG GSF S+LLI++VE +TSS      WFSDDM
Sbjct  273  VVGMQEFFYGEVPKTMRTMGIALYTSVFGVGSFVSALLITLVEVYTSSKGVP-SWFSDDM  331

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLDNYYW LA  S  SL L+V+ CKF
Sbjct  332  VEARLDNYYWLLAWFSGGSLVLYVLLCKF  360



>ref|XP_003633812.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Vitis vinifera]
 ref|XP_010660979.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Vitis vinifera]
Length=533

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 2/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG N  IPPA LQSAITVSII+LMPLYDK  IP  R+ T  +KG+ V QR
Sbjct  318  TKQGMTMKRNIGRNLLIPPAMLQSAITVSIIVLMPLYDKVLIPFTRLITRKEKGINVMQR  377

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGM LS+IAMVIAA  + KRL IS   E+  SETVP+SIFWLLPQYI+LGI+DIFTVV
Sbjct  378  MGIGMVLSIIAMVIAALVEKKRLSISSKLES-QSETVPLSIFWLLPQYIILGIADIFTVV  436

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY EVP  MRT+GIALY+SVFG GSF S+ LI ++E FTSS   Q GWFSDDM+E
Sbjct  437  GMQEFFYGEVPIRMRTMGIALYSSVFGVGSFMSAFLIWLIEIFTSSGGRQ-GWFSDDMRE  495

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKFNGS  119
            ARLD YYW LA+ S  SL L+++ CK+  S
Sbjct  496  ARLDKYYWLLALSSTFSLLLYMLLCKYYKS  525



>ref|XP_004296558.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Fragaria vesca 
subsp. vesca]
Length=545

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF IPPA LQSAI +SI+LLMPLYDK  IP+ +V T N+KG+TV QR
Sbjct  322  TKQGMTMKRNIGSNFLIPPATLQSAIALSIVLLMPLYDKVLIPITKVLTCNEKGITVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIG+F SVIA++IAA  +T+RL ISR  E L   SETVP+SIFWLLPQYILLGISDIFT
Sbjct  382  MGIGIFTSVIALIIAAIVETRRLHISRKMEMLGSQSETVPLSIFWLLPQYILLGISDIFT  441

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSE P  MRT+  ALYTSVFG GS+ S+ LIS VE  TSS+ N+  WF DDM
Sbjct  442  VVGMQEFFYSEFPIKMRTMAFALYTSVFGVGSYLSAFLISTVETITSSNGNKS-WFCDDM  500

Query  214  KEARLDNYYWFLAVLSAVSLTLFVI  140
             EARLD YYWFLA  SA+S   FVI
Sbjct  501  SEARLDKYYWFLAASSALSFLFFVI  525



>ref|XP_011046083.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X1 [Populus 
euphratica]
Length=540

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR++G +FKIPPA LQSAITVSIILLMP YD   IP  R+ T N KG++V QR
Sbjct  319  TKQGMTMKRNVGSSFKIPPATLQSAITVSIILLMPFYDALLIPFTRLITRNKKGISVTQR  378

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE---TVPMSIFWLLPQYILLGISDIF  398
            MGIGM LS+IAMVIAA  +TKRLEISR  + L  +    VP+SIFWLLPQYILLGISDIF
Sbjct  379  MGIGMVLSIIAMVIAALVETKRLEISRKMDVLDPKLETEVPLSIFWLLPQYILLGISDIF  438

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+GIALYTSVFG GSF S+LLIS+VE+FTSS      WFSDD
Sbjct  439  TVVGMQEFFYSEVPVRMRTMGIALYTSVFGVGSFLSALLISLVEYFTSSRGKGRSWFSDD  498

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            M+EAR D YYW LA LS +SL  +VIFCK
Sbjct  499  MREARFDKYYWLLASLSVLSLVFYVIFCK  527



>ref|XP_006372628.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP50425.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=540

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR++G +FKIPPA LQSAITVSIILLMP YD   IP  R+ T + KG++V QR
Sbjct  319  TKQGMTMKRNVGSSFKIPPATLQSAITVSIILLMPFYDALLIPFTRLITRDKKGISVTQR  378

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE---TVPMSIFWLLPQYILLGISDIF  398
            MGIGM LS+IAMVIAA  +TKRLEISR  E L  +    VP+SIFWLLPQYILLGISDIF
Sbjct  379  MGIGMVLSIIAMVIAALVETKRLEISRKMEVLDPKLETEVPLSIFWLLPQYILLGISDIF  438

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+GIALYTSVFG GSF S+LLIS+VE+FTSS      WFSDD
Sbjct  439  TVVGMQEFFYSEVPVRMRTMGIALYTSVFGVGSFLSALLISLVEYFTSSRGKGRSWFSDD  498

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            M+EAR D YYW LA+LS +SL  +VIFCK
Sbjct  499  MREARFDKYYWLLALLSVLSLVFYVIFCK  527



>gb|KJB75802.1| hypothetical protein B456_012G058600 [Gossypium raimondii]
Length=541

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 1/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAIT+SIIL+MPLYDK  IP+ ++ T N KG+TV QR
Sbjct  323  TKQGMTMKRNIGRNFKIPPATLQSAITLSIILMMPLYDKVLIPITQIVTRNQKGITVMQR  382

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GMFLS+IAM+IAA  +TKRLEISR   +L SETV +SIFWLLPQY+LLGISDIFTVV
Sbjct  383  MGVGMFLSIIAMIIAAVVETKRLEISRKMSSLESETVELSIFWLLPQYVLLGISDIFTVV  442

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+IS++E FTSS   Q  WFSDDM+E
Sbjct  443  GMQEFFYNEVPVRMRTMGFALYTSVFGLGSFLSALMISVIEAFTSSGGRQS-WFSDDMRE  501

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
              LD YYW LA+ S +SL  + IF KF
Sbjct  502  DGLDKYYWLLALASTLSLLFYAIFSKF  528



>emb|CBI34989.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 2/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG N  IPPA LQSAITVSII+LMPLYDK  IP  R+ T  +KG+ V QR
Sbjct  318  TKQGMTMKRNIGRNLLIPPAMLQSAITVSIIVLMPLYDKVLIPFTRLITRKEKGINVMQR  377

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGM LS+IAMVIAA  + KRL IS   E+  SETVP+SIFWLLPQYI+LGI+DIFTVV
Sbjct  378  MGIGMVLSIIAMVIAALVEKKRLSISSKLES-QSETVPLSIFWLLPQYIILGIADIFTVV  436

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY EVP  MRT+GIALY+SVFG GSF S+ LI ++E FTSS   Q GWFSDDM+E
Sbjct  437  GMQEFFYGEVPIRMRTMGIALYSSVFGVGSFMSAFLIWLIEIFTSSGGRQ-GWFSDDMRE  495

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKFNGS  119
            ARLD YYW LA+ S  SL L+++ CK+  S
Sbjct  496  ARLDKYYWLLALSSTFSLLLYMLLCKYYKS  525



>ref|XP_008357888.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.8-like 
[Malus domestica]
Length=543

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG  FK PPA LQSAIT+SIILLMPLYDK  IP+ R+ T N+KG++V QR
Sbjct  321  TKQGMTMKRNIGSXFKXPPATLQSAITLSIILLMPLYDKIMIPIXRLVTSNEKGISVMQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAMVIAA  + KRL+ISR  E L   SETVP SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFVSVIAMVIAAVVEAKRLKISREMEMLGSQSETVPFSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFYSEVP  MRT+  ALYTSVFG GS+ S+LLI+ VE  TSS   Q  WFSDDM
Sbjct  441  VVGIQEFFYSEVPRRMRTMAFALYTSVFGVGSYLSTLLIATVEAVTSSGGXQS-WFSDDM  499

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKFNGS*KLISIWILLC  86
             EARLD  YWFLA LSA+S   +VI  +   S K + +   +C
Sbjct  500  NEARLDKXYWFLASLSALSFVFYVILSRCYTSTKDLDLEDEIC  542



>ref|XP_007032333.1| Amino acid permease, putative isoform 2 [Theobroma cacao]
 gb|EOY03259.1| Amino acid permease, putative isoform 2 [Theobroma cacao]
Length=519

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG NFKIPPA LQSAIT+SIILLMPLYDK  IP+ ++ T N KG++V QR
Sbjct  301  TKQGMTMERNIGRNFKIPPATLQSAITLSIILLMPLYDKVLIPITQIVTCNRKGISVMQR  360

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GMFLS+IAM+IAA  + KRLEIS+N   L SETVP+SIFWLLPQY+LLGISDIFTVV
Sbjct  361  MGVGMFLSIIAMIIAAVVEMKRLEISKNIGVLESETVPLSIFWLLPQYVLLGISDIFTVV  420

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+ISI+E FTSS   Q  WFSDDM+E
Sbjct  421  GMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALMISIIEAFTSSKGRQS-WFSDDMRE  479

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
              LD YYW LA+ SA+SL L+ I CK
Sbjct  480  DGLDKYYWLLALASALSLLLYAILCK  505



>ref|XP_007032332.1| Amino acid permease, putative isoform 1 [Theobroma cacao]
 gb|EOY03258.1| Amino acid permease, putative isoform 1 [Theobroma cacao]
Length=541

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 171/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG NFKIPPA LQSAIT+SIILLMPLYDK  IP+ ++ T N KG++V QR
Sbjct  323  TKQGMTMERNIGRNFKIPPATLQSAITLSIILLMPLYDKVLIPITQIVTCNRKGISVMQR  382

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GMFLS+IAM+IAA  + KRLEIS+N   L SETVP+SIFWLLPQY+LLGISDIFTVV
Sbjct  383  MGVGMFLSIIAMIIAAVVEMKRLEISKNIGVLESETVPLSIFWLLPQYVLLGISDIFTVV  442

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+ISI+E FTSS   Q  WFSDDM+E
Sbjct  443  GMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALMISIIEAFTSSKGRQS-WFSDDMRE  501

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
              LD YYW LA+ SA+SL L+ I CK
Sbjct  502  DGLDKYYWLLALASALSLLLYAILCK  527



>ref|XP_003543540.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Glycine max]
 gb|KHN13270.1| Putative peptide/nitrate transporter [Glycine soja]
Length=540

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 168/209 (80%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG  FKIPPA LQSAIT+SIILLMPLYDK FIP+ +V T  ++G++V QR
Sbjct  322  TKQGMTMKRNIGAGFKIPPATLQSAITLSIILLMPLYDKIFIPITQVITRQERGISVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAM+IAA  + +RLEI     +    SETVP+SIFWLLPQYILLGISDIFT
Sbjct  382  MGIGMVLSIIAMIIAALVEMRRLEIGSQMRSAGSQSETVPLSIFWLLPQYILLGISDIFT  441

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP +MRT+GIALYTSVFG GSF S+LLI++VE +TSS      WF DDM
Sbjct  442  VVGMQEFFYGEVPRHMRTMGIALYTSVFGVGSFVSALLITLVEVYTSSKGIPS-WFCDDM  500

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLD+YYW LA LS VSL L+ + C++
Sbjct  501  VEARLDSYYWLLAWLSTVSLLLYALLCRY  529



>emb|CDY37529.1| BnaA05g33940D [Brassica napus]
Length=570

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGP+FKIPPA LQS IT+SIILLMPLY+K  IP+ +    N +G++V +R
Sbjct  345  TKQGMTMKRNIGPSFKIPPATLQSTITLSIILLMPLYEKILIPVTKRIKNNGQGISVMER  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS---ETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L+    ETVP SIFWLLPQYILLGISDIF
Sbjct  405  MGVGMFLSIIAIVIAALVERKRLDISQKVKTLTDYDPETVPFSIFWLLPQYILLGISDIF  464

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS+VE +++S+     WF+DD
Sbjct  465  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAGLISVVEAYSTSTGEGKNWFADD  524

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLD YYW LA+ S +S  ++++ CK+
Sbjct  525  MSEARLDKYYWLLALTSTISFVVYIVLCKY  554



>ref|XP_007215636.1| hypothetical protein PRUPE_ppa003862mg [Prunus persica]
 gb|EMJ16835.1| hypothetical protein PRUPE_ppa003862mg [Prunus persica]
Length=543

 Score =   258 bits (660),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 163/206 (79%), Gaps = 3/206 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG  FKIPPA LQSAIT+SIILLMPLYDK  IP+ R+ T ++KG++V QR
Sbjct  321  TKQGMTMKRNIGSKFKIPPATLQSAITLSIILLMPLYDKIMIPITRLVTCHEKGISVMQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SV+AM  AA  +T+RL IS   E L   SETVP SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFISVLAMASAAVVETRRLHISGEMEALGAHSETVPFSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP  MRT+   LYTSVFG GS+ SSLLI+ VE  TSS+  Q  WFSDDM
Sbjct  441  VVGMQEFFYSEVPVRMRTMAFGLYTSVFGVGSYLSSLLIATVEAVTSSNGRQS-WFSDDM  499

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIF  137
             EARLD YYWFLA LSA+S   +V+ 
Sbjct  500  SEARLDKYYWFLASLSALSFLFYVLL  525



>ref|XP_004489344.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Cicer arietinum]
Length=543

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 172/209 (82%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAIT+SIILLMPLY++ FIP  ++ T  DKG+ V QR
Sbjct  325  TKQGMTMKRNIGSNFKIPPATLQSAITLSIILLMPLYNRVFIPFAQLITRQDKGINVMQR  384

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            MGIGM LS+IAMVIAA  + KRLEI +N  +  S  ETVP+SIFWLLPQYILLGISDIFT
Sbjct  385  MGIGMVLSIIAMVIAALVEMKRLEIGKNMRSEGSLLETVPISIFWLLPQYILLGISDIFT  444

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY EVP NMRT+GIALYTSVFG GSF S+LLI++VE +TSS      WFSDDM
Sbjct  445  VVGMQEFFYGEVPKNMRTMGIALYTSVFGCGSFVSALLITLVEVYTSSKGTPS-WFSDDM  503

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLDNYYW LA+LS+VSL L+ + CK+
Sbjct  504  VEARLDNYYWLLALLSSVSLILYTLLCKY  532



>dbj|BAE98864.1| oligopeptide transporter - like protein [Arabidopsis thaliana]
Length=530

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGPNFKIPPA LQS IT+SIILLMP YDK  IP+ +  T N+KG++V++R
Sbjct  332  TKQGMTMKRNIGPNFKIPPATLQSTITLSIILLMPFYDKILIPIAKKLTKNEKGISVKER  391

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IA+VIAA  + KRL+IS+  +  +    P+SI WLLPQYILLGISDIFTVV
Sbjct  392  MGIGMFLSIIAIVIAALVERKRLKISKMMKT-TPNLDPVSILWLLPQYILLGISDIFTVV  450

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT+G ALYTSVFG GSF S+ LISI+E +TSS   +H WF+DDM E
Sbjct  451  GMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSAALISIIETYTSSRGGKHNWFADDMSE  510

Query  208  ARLDNYYWFLAVLSAVS  158
            ARLDNYYW LA  SA+S
Sbjct  511  ARLDNYYWLLAFTSAIS  527



>ref|XP_010272076.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Nelumbo nucifera]
Length=548

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 167/214 (78%), Gaps = 5/214 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR IG +F IPPA LQSAIT+SIILLMPLYDK  IP++R  T +DKG+TV QR
Sbjct  322  TKQGMTMKRKIGKSFIIPPATLQSAITISIILLMPLYDKMIIPMMRFVTRDDKGITVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSET----VPMSIFWLLPQYILLGISDI  401
            MGIGMFLSVIAMV AA  + KRLEISR+P  L SET    VP+SIFWLLPQYILLG+SD+
Sbjct  382  MGIGMFLSVIAMVTAAVVEAKRLEISRSPGVLESETVVVVVPLSIFWLLPQYILLGVSDV  441

Query  400  FTVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSD  221
            FTVVGMQEFFY++VP+ +RT+G+ LY SVFG GSF S+LLIS++E  TS+    H W SD
Sbjct  442  FTVVGMQEFFYTQVPSRIRTMGVGLYFSVFGVGSFLSALLISVIEIVTSARGG-HSWLSD  500

Query  220  DMKEARLDNYYWFLAVLSAVSLTLFVIFCKFNGS  119
            DM+EARLD YYW LA    +S+ LF    K+  S
Sbjct  501  DMREARLDKYYWLLASSGTISMLLFTCSSKYYDS  534



>ref|XP_010550101.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGP+FKIPPA LQSAIT+SIILLMPLYDK  IP+ R  T  +KG++V +R
Sbjct  333  TKQGMTMKRNIGPSFKIPPATLQSAITLSIILLMPLYDKILIPIARKLTKKEKGISVMER  392

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE---NLSSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+ IAA  +TKRLE+S+  +   +    TVP+SIFWLLPQYILLGISDIF
Sbjct  393  MGVGMFLSIIAISIAAIVETKRLELSKKMKTSPHSEQGTVPLSIFWLLPQYILLGISDIF  452

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LI+ +E  TS     H WF+DD
Sbjct  453  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAGLITAIEAITSLRGKHHNWFADD  512

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLDNYYW LA+ SA+S  L+++ CK+
Sbjct  513  MSEARLDNYYWLLAITSALSFLLYIVLCKY  542



>ref|XP_010453501.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=565

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQS IT+SIILLMPLY+K  IP+ +    N KG++V +R
Sbjct  340  TKQGMTMKRNIGSSFKIPPATLQSTITLSIILLMPLYEKILIPITKRIKKNGKGISVMER  399

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+N + L     ETVP+SIF LLPQYILLGISDIF
Sbjct  400  MGVGMFLSIIAIVIAALVERKRLDISQNMKTLPDYDPETVPLSIFCLLPQYILLGISDIF  459

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LI+IVE ++SS+  +  WF+DD
Sbjct  460  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALITIVEAYSSSTGERQNWFADD  519

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M +ARLD YYW LA+ S +S  ++++ CK+
Sbjct  520  MSKARLDKYYWLLALTSTISFIVYIVLCKY  549



>ref|XP_010550102.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X2 [Tarenaya 
hassleriana]
Length=504

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGP+FKIPPA LQSAIT+SIILLMPLYDK  IP+ R  T  +KG++V +R
Sbjct  282  TKQGMTMKRNIGPSFKIPPATLQSAITLSIILLMPLYDKILIPIARKLTKKEKGISVMER  341

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE---NLSSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+ IAA  +TKRLE+S+  +   +    TVP+SIFWLLPQYILLGISDIF
Sbjct  342  MGVGMFLSIIAISIAAIVETKRLELSKKMKTSPHSEQGTVPLSIFWLLPQYILLGISDIF  401

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LI+ +E  TS     H WF+DD
Sbjct  402  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAGLITAIEAITSLRGKHHNWFADD  461

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLDNYYW LA+ SA+S  L+++ CK+
Sbjct  462  MSEARLDNYYWLLAITSALSFLLYIVLCKY  491



>ref|XP_010255307.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Nelumbo nucifera]
Length=537

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 167/208 (80%), Gaps = 2/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR IG NF IPPA LQSAIT+SII LMPLYDK  IP++R+ + ND GV+V QR
Sbjct  326  TKQGMTMKRRIGKNFIIPPATLQSAITISIIFLMPLYDKMIIPMIRIISRNDGGVSVMQR  385

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNP-ENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            MGIGMFLS+IAMVIAA  + KRL+ISR+  ++  +  VP+SIFWLLPQYILLG SD+FTV
Sbjct  386  MGIGMFLSIIAMVIAALVEAKRLQISRSGLQSAGTAVVPLSIFWLLPQYILLGTSDVFTV  445

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQEFFY++VP+ +RT+G+ LY SVFG GSF S+LLIS++E  TS+   ++ WFSDDM+
Sbjct  446  VGMQEFFYTQVPSRLRTMGVGLYFSVFGVGSFLSALLISVIEKITSARG-ENSWFSDDMR  504

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            EARLD YYW LA  S +SL  FV  CK+
Sbjct  505  EARLDKYYWLLAFSSTLSLLFFVSLCKY  532



>emb|CDY49047.1| BnaC05g48750D [Brassica napus]
Length=551

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQS IT+SIILLMPLY+K  IP+ +    N +G++V +R
Sbjct  324  TKQGMTMKRNIGSSFKIPPATLQSTITLSIILLMPLYEKILIPVTKRIKNNGQGISVMER  383

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  384  MGVGMFLSIIAIVIAALVERKRLDISQKVKTLPDYDPETVPLSIFWLLPQYILLGISDIF  443

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS+VE +++S+     WF+DD
Sbjct  444  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAGLISVVEAYSTSTGEGQNWFADD  503

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLD YYW LA+ S +S  ++++ CK+
Sbjct  504  MSEARLDKYYWLLALTSTISFAVYIVLCKY  533



>ref|XP_002305027.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEE85538.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=540

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 172/209 (82%), Gaps = 4/209 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR++G +FKIPPA LQS+ITVSIILLMP YD   IPL R+ T ++KG++V +R
Sbjct  319  TKQGMTMKRNVGSSFKIPPATLQSSITVSIILLMPFYDALLIPLARLITRDEKGISVTER  378

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE---TVPMSIFWLLPQYILLGISDIF  398
            MGIGM LS+IAM IAA  +TKRLEI +  E +  +    VP+SIFWLLPQYILLGISDIF
Sbjct  379  MGIGMVLSIIAMAIAALVETKRLEIGQKMEVVDQKMETEVPLSIFWLLPQYILLGISDIF  438

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+GIALYTSVFG GSF S+LLIS+VE+FTSS+  +  WFSDD
Sbjct  439  TVVGMQEFFYSEVPVRMRTMGIALYTSVFGVGSFLSALLISLVEYFTSSTGGKS-WFSDD  497

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            M+EARLD YYW LA+LS +SL  +V+FCK
Sbjct  498  MREARLDKYYWLLALLSVLSLIFYVVFCK  526



>ref|XP_011035394.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Populus euphratica]
Length=538

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 172/209 (82%), Gaps = 4/209 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR++G +FKIPPA LQS+ITVSIILLMP YD   IPL R+ T ++KG++V +R
Sbjct  318  TKQGMTMKRNVGSSFKIPPATLQSSITVSIILLMPFYDALLIPLARLITRDEKGISVTER  377

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE---TVPMSIFWLLPQYILLGISDIF  398
            MGIGM LS+IAM IAA  ++KRLEI +  E +  +    VP+SIFWLLPQYILLGISDIF
Sbjct  378  MGIGMVLSIIAMAIAALVESKRLEIGQKMEVVDQKIETEVPLSIFWLLPQYILLGISDIF  437

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+GIALYTSVFG GSF S+LLIS+VE+FTSS+  +  WFSDD
Sbjct  438  TVVGMQEFFYSEVPVRMRTMGIALYTSVFGVGSFLSALLISLVEYFTSSTGGKS-WFSDD  496

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            M+EARLD YYW LA+LS +SL  +VIFCK
Sbjct  497  MREARLDKYYWLLALLSVLSLIFYVIFCK  525



>emb|CDY70256.1| BnaCnng67440D [Brassica napus]
Length=561

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM +KR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  + N+KG+TV  R
Sbjct  339  TKQGMALKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPMAKKISKNEKGITVMTR  398

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMF+S+IA+VIAA  + KRL+IS+  +   + T P+SIFWLLPQYILLGISDIFTVV
Sbjct  399  MGIGMFISIIAIVIAALVERKRLKISKEMKTSPNTTEPLSIFWLLPQYILLGISDIFTVV  458

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS++E +T S   +H WF+DDM E
Sbjct  459  GMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVIESYTKSRGGKHNWFADDMSE  518

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLDNYYW LA+ SA+S  ++++ CK+
Sbjct  519  ARLDNYYWLLALTSAISFLMYIVICKY  545



>gb|KFK25622.1| hypothetical protein AALP_AA8G138600 [Arabis alpina]
Length=571

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQS +T+SIILLMPLY+K  IP+ +    N+KG++V +R
Sbjct  345  TKQGMTMKRNIGSSFKIPPATLQSTLTLSIILLMPLYEKILIPVTKRIKNNNKGISVMER  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS---ETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRLEIS+  + +     ET+PMSIFWLLPQYILLGI DIF
Sbjct  405  MGVGMFLSIIAIVIAALVERKRLEISQKMKTVPGYDPETIPMSIFWLLPQYILLGIPDIF  464

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TV+GMQEFFYSE P  MRT+G ALYTSVFG GSF S+ LI+IVE ++SS+  +  WF+DD
Sbjct  465  TVIGMQEFFYSEAPVRMRTMGFALYTSVFGVGSFVSAALITIVEAYSSSTGERQNWFADD  524

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M +ARLD YYW LA+ S +S  ++++ CK+
Sbjct  525  MSKARLDKYYWLLALTSTISFGVYIVLCKY  554



>ref|XP_010420013.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=540

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 167/214 (78%), Gaps = 4/214 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG +FKIPPA LQS IT+SIILLMPLY+K  IP+ +    N KG++V +R
Sbjct  315  TKQGMTMQRNIGSSFKIPPATLQSTITLSIILLMPLYEKILIPVTKRIKKNGKGISVMER  374

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP+SIF LLPQYILLGISDIF
Sbjct  375  MGVGMFLSIIAIVIAALVERKRLDISQKMKTLPDYDPETVPLSIFCLLPQYILLGISDIF  434

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LI+IVE ++SS+  +  WF+DD
Sbjct  435  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALITIVEAYSSSTGERQNWFADD  494

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK-FNGS  119
            M +ARLD YYW LA+ S V    +++ CK FN S
Sbjct  495  MSKARLDKYYWLLALTSTVCFMFYIVLCKYFNSS  528



>ref|XP_010498082.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like isoform X3 [Camelina 
sativa]
Length=584

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 169/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF+IPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  358  TKQGMTMKRNIGSNFRIPPATLQSTITLSIILLMPLYDKILIPITKRIKNNGKGISVMER  417

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  418  MGVGMFLSIIAIVIAAIVERKRLDISQKMKTLPDYDPETVPLSIFWLLPQYILLGISDIF  477

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS+VE ++SS+ +   WF+DD
Sbjct  478  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVVEAYSSSTGDCQNWFADD  537

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLDNYYW LA+ S +S  ++++ CKF
Sbjct  538  MSEARLDNYYWLLALTSTISFVVYIVLCKF  567



>ref|XP_010486758.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like isoform X1 [Camelina 
sativa]
 ref|XP_010493500.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like isoform X2 [Camelina 
sativa]
Length=599

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 169/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF+IPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  373  TKQGMTMKRNIGSNFRIPPATLQSTITLSIILLMPLYDKILIPITKRIKNNGKGISVMER  432

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  433  MGVGMFLSIIAIVIAAIVERKRLDISQKMKTLPDYDPETVPLSIFWLLPQYILLGISDIF  492

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS+VE ++SS+ +   WF+DD
Sbjct  493  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVVEAYSSSTGDCQNWFADD  552

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLDNYYW LA+ S +S  ++++ CKF
Sbjct  553  MSEARLDNYYWLLALTSTISFVVYIVLCKF  582



>ref|XP_010492181.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9-like [Camelina sativa]
Length=565

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 166/210 (79%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQS IT+SIILLMPLY+K  IP+ +    N +G++V +R
Sbjct  340  TKQGMTMKRNIGSSFKIPPATLQSTITLSIILLMPLYEKILIPVTKRIKKNGRGISVMER  399

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ET+P+SIF LLPQYILLGISDIF
Sbjct  400  MGVGMFLSIIAIVIAALVERKRLDISQKMKTLPDYDPETIPLSIFCLLPQYILLGISDIF  459

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LI+IVE ++SS+  +  WF+DD
Sbjct  460  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALITIVEAYSSSTGERQNWFADD  519

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M +ARLD YYW LA+ S V   ++++ CK+
Sbjct  520  MSKARLDKYYWLLALASTVCFMVYIVLCKY  549



>ref|XP_006299737.1| hypothetical protein CARUB_v10015930mg [Capsella rubella]
 gb|EOA32635.1| hypothetical protein CARUB_v10015930mg [Capsella rubella]
Length=684

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 170/210 (81%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF+IPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  339  TKQGMTMKRNIGSNFRIPPATLQSTITLSIILLMPLYDKILIPITKRIKKNGKGISVMER  398

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  +NL     ETVP+SIFWLLPQYILLGISDIF
Sbjct  399  MGVGMFLSIIAIVIAAIVERKRLDISQKMKNLPDYDPETVPLSIFWLLPQYILLGISDIF  458

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LISIVE ++SS+ +   WF+DD
Sbjct  459  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISIVEVYSSSTGDCQNWFADD  518

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLDNYYW LA+ S +S  ++++ CKF
Sbjct  519  MSEARLDNYYWLLALTSTISFVVYIVLCKF  548



>ref|XP_010696018.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 164/210 (78%), Gaps = 12/210 (6%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG  FKIPPA LQ AITVSII+LMP YD+  +P  ++ T N+KG+TV QR
Sbjct  324  TKQGMTMRRNIGTKFKIPPATLQGAITVSIIILMPFYDRVLVPCTQLITRNEKGITVLQR  383

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GM LS+IAMVIAA  + KRL   +NP         +SIFWLLPQYILLGISDIFTVV
Sbjct  384  MGVGMVLSIIAMVIAALVEEKRL---KNPS--------LSIFWLLPQYILLGISDIFTVV  432

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY EVP  MRT+GIALYTSVFG GSF S+++I+++E FT+   NQ  WFSDDM +
Sbjct  433  GMQEFFYGEVPVKMRTMGIALYTSVFGVGSFLSAIMIALIEVFTTRGGNQS-WFSDDMMK  491

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKFNGS  119
            ARLD YYW LA+LS+ SL ++++ CKF+ S
Sbjct  492  ARLDKYYWLLAILSSFSLLIYIVLCKFHKS  521



>ref|XP_008443465.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Cucumis melo]
Length=560

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 163/206 (79%), Gaps = 8/206 (4%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG +FKIPPA LQSAIT+SIILLMPLYDK  IP+ R+FT  +KG+TV QR
Sbjct  349  TKQGMTMERNIGADFKIPPATLQSAITISIILLMPLYDKVLIPITRLFTGAEKGITVMQR  408

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS IAM++AA  + KRL +++N        + +SIFWLLPQYI+LGISDIFTVV
Sbjct  409  MGIGMFLSTIAMILAALVEAKRLTMTKN-------ALSLSIFWLLPQYIILGISDIFTVV  461

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT G ALY SVFG GSF S+++ISIVE  TS     + WFSDDMKE
Sbjct  462  GMQEFFYSEVPVSMRTTGFALYNSVFGVGSFCSAIMISIVELLTSVEGKPN-WFSDDMKE  520

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLD YYW LA  S +S  L+VI+CK
Sbjct  521  ARLDKYYWLLAFCSGLSFVLYVIWCK  546



>ref|XP_010696017.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=542

 Score =   251 bits (641),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 164/210 (78%), Gaps = 12/210 (6%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG  FKIPPA LQ AITVSII+LMP YD+  +P  ++ T N+KG+TV QR
Sbjct  335  TKQGMTMRRNIGTKFKIPPATLQGAITVSIIILMPFYDRVLVPCTQLITRNEKGITVLQR  394

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MG+GM LS+IAMVIAA  + KRL   +NP         +SIFWLLPQYILLGISDIFTVV
Sbjct  395  MGVGMVLSIIAMVIAALVEEKRL---KNPS--------LSIFWLLPQYILLGISDIFTVV  443

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY EVP  MRT+GIALYTSVFG GSF S+++I+++E FT+   NQ  WFSDDM +
Sbjct  444  GMQEFFYGEVPVKMRTMGIALYTSVFGVGSFLSAIMIALIEVFTTRGGNQS-WFSDDMMK  502

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKFNGS  119
            ARLD YYW LA+LS+ SL ++++ CKF+ S
Sbjct  503  ARLDKYYWLLAILSSFSLLIYIVLCKFHKS  532



>ref|XP_010463532.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9 [Camelina sativa]
Length=568

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 169/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NF+IPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  343  TKQGMTMKRNIGTNFRIPPATLQSTITLSIILLMPLYDKILIPITKRIKKNGKGISVMER  402

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  403  MGVGMFLSIIAIVIAAIVERKRLDISQKMKTLPDYDPETVPLSIFWLLPQYILLGISDIF  462

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS+VE ++SS+ +   WF+DD
Sbjct  463  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISVVEAYSSSTGDCQNWFADD  522

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M +ARLDNYYW LA+ S +S  ++++ CKF
Sbjct  523  MSKARLDNYYWLLALTSTISFVVYIVLCKF  552



>emb|CDY69851.1| BnaCnng65650D [Brassica napus]
Length=563

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 166/207 (80%), Gaps = 0/207 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MKR+IGPNFKIPPA LQS IT+SIILLMPLYDK  IP+ +  + N+KG+TV  R
Sbjct  341  TKQGMAMKRNIGPNFKIPPATLQSTITLSIILLMPLYDKVLIPMAKKISKNEKGITVMTR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMF+S+IA+VIAA  + KRL+IS+  +   + T P+SIFWLLPQYILLGISDIFTVV
Sbjct  401  MGIGMFISIIAIVIAALVERKRLKISKEMKTSPNTTEPLSIFWLLPQYILLGISDIFTVV  460

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP  MR +G ALYTSVFG GSF S+ LIS++E +T S   +H WF+DDM E
Sbjct  461  GMQEFFYSEVPVRMRAMGFALYTSVFGVGSFVSAALISVIESYTKSRGGKHNWFADDMSE  520

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLDNY W LA+ SA+S  ++++ CK+
Sbjct  521  ARLDNYDWLLALTSAISFFMYIVICKY  547



>ref|XP_004147481.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Cucumis sativus]
 gb|KGN59623.1| hypothetical protein Csa_3G829130 [Cucumis sativus]
Length=560

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTM+R+IG +FKIPPA LQSAIT+SIILLMPLYDK  IP+ R+FT   KG+TV QR
Sbjct  349  TKQGMTMERTIGADFKIPPATLQSAITISIILLMPLYDKVLIPITRLFTGTKKGITVMQR  408

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS IAM++AA  + KRL +++N  +L       SI WLLPQYI+LGISDIFTVV
Sbjct  409  MGIGMFLSTIAMILAALIEAKRLTMTKNASSL-------SILWLLPQYIILGISDIFTVV  461

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFYSEVP +MRT G ALY SVFG GSF S+++IS+VE  TS     + WFSD+MKE
Sbjct  462  GMQEFFYSEVPVSMRTTGFALYNSVFGVGSFCSAIMISVVELLTSVEGKPN-WFSDNMKE  520

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            ARLD YYW LA  S +S  L+VI+CK
Sbjct  521  ARLDKYYWLLAFCSGLSFVLYVIWCK  546



>ref|XP_010091949.1| Putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB47729.1| Putative peptide/nitrate transporter [Morus notabilis]
Length=541

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 169/209 (81%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +F+IPPA LQSAIT+SIILLMPLYD+  IP+ R+ T N+KG++V QR
Sbjct  322  TKQGMTMKRNIGSSFQIPPATLQSAITLSIILLMPLYDRVLIPVTRLVTRNEKGISVMQR  381

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            MG GM LS+IAMV AA  +T+RL+ISR  E     SETVP+SIFWLLPQYILLGISDIFT
Sbjct  382  MGTGMCLSIIAMVTAAGVETQRLKISRKAEIHGSHSETVPLSIFWLLPQYILLGISDIFT  441

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFYSEVP  MRT+  ALY SVFG GSF S+LLI++VE  T S  N + WFSDDM
Sbjct  442  VVGMQEFFYSEVPVRMRTMAFALYNSVFGVGSFLSALLITVVEDLTKSKGN-NSWFSDDM  500

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             EARLD YYWFLA+ SA+SL L+ I C+F
Sbjct  501  CEARLDKYYWFLALTSALSLLLYSILCRF  529



>ref|XP_006408492.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
 gb|ESQ49945.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
Length=547

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  321  TKQGMTMKRNIGSSFKIPPATLQSTITLSIILLMPLYDKILIPITKRIKNNGKGISVMER  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  381  MGVGMFLSIIAIVIAAIVERKRLDISQKVKALPDYDPETVPLSIFWLLPQYILLGISDIF  440

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LISIVE ++SS+  +  WF+DD
Sbjct  441  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISIVEAYSSSTGERQNWFADD  500

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLD YYW LA+ S +S  ++++ CK+
Sbjct  501  MSEARLDKYYWLLALTSTLSFVVYIVLCKY  530



>ref|XP_006408493.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
 gb|ESQ49946.1| hypothetical protein EUTSA_v10020393mg [Eutrema salsugineum]
Length=569

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 168/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG +FKIPPA LQS IT+SIILLMPLYDK  IP+ +    N KG++V +R
Sbjct  343  TKQGMTMKRNIGSSFKIPPATLQSTITLSIILLMPLYDKILIPITKRIKNNGKGISVMER  402

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  403  MGVGMFLSIIAIVIAAIVERKRLDISQKVKALPDYDPETVPLSIFWLLPQYILLGISDIF  462

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LISIVE ++SS+  +  WF+DD
Sbjct  463  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISIVEAYSSSTGERQNWFADD  522

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLD YYW LA+ S +S  ++++ CK+
Sbjct  523  MSEARLDKYYWLLALTSTLSFVVYIVLCKY  552



>ref|NP_186784.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9SRI2.1|PTR31_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.9; Short=AtNPF5.9 [Arabidopsis 
thaliana]
 gb|AAF03501.1|AC010676_11 putative peptide transporter [Arabidopsis thaliana]
 gb|AEE73654.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=563

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 166/210 (79%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TMKR+IG NFKIPPA LQS IT+SIILLMPLYDK  IP+ +    N  G++V +R
Sbjct  338  TKQGVTMKRNIGSNFKIPPATLQSTITLSIILLMPLYDKILIPITKRIKKNGTGISVMER  397

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL IS+  + L     ETVP+SIFWLLPQYILLGISDIF
Sbjct  398  MGVGMFLSIIAIVIAAIVERKRLAISQKMKTLPDYDPETVPLSIFWLLPQYILLGISDIF  457

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LISIVE ++SS+ ++  WF+DD
Sbjct  458  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAALISIVEAYSSSTGDRQNWFADD  517

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLD YYW LA+ S +S  +++  CKF
Sbjct  518  MSEARLDKYYWLLALTSTISFVVYIFLCKF  547



>ref|XP_008793798.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X2 [Phoenix 
dactylifera]
Length=484

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MK +IG NF IPPA LQS+IT+SIILLMPLYDK  IP +RVFT ++ G+TV QR
Sbjct  268  TKQGMMMKHNIG-NFVIPPAMLQSSITISIILLMPLYDKLIIPFLRVFTRDENGITVLQR  326

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRN--PENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGM LS++ MV+AA  ++KRL I ++   E+LSS+   +SIFWLLPQYILLGISD+FT
Sbjct  327  IGIGMCLSIVGMVVAALVESKRLGIIKDGAAESLSSKNTQLSIFWLLPQYILLGISDVFT  386

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY +VP  MRT+GIALY SVFG GSF  +LLIS++E  T ++    GW SDD 
Sbjct  387  VVGMQEFFYMQVPTTMRTIGIALYLSVFGVGSFLGALLISVLELTTGANGKNRGWLSDDA  446

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
            +E+RLDNYYWFLAVLS++S  +FV
Sbjct  447  RESRLDNYYWFLAVLSSISFLIFV  470



>ref|XP_008798051.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Phoenix dactylifera]
Length=527

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MK +IG  F IPPA LQS+IT+SIILLMPLYDK  IP +RVFT ++KG+TV QR
Sbjct  313  TKQGMLMKHNIG-KFVIPPAMLQSSITISIILLMPLYDKLIIPFLRVFTHDEKGITVLQR  371

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEI--SRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGM LS++ + +AA  ++KRLEI     P    S    ++IFWLLPQYILLGISD+FT
Sbjct  372  IGIGMCLSIVGVAVAALVESKRLEIIMKGGPGESQSPNTKLNIFWLLPQYILLGISDVFT  431

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQ+FFY++VPA M+T+GIALY SVFG GSF  +LLIS+VE  TS+    HGWFSDD 
Sbjct  432  VVGMQDFFYTQVPATMKTIGIALYLSVFGVGSFLGALLISVVELTTSAEGKNHGWFSDDA  491

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            +++RLDNYYWFLA+LS++S  +FV  C++
Sbjct  492  RQSRLDNYYWFLALLSSISFLIFVYLCRY  520



>ref|XP_008793797.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like isoform X1 [Phoenix 
dactylifera]
Length=528

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MK +IG NF IPPA LQS+IT+SIILLMPLYDK  IP +RVFT ++ G+TV QR
Sbjct  312  TKQGMMMKHNIG-NFVIPPAMLQSSITISIILLMPLYDKLIIPFLRVFTRDENGITVLQR  370

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRN--PENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGM LS++ MV+AA  ++KRL I ++   E+LSS+   +SIFWLLPQYILLGISD+FT
Sbjct  371  IGIGMCLSIVGMVVAALVESKRLGIIKDGAAESLSSKNTQLSIFWLLPQYILLGISDVFT  430

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY +VP  MRT+GIALY SVFG GSF  +LLIS++E  T ++    GW SDD 
Sbjct  431  VVGMQEFFYMQVPTTMRTIGIALYLSVFGVGSFLGALLISVLELTTGANGKNRGWLSDDA  490

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
            +E+RLDNYYWFLAVLS++S  +FV
Sbjct  491  RESRLDNYYWFLAVLSSISFLIFV  514



>ref|XP_010913459.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X2 [Elaeis guineensis]
Length=521

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 165/209 (79%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MK +IG  F IPPA LQS+IT+SIILLMPLYDK  IP +R+FT ++KG+TV QR
Sbjct  307  TKQGMVMKHNIG-KFVIPPAMLQSSITISIILLMPLYDKLIIPFLRIFTRDEKGITVLQR  365

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE--TVPMSIFWLLPQYILLGISDIFT  395
            +GIGM  S++ MV+AA  ++KRL+I     ++ S+     +SIFWLLPQYILLGISD+FT
Sbjct  366  IGIGMCFSIVGMVVAALVESKRLKIIIKEGSVESQAPNTQLSIFWLLPQYILLGISDVFT  425

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY++VPA MRT+GIALY SVFG GSF  +LLIS+VE  TS+    HGWFSDD 
Sbjct  426  VVGMQEFFYTQVPAAMRTIGIALYLSVFGVGSFLGALLISVVELTTSAKGKNHGWFSDDA  485

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            +E+RLDNYYW LA+LS++S  +FV  C++
Sbjct  486  RESRLDNYYWSLALLSSISFLIFVNLCRY  514



>ref|XP_009147425.1| PREDICTED: protein NRT1/ PTR FAMILY 5.9 [Brassica rapa]
Length=571

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IGP+FKIPPA LQS IT+SIILLMPLY+K  IP+ +    N +G++V +R
Sbjct  346  TKQGMTMKRNIGPSFKIPPATLQSTITLSIILLMPLYEKILIPVTKRIKNNGQGISVMER  405

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENL---SSETVPMSIFWLLPQYILLGISDIF  398
            MG+GMFLS+IA+VIAA  + KRL+IS+  + L     ETVP SIFWLLPQYILLGISDIF
Sbjct  406  MGVGMFLSIIAIVIAAIVERKRLDISQKVKTLPDYDPETVPFSIFWLLPQYILLGISDIF  465

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFYSEVP  MRT+G ALYTSVFG GSF S+ LIS+VE +++S+     WF+DD
Sbjct  466  TVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFVSAGLISVVEAYSTSTGEGQNWFADD  525

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            M EARLD YYW LA+ S +S  ++++ CK+
Sbjct  526  MSEARLDKYYWLLALTSTISFVVYIVLCKY  555



>ref|XP_010913458.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X1 [Elaeis guineensis]
Length=552

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 165/209 (79%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MK +IG  F IPPA LQS+IT+SIILLMPLYDK  IP +R+FT ++KG+TV QR
Sbjct  338  TKQGMVMKHNIG-KFVIPPAMLQSSITISIILLMPLYDKLIIPFLRIFTRDEKGITVLQR  396

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE--TVPMSIFWLLPQYILLGISDIFT  395
            +GIGM  S++ MV+AA  ++KRL+I     ++ S+     +SIFWLLPQYILLGISD+FT
Sbjct  397  IGIGMCFSIVGMVVAALVESKRLKIIIKEGSVESQAPNTQLSIFWLLPQYILLGISDVFT  456

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVGMQEFFY++VPA MRT+GIALY SVFG GSF  +LLIS+VE  TS+    HGWFSDD 
Sbjct  457  VVGMQEFFYTQVPAAMRTIGIALYLSVFGVGSFLGALLISVVELTTSAKGKNHGWFSDDA  516

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            +E+RLDNYYW LA+LS++S  +FV  C++
Sbjct  517  RESRLDNYYWSLALLSSISFLIFVNLCRY  545



>ref|XP_010928216.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Elaeis guineensis]
Length=528

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 161/202 (80%), Gaps = 1/202 (0%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MK SIG  F IPPA LQS+IT+SIILLMPLYDK  IP +RVFT ++ G+TV QR
Sbjct  314  TKQGMMMKHSIG-KFVIPPAMLQSSITISIILLMPLYDKLIIPFLRVFTRDENGITVLQR  372

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +GIGM LS++ +V+AAF ++KRL I +     +S    +SIFWLLPQYILLGISD+FTVV
Sbjct  373  IGIGMCLSIVGVVVAAFVESKRLGIMKEGVESTSLNTQLSIFWLLPQYILLGISDVFTVV  432

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY +VP+ MRT+GIAL+ SVFG GSF  +LLIS+VE  TS++   HGW SDD++E
Sbjct  433  GMQEFFYMQVPSTMRTIGIALHLSVFGVGSFLGALLISVVELTTSANGKNHGWLSDDIRE  492

Query  208  ARLDNYYWFLAVLSAVSLTLFV  143
            +RLDNYYWFLAVLS +S  +FV
Sbjct  493  SRLDNYYWFLAVLSFISFLIFV  514



>ref|XP_010033250.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Eucalyptus grandis]
 gb|KCW52838.1| hypothetical protein EUGRSUZ_J02168 [Eucalyptus grandis]
Length=528

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 164/207 (79%), Gaps = 9/207 (4%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM MKR+IG +F IPPA LQSAIT+SIILLMPLYDK  IP+ R+FT N +G+ V QR
Sbjct  318  TKQGMAMKRNIGSHFDIPPATLQSAITLSIILLMPLYDKMLIPITRLFTHNKEGINVMQR  377

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLSVIAMV AA  +TKRLE+ R  ++       +SIFWLLPQYILLGISD+FTVV
Sbjct  378  MGIGMFLSVIAMVTAALVETKRLEMIRRAKD-----AELSIFWLLPQYILLGISDVFTVV  432

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+L+IS++E FT      H WFSDDM E
Sbjct  433  GMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALMISVIEFFTRG----HSWFSDDMSE  488

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLD+YYW LA+ +++SL L+V  CKF
Sbjct  489  ARLDSYYWILALAASLSLLLYVASCKF  515



>ref|XP_006446423.1| hypothetical protein CICLE_v10014849mg [Citrus clementina]
 ref|XP_006470412.1| PREDICTED: putative peptide/nitrate transporter At3g01350-like 
[Citrus sinensis]
 gb|ESR59663.1| hypothetical protein CICLE_v10014849mg [Citrus clementina]
 gb|KDO66304.1| hypothetical protein CISIN_1g009413mg [Citrus sinensis]
Length=535

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 171/207 (83%), Gaps = 5/207 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG NFKIPPA LQSAITVSIILLMPLYDK  IP + +    +KG+TV QR
Sbjct  320  TKQGMTMKRNIGSNFKIPPATLQSAITVSIILLMPLYDKILIPFIHIIIRCEKGITVMQR  379

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            MGIGMFLS+IAM+IAA  +TKRLE+++      SETVP+SIFWLLPQYILLGISDIFTV+
Sbjct  380  MGIGMFLSIIAMIIAAIVETKRLEMNQQ----YSETVPLSIFWLLPQYILLGISDIFTVI  435

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY+EVP  MRT+G ALYTSVFG GSF S+LLI+++E   SSS N   WFSDDMKE
Sbjct  436  GMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALLITVIEAL-SSSRNGRSWFSDDMKE  494

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLD YYW LA+ SA+SL L+V+ CKF
Sbjct  495  ARLDLYYWVLALASALSLLLYVMLCKF  521



>ref|XP_008365497.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like, partial [Malus 
domestica]
Length=503

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 148/183 (81%), Gaps = 3/183 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGMTMKR+IG  FK PPA LQSAIT+SIILLMPLYDK  IP+ R+ T N+KG++V QR
Sbjct  321  TKQGMTMKRNIGSXFKXPPATLQSAITLSIILLMPLYDKIMIPITRLVTSNEKGISVMQR  380

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            MGIGMF+SVIAMVIAA  + KRL+ISR  E L S  ETVP SIFWLLPQYILLGISDIFT
Sbjct  381  MGIGMFVSVIAMVIAAVVEAKRLKISREMEMLGSQPETVPFSIFWLLPQYILLGISDIFT  440

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFYSEVP  MRT+  ALYTSVFG GS+ S+LLI+ VE  TSS   Q  WFSDDM
Sbjct  441  VVGIQEFFYSEVPRRMRTMAFALYTSVFGVGSYLSTLLIATVEAVTSSGGRQS-WFSDDM  499

Query  214  KEA  206
             EA
Sbjct  500  NEA  502



>ref|XP_009413863.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 161/208 (77%), Gaps = 4/208 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            T+QGM M+RSIG    IPPA LQSAIT+SIIL+MPLYDK  IPL+R+ T   KG+ V QR
Sbjct  316  TRQGMMMRRSIGDGITIPPAMLQSAITISIILIMPLYDKLIIPLLRLLTRQGKGINVLQR  375

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNP-ENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            +GIGM LSV+AMV+AA  ++KR+ I R     L S+   ++IFWLLPQY+LLGISD+FTV
Sbjct  376  IGIGMCLSVVAMVVAAVVESKRIGILRTEGSQLDSQ---LTIFWLLPQYVLLGISDVFTV  432

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQEFFY EVP  MRT+GIALY SVFG GSF S+LLIS++E  +++S   H WFSDD +
Sbjct  433  VGMQEFFYMEVPTTMRTIGIALYLSVFGVGSFLSALLISVLESISNTSGKHHNWFSDDTR  492

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            E RLDNYYWFLA+LS++S  +F   C++
Sbjct  493  EGRLDNYYWFLALLSSISFLIFACLCRY  520



>ref|XP_009413865.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=528

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 161/208 (77%), Gaps = 4/208 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            T+QGM M+RSIG    IPPA LQSAIT+SIIL+MPLYDK  IPL+R+ T   KG+ V QR
Sbjct  315  TRQGMMMRRSIGDGITIPPAMLQSAITISIILIMPLYDKLIIPLLRLLTRQGKGINVLQR  374

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNP-ENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            +GIGM LSV+AMV+AA  ++KR+ I R     L S+   ++IFWLLPQY+LLGISD+FTV
Sbjct  375  IGIGMCLSVVAMVVAAVVESKRIGILRTEGSQLDSQ---LTIFWLLPQYVLLGISDVFTV  431

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQEFFY EVP  MRT+GIALY SVFG GSF S+LLIS++E  +++S   H WFSDD +
Sbjct  432  VGMQEFFYMEVPTTMRTIGIALYLSVFGVGSFLSALLISVLESISNTSGKHHNWFSDDTR  491

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            E RLDNYYWFLA+LS++S  +F   C++
Sbjct  492  EGRLDNYYWFLALLSSISFLIFACLCRY  519



>ref|XP_009401528.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8-like [Musa acuminata 
subsp. malaccensis]
Length=513

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 161/207 (78%), Gaps = 4/207 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM M+RSIG +F IPPA LQSAIT+SIIL+MPLYDK  IP +R+ T  +KG+ V QR
Sbjct  308  TKQGMMMRRSIGSSFVIPPAMLQSAITISIILIMPLYDKLIIPFLRLLTRREKGIDVLQR  367

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +GIGM +S++AMV+AA  ++KR    R  E+L  ++  ++IFWLLPQY+LLGISD+FTVV
Sbjct  368  IGIGMCVSIVAMVVAAVVESKR----RTHESLRVDSQRLTIFWLLPQYVLLGISDVFTVV  423

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY +VP  MRT+GI LY SVFG GSF S+LLIS++E  +++    HGWFSDD +E
Sbjct  424  GMQEFFYMQVPTTMRTIGIGLYLSVFGVGSFLSALLISVLELTSNTRGKSHGWFSDDARE  483

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            ARLD YYW LA+LS++S  +F   C++
Sbjct  484  ARLDKYYWILALLSSISFLMFAYLCRY  510



>gb|EAZ00312.1| hypothetical protein OsI_22329 [Oryza sativa Indica Group]
Length=563

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 152/208 (73%), Gaps = 5/208 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM M   +G  F IPPA LQS+ITVSIILLMPLYD   +PL  + T + KG+TV QR
Sbjct  359  TKQGMLMDHRVGAVFVIPPAMLQSSITVSIILLMPLYDTVVVPLTGLVTGHGKGITVLQR  418

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G+GM LS++AM +A   + +RL  + +    SS    +SIFWLLPQY+LLG+SD+FTVV
Sbjct  419  IGVGMVLSIVAMAVAVLVEARRLRAAAS----SSSGGRLSIFWLLPQYVLLGVSDVFTVV  474

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQ-HGWFSDDMK  212
            GMQEFFY++VP+ MRT+GIALY SVFG GSF  + LI+ +E  T++     HGWFSDD +
Sbjct  475  GMQEFFYTQVPSAMRTVGIALYLSVFGVGSFVGAFLITALEMATAAGGGHDHGWFSDDPR  534

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            EARLD YYWFLA+LS VS  +F   CK+
Sbjct  535  EARLDKYYWFLALLSCVSFVVFTHLCKY  562



>ref|XP_003560866.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brachypodium distachyon]
 ref|XP_010227802.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brachypodium distachyon]
 ref|XP_010227804.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Brachypodium distachyon]
Length=538

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 151/208 (73%), Gaps = 11/208 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIG-PNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQ  572
            TKQGM M   +G     IPPA LQS ITVSIILLMPLYD+  IP++ + T + KG+TV Q
Sbjct  339  TKQGMLMDHRVGGSGLVIPPAMLQSTITVSIILLMPLYDRMIIPMISIITRDSKGITVLQ  398

Query  571  RMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            R+G+GM LSV+AMVIAA  +++R  +             MSI WLLPQY+LLG+SD+FTV
Sbjct  399  RIGVGMVLSVVAMVIAAVIESRRRLVVGQ----------MSIAWLLPQYLLLGVSDVFTV  448

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQEFFY++VP  MRT+GIALY SVFG GS   ++LIS +E  T+ ++  HGWFSDD +
Sbjct  449  VGMQEFFYTQVPGAMRTIGIALYLSVFGVGSLVGAMLISAIEMATARNSTSHGWFSDDPR  508

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            EARLD+YYWFLA+L A+S  +F   CK+
Sbjct  509  EARLDSYYWFLALLGAISFVIFTQLCKY  536



>ref|XP_002454309.1| hypothetical protein SORBIDRAFT_04g028390 [Sorghum bicolor]
 gb|EES07285.1| hypothetical protein SORBIDRAFT_04g028390 [Sorghum bicolor]
Length=464

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 151/207 (73%), Gaps = 3/207 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            T+QG+ +   +G  F IPPA LQS+ T+S+ILLMPLYDK FIPL+R+FT  +KG+TV QR
Sbjct  252  TEQGILINHKVGSTFVIPPAMLQSSTTMSVILLMPLYDKIFIPLMRMFTREEKGITVLQR  311

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +GIGM LSV+AMV A+  ++KRL      +  + +   +SIFWLLPQYILLG++D+FTVV
Sbjct  312  IGIGMVLSVVAMVTASIVESKRLHFVSEGDGTTHQ---LSIFWLLPQYILLGVADVFTVV  368

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY++VP  MRT+GIALY SVFGFG+F  + LI +++  T+     HGWFSDD ++
Sbjct  369  GMQEFFYTQVPNTMRTIGIALYVSVFGFGNFLGAFLIEVLKTTTARMGEGHGWFSDDPRQ  428

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
              LD YYWFLA +  VS   F   CK+
Sbjct  429  EHLDKYYWFLAFVGTVSFVFFTYLCKY  455



>ref|XP_006656833.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide/nitrate transporter 
At5g14940-like [Oryza brachyantha]
Length=541

 Score =   222 bits (566),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 150/208 (72%), Gaps = 11/208 (5%)
 Frame = -2

Query  748  TKQGMTM-KRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQ  572
            T+QGM M  R  G  F IPPA LQS+ITVSIILLMPLYD+  +PL  + T + KGVTV Q
Sbjct  343  TRQGMAMDHRVAGGAFVIPPAMLQSSITVSIILLMPLYDRMVVPLAGLVTGDGKGVTVLQ  402

Query  571  RMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            R+G+GM LS++AM +AA  + +RL    +          +SI WLLPQY+LLG+SD+F V
Sbjct  403  RIGVGMVLSIVAMAVAALVEARRLRXGAS----------LSIAWLLPQYVLLGVSDVFAV  452

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQEFFY++VP  MRT+GIALY SVFG GSF  + LI+ +E  T+++A  HGWFSDD +
Sbjct  453  VGMQEFFYTQVPGAMRTVGIALYLSVFGVGSFLGAFLITAIEMATATAAGGHGWFSDDPR  512

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            EA LD YYWFLA+LS VS  +FV  CK+
Sbjct  513  EAHLDRYYWFLALLSCVSFVVFVHLCKY  540



>ref|XP_002438139.1| hypothetical protein SORBIDRAFT_10g008670 [Sorghum bicolor]
 gb|EER89506.1| hypothetical protein SORBIDRAFT_10g008670 [Sorghum bicolor]
Length=538

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 152/213 (71%), Gaps = 12/213 (6%)
 Frame = -2

Query  748  TKQGMTMKRSIG---PNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTV  578
            TKQGM M  +IG    +F IPPA LQS+ITVSIILL+P+YD+  IPL+   T    G+TV
Sbjct  328  TKQGMLMDHTIGVGSGSFVIPPAMLQSSITVSIILLVPMYDRMIIPLINAVTGGSDGITV  387

Query  577  RQRMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIF  398
             QR+G+GM LSV+AMV AA  ++ RL +        +  V ++IFWLLPQY+LLGISD+F
Sbjct  388  LQRIGVGMVLSVVAMVTAALVESWRLRV--------APAVRLTIFWLLPQYVLLGISDVF  439

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            TVVGMQEFFY++VPA+MRT GI LY SVFG G F  + LI+ +E  T+   N  GWFSDD
Sbjct  440  TVVGMQEFFYTQVPASMRTTGIGLYLSVFGVGGFLGAFLITALEMATARPGNARGWFSDD  499

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK-FNG  122
             +EARLDN+YWFLA+L  +S  +F   CK +NG
Sbjct  500  PREARLDNFYWFLALLCFISFVIFTHLCKYYNG  532



>ref|XP_006432899.1| hypothetical protein CICLE_v10003886mg [Citrus clementina]
 ref|XP_006494124.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Citrus sinensis]
 gb|ESR46139.1| hypothetical protein CICLE_v10003886mg [Citrus clementina]
Length=508

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 150/191 (79%), Gaps = 8/191 (4%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLND--KGVTVR  575
            TKQGM MKR+IG  FKIPPA LQSAITVSIILLMPLYD   IP++++ T     KG++V 
Sbjct  323  TKQGMAMKRNIGSRFKIPPATLQSAITVSIILLMPLYDTVLIPIIQIITCYQFKKGISVM  382

Query  574  QRMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            QRMGIGMFL+ IAMVIAA  +TKRL+ S+      +E  P++IFWLLP+Y+LLGISDIFT
Sbjct  383  QRMGIGMFLTSIAMVIAAAVETKRLQRSKQ-----AEAKPITIFWLLPEYVLLGISDIFT  437

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VV MQEFFY+EV   MRT+G ALYTSVFG GSF S+LLIS++E FTSS A Q  WFSDDM
Sbjct  438  VVAMQEFFYNEVSVRMRTMGFALYTSVFGVGSFLSALLISVIEFFTSSRARQ-SWFSDDM  496

Query  214  KEARLDNYYWF  182
             +AR+++  +F
Sbjct  497  TQARMNDIIFF  507



>ref|XP_004965110.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like 
[Setaria italica]
Length=525

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 145/207 (70%), Gaps = 8/207 (4%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM M   +G  F +PPA LQS+IT+SIILL+P+YD+  IPL    T   +G+TV QR
Sbjct  318  TKQGMLMDHKLGA-FVVPPAMLQSSITISIILLVPMYDRVIIPLFNAVTRGTEGITVFQR  376

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G+GM LSV+AMV AA  ++ RL ++     L        IFWLLPQY+LLG+SD+FTVV
Sbjct  377  IGVGMVLSVVAMVTAALVESWRLRVANASARL-------KIFWLLPQYVLLGVSDVFTVV  429

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY++VPA+MRT+GI LY SVFG G F  + LI+ +E  T+   N  GWFSDD +E
Sbjct  430  GMQEFFYTQVPASMRTIGIGLYLSVFGVGGFLGAFLITALEMATARPGNSRGWFSDDARE  489

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            A LDNYYWFLA L  +S  +F   CKF
Sbjct  490  AHLDNYYWFLAFLCFISFLIFTHLCKF  516



>ref|NP_001057261.1| Os06g0239500 [Oryza sativa Japonica Group]
 dbj|BAD37875.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAD37912.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAF19175.1| Os06g0239500 [Oryza sativa Japonica Group]
 dbj|BAG89295.1| unnamed protein product [Oryza sativa Japonica Group]
Length=535

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 152/210 (72%), Gaps = 7/210 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM M   +G  F IPPA LQS+ITVSIILLMPLYD   +PL  +   + KG+TV QR
Sbjct  329  TKQGMLMDHRVGAVFVIPPAMLQSSITVSIILLMPLYDTVVVPLAGLVAGHGKGITVLQR  388

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G+GM LS++AM +AA  + +RL  + +    SS    +SIFWLLPQY+LLG+SD+FTVV
Sbjct  389  IGVGMVLSIVAMAVAALVEARRLRAAAS----SSSGGRLSIFWLLPQYVLLGVSDVFTVV  444

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTS---SSANQHGWFSDD  218
            GMQEFFY++VP+ MRT+GIALY SVFG GSF  + LI+ +E  T+      + HGWFSDD
Sbjct  445  GMQEFFYTQVPSAMRTVGIALYLSVFGVGSFVGAFLITALEMVTAGGGGGGHDHGWFSDD  504

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             +EARLD YYWFLA+LS VS  +F   CK+
Sbjct  505  PREARLDKYYWFLALLSCVSFVVFTHLCKY  534



>gb|ABK25104.1| unknown [Picea sitchensis]
Length=604

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 160/206 (78%), Gaps = 3/206 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R IG NF+IP A+LQS I++SI++L+P+YD+ F+P+ R  T N++G+T+ QR
Sbjct  380  TKQGSTMDRKIGENFEIPAASLQSFISLSILVLVPVYDRIFVPVARSITKNERGITLLQR  439

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNP--ENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIG+F+S+++M +AA T+ KRL+++++   E++   T+P+SIFWLLPQYIL GISD+FT
Sbjct  440  IGIGIFISILSMTVAALTEMKRLQVAKDYGFEDMPHATIPLSIFWLLPQYILFGISDVFT  499

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            ++G+QE+FY ++P  MR++GIALY SVFG GSF SS  ISI+E   SS   +  WF+D++
Sbjct  500  MIGLQEYFYDQMPDTMRSVGIALYLSVFGIGSFLSSFFISIIEEL-SSGGKEQSWFADNL  558

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIF  137
              A LD +YWFLA LSA+ L ++V F
Sbjct  559  NRAHLDYFYWFLAALSALFLCIYVTF  584



>dbj|BAD37873.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAD37910.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 gb|EAZ36431.1| hypothetical protein OsJ_20761 [Oryza sativa Japonica Group]
Length=521

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 152/210 (72%), Gaps = 11/210 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM M   +G  F IPPA LQS+ITVSIILLMPLYD+  +PL    T + KG+TV QR
Sbjct  319  TKQGMLMDHRVGAVFVIPPAMLQSSITVSIILLMPLYDRVVVPL----TGHGKGITVLQR  374

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G+GM LS++AM +AA  + +R   + +    SS    +SIFWLLPQY+LLG+SD+FTVV
Sbjct  375  IGVGMVLSIVAMAVAALVEARRPRAAAS----SSSGGRLSIFWLLPQYVLLGVSDVFTVV  430

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTS---SSANQHGWFSDD  218
            GMQEFFY++VP+ MRT+GIALY SVFG GSF  + LI+ +E  T+      + HGWFSDD
Sbjct  431  GMQEFFYTQVPSAMRTVGIALYLSVFGVGSFVGAFLITALEMATAGGGGGGHDHGWFSDD  490

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             +EARLD YYWFLA+LS VS  +F   CK+
Sbjct  491  PREARLDKYYWFLALLSCVSFVVFTHLCKY  520



>gb|ERN18357.1| hypothetical protein AMTR_s00055p00208320 [Amborella trichopoda]
Length=509

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 148/202 (73%), Gaps = 10/202 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TMKR+IG  F+IPPAALQS I + II+LMP+YD   IP++++ T +DKG+   QR
Sbjct  299  TKQGSTMKRNIGEKFQIPPAALQSTINLCIIMLMPIYDSILIPILKIITQDDKGIDTLQR  358

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +GIGMF S+ +M+IAA T++KRL              P++I WLLPQY+LLG+SD+F VV
Sbjct  359  IGIGMFFSITSMIIAALTESKRLH----------SVHPINICWLLPQYVLLGVSDVFMVV  408

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFYS+V   M+T+GIALY SVFG G + S++LIS+VE  T+ +     WFSD++ +
Sbjct  409  GIQEFFYSQVSGGMKTMGIALYLSVFGVGGYLSAILISLVEMLTTMNGASSSWFSDNLSK  468

Query  208  ARLDNYYWFLAVLSAVSLTLFV  143
            ARLD YY  LAVLS +S+ LFV
Sbjct  469  ARLDCYYGLLAVLSIMSMILFV  490



>ref|XP_004953900.1| PREDICTED: LOW QUALITY PROTEIN: putative peptide/nitrate transporter 
At3g01350-like [Setaria italica]
Length=528

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 152/207 (73%), Gaps = 5/207 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            T  GM M   +G  F IPPA LQS+ T+S+ILLMPLYDK F+PL+R+FT  +KG+TV QR
Sbjct  318  TNHGMLMNHKVGSTFVIPPATLQSSTTMSVILLMPLYDKIFVPLMRLFTREEKGITVLQR  377

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
             GIGM LSV+AMV+AA  ++KRL ++        +   +SIFWLLPQYILLG++D+FTVV
Sbjct  378  TGIGMVLSVVAMVVAAAVESKRLHLTSE-----GDATQLSIFWLLPQYILLGVADVFTVV  432

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            GMQEFFY++VP+++RT GIALY SVFGFGSF  + LIS++E  T+     HGWFSDD ++
Sbjct  433  GMQEFFYTQVPSSLRTTGIALYLSVFGFGSFLGAFLISVLEMTTAMLGEGHGWFSDDPQQ  492

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             RLD YY FLA++S +    F   CK+
Sbjct  493  ERLDKYYLFLALVSTIGFVFFTYLCKY  519



>ref|XP_011627979.1| PREDICTED: protein NRT1/ PTR FAMILY 5.8 [Amborella trichopoda]
Length=577

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 148/202 (73%), Gaps = 10/202 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TMKR+IG  F+IPPAALQS I + II+LMP+YD   IP++++ T +DKG+   QR
Sbjct  367  TKQGSTMKRNIGEKFQIPPAALQSTINLCIIMLMPIYDSILIPILKIITQDDKGIDTLQR  426

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +GIGMF S+ +M+IAA T++KRL              P++I WLLPQY+LLG+SD+F VV
Sbjct  427  IGIGMFFSITSMIIAALTESKRLH----------SVHPINICWLLPQYVLLGVSDVFMVV  476

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFYS+V   M+T+GIALY SVFG G + S++LIS+VE  T+ +     WFSD++ +
Sbjct  477  GIQEFFYSQVSGGMKTMGIALYLSVFGVGGYLSAILISLVEMLTTMNGASSSWFSDNLSK  536

Query  208  ARLDNYYWFLAVLSAVSLTLFV  143
            ARLD YY  LAVLS +S+ LFV
Sbjct  537  ARLDCYYGLLAVLSIMSMILFV  558



>gb|EPS62614.1| hypothetical protein M569_12174, partial [Genlisea aurea]
Length=486

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 145/205 (71%), Gaps = 12/205 (6%)
 Frame = -2

Query  748  TKQGMTMKRSI-GPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQ  572
            TKQGMTM R+I G  FKIPPAALQSAIT+SII+LMPLYDK F+PL R+ T ++ GV+V Q
Sbjct  293  TKQGMTMNRTIAGGRFKIPPAALQSAITISIIVLMPLYDKLFVPLARLLTRDENGVSVEQ  352

Query  571  RMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            RM +GM  +V +M +AA  + +R         LS    PM+I WLLPQY+LLGISD+FTV
Sbjct  353  RMSVGMIFAVASMAVAAAVEKRR---------LSKIETPMTIAWLLPQYVLLGISDVFTV  403

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQEFFY EVP  MRT+GIALYTSVFGFGS   ++LI+++E  T       GWFSDD  
Sbjct  404  VGMQEFFYGEVPEGMRTVGIALYTSVFGFGSLLGAILITVIEWLTKDEGGGGGWFSDD--  461

Query  211  EARLDNYYWFLAVLSAVSLTLFVIF  137
            + RLD YYW L   S  S   F+IF
Sbjct  462  DTRLDKYYWLLGSASFFSFIAFLIF  486



>ref|XP_011464751.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Fragaria vesca 
subsp. vesca]
Length=557

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R+I P F IP A+LQS I ++II+ +P+YD+ F+P  R FT    G+T+ QR
Sbjct  341  TKQGATMDRTIVPGFDIPAASLQSFIGLTIIIFIPIYDRIFVPTARAFTREPSGITMLQR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+F S+I+MV+AA  + KRL+ + + +  +L S T+PMSI+WL+PQY+L G++D+FT
Sbjct  401  IGTGIFFSIISMVVAALVEIKRLQTAEDYDLVDLPSATIPMSIWWLVPQYLLYGLADVFT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQEFFY +VP  +R++G+ALY S+ G GSF SS LISI+E  T S+A Q  WFSD++
Sbjct  461  MVGMQEFFYDQVPNELRSVGLALYLSIIGVGSFLSSFLISIIEDAT-SAAGQTSWFSDNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LSAV L +++ F K
Sbjct  520  NTAHLDYFYWLLAALSAVGLAVYIYFAK  547



>ref|XP_010665406.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X3 [Vitis 
vinifera]
Length=530

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG    IP ++LQ  I +SI+L++P+YD+  +P+ R  T    G+T+ QR
Sbjct  314  TKQGITMDRSIGWGIDIPASSLQGFIGLSIVLIVPIYDRILVPIARTLTRKPSGITMLQR  373

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MV+AA  + KRL+ ++     ++ + T+PMS++WLLPQYIL G+SD+ T
Sbjct  374  IGTGMFLSAISMVVAALVEMKRLKTAQEHGLVDMPNVTLPMSVWWLLPQYILFGVSDVVT  433

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++GIALY S+ G G+F SS LIS +E  T     QH WF+D++
Sbjct  434  IVGLQEFFYDQVPTELRSVGIALYLSILGVGNFLSSFLISAIEKATGGDG-QHSWFNDNL  492

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LDNYYW LA LSAV L+L++ F K
Sbjct  493  NRAHLDNYYWVLAGLSAVGLSLYLYFAK  520



>ref|XP_003634604.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Vitis 
vinifera]
Length=572

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG    IP ++LQ  I +SI+L++P+YD+  +P+ R  T    G+T+ QR
Sbjct  356  TKQGITMDRSIGWGIDIPASSLQGFIGLSIVLIVPIYDRILVPIARTLTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MV+AA  + KRL+ ++     ++ + T+PMS++WLLPQYIL G+SD+ T
Sbjct  416  IGTGMFLSAISMVVAALVEMKRLKTAQEHGLVDMPNVTLPMSVWWLLPQYILFGVSDVVT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++GIALY S+ G G+F SS LIS +E  T     QH WF+D++
Sbjct  476  IVGLQEFFYDQVPTELRSVGIALYLSILGVGNFLSSFLISAIEKATGGDG-QHSWFNDNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LDNYYW LA LSAV L+L++ F K
Sbjct  535  NRAHLDNYYWVLAGLSAVGLSLYLYFAK  562



>ref|XP_010665405.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Vitis 
vinifera]
Length=584

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG    IP ++LQ  I +SI+L++P+YD+  +P+ R  T    G+T+ QR
Sbjct  368  TKQGITMDRSIGWGIDIPASSLQGFIGLSIVLIVPIYDRILVPIARTLTRKPSGITMLQR  427

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MV+AA  + KRL+ ++     ++ + T+PMS++WLLPQYIL G+SD+ T
Sbjct  428  IGTGMFLSAISMVVAALVEMKRLKTAQEHGLVDMPNVTLPMSVWWLLPQYILFGVSDVVT  487

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++GIALY S+ G G+F SS LIS +E  T     QH WF+D++
Sbjct  488  IVGLQEFFYDQVPTELRSVGIALYLSILGVGNFLSSFLISAIEKATGGDG-QHSWFNDNL  546

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LDNYYW LA LSAV L+L++ F K
Sbjct  547  NRAHLDNYYWVLAGLSAVGLSLYLYFAK  574



>ref|XP_010665404.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X2 [Vitis vinifera]
Length=465

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSIG  F IP A+LQ+ I +SI+L++P+YD+ F+P+ R  T    G+T+ QR
Sbjct  249  TKQGFTMDRSIGSGFDIPAASLQAFIGLSIVLIIPIYDRIFVPIARTLTRKPSGITMLQR  308

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MVIAA  + KRL+ ++     ++ + T+PM ++WLLPQYIL GI+D+FT
Sbjct  309  IGTGMFLSGISMVIAALVEMKRLKTAQEHSLVDVPNATLPMKVWWLLPQYILFGITDVFT  368

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFY +VP  +R++G+AL   +FG GSF SS LIS +E  T     QH WF++++
Sbjct  369  VVGLQEFFYDQVPTELRSVGLALCHCIFGVGSFLSSFLISGIEKATGGDG-QHSWFNNNV  427

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD YYW LA LSAV L+L++ F +
Sbjct  428  NRAHLDYYYWVLAGLSAVGLSLYLYFAR  455



>emb|CAN75422.1| hypothetical protein VITISV_011767 [Vitis vinifera]
Length=584

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG    IP ++LQ  I +SI+L++P+YD+  +P+ R  T    G+T+ QR
Sbjct  368  TKQGITMDRSIGWGIDIPASSLQGFIGLSIVLIVPIYDRILVPIARTLTRKPSGITMLQR  427

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MV+AA  + KRL+ ++     ++ + T+PMS++WLLPQYIL G+SD+FT
Sbjct  428  IGTGMFLSAISMVVAALVEMKRLKTAQEHGLVDMPNVTLPMSVWWLLPQYILFGVSDVFT  487

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++GIALY S+ G G+F SS LIS +E  T     QH WF+D++
Sbjct  488  IVGLQEFFYDQVPTELRSVGIALYLSILGVGNFLSSFLISAIEKATGGDG-QHSWFNDNL  546

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD YYW LA LSAV L+L++ F K
Sbjct  547  NRAHLDXYYWVLAGLSAVGLSLYLYFAK  574



>ref|XP_006416187.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
 gb|ESQ34540.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
Length=364

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P +KI PA LQS I++SI++ +PLYD+  IP+ R +T    G+T+ QR
Sbjct  148  TKQGATMERSITPGYKISPATLQSFISLSIVIFLPLYDRVLIPIARSYTHKPGGITMLQR  207

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L G+SD+FT
Sbjct  208  IGTGLFLSFLAMVIAALVEMKRLKTAADYGLVDSPDATVPMSVWWLVPQYVLFGVSDVFT  267

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS +IS++E  TS S  Q  WF++++
Sbjct  268  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGSFLSSFMISVIEKATSQS-GQVSWFANNL  326

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA  S + L  ++ F K
Sbjct  327  NQAHLDYFYWLLACFSFIGLASYLYFAK  354



>ref|XP_010095904.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62498.1| putative peptide/nitrate transporter [Morus notabilis]
Length=561

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+R+I P F IPPA+LQS +++++++ +P+YD+  +P+ R FT    G+T+ QR
Sbjct  347  TKQGATMERTIVPGFDIPPASLQSTVSLAVLVFIPIYDRVVVPVARAFTGKPSGITMLQR  406

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLSV++M+IAA  + KRL+ +R  +  +    TVPMS++WLLPQYIL GISD+FT
Sbjct  407  IGTGMFLSVLSMIIAALVEIKRLQTAREYDLVDTPGMTVPMSVWWLLPQYILSGISDVFT  466

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG GSF SS LISI+E  T     +H WFS+++
Sbjct  467  MVGLQEFFYDQVPTELRSIGLSLYLSIFGVGSFLSSFLISIIEEATGGDG-RHSWFSNNL  525

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD YYW L  LS+V+L L+  F +
Sbjct  526  NKAHLDYYYWLLTGLSSVALFLYWYFAR  553



>ref|XP_010683110.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RS+GPNF IPPA+LQS I++S++L +P+YD+  +P+ R FT    G+ + QR
Sbjct  358  TKQGLTMDRSLGPNFSIPPASLQSFISLSVVLFIPIYDRILVPISRTFTGKPAGIAMLQR  417

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGM +S I+M+IAA  + KRLE +      ++ + TVPMS++WL+PQY+L G+SD+FT
Sbjct  418  IGIGMLISAISMIIAAIVEKKRLETALEYGLIDIPNATVPMSVWWLVPQYVLFGVSDVFT  477

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY SVFG GS  SSL+IS+++  T S+  Q  WFS ++
Sbjct  478  MVGLQEFFYDQVPTELRSVGLSLYLSVFGVGSLLSSLMISVIDKVTGSN-GQDSWFSSNL  536

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
                LD +Y  LA  SA+ +T+FV F K
Sbjct  537  NRGHLDYFYCLLAAFSAIEITVFVYFAK  564



>ref|XP_004499763.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
isoform X1 [Cicer arietinum]
 ref|XP_004499764.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
isoform X2 [Cicer arietinum]
Length=543

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG+TM R I P F +PPA+LQS I++SI+L +P+YD+  +P+ R FT    G+T+ QR+
Sbjct  329  KQGVTMDRKILPTFNVPPASLQSFISLSIVLFIPVYDRIIVPIARAFTGKPSGITMLQRI  388

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFTV  392
            G+GMF SVI+MV+AAF + KRL+++R+    ++ + T+PMSI+WL+PQY+L G+SD+FT+
Sbjct  389  GVGMFFSVISMVVAAFVEMKRLKVARDHGLLDMPNVTIPMSIWWLIPQYVLFGVSDVFTM  448

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            +G+QEFFY +VP  +R++G+ALY S+FG GSF SS LIS ++  TS      GWF+ ++ 
Sbjct  449  IGLQEFFYDQVPDELRSIGLALYLSIFGVGSFLSSFLISAIQKGTSKDGCD-GWFASNLN  507

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCK  131
             A LD +Y  LAVLSAV L+ F  F K
Sbjct  508  RAHLDYFYALLAVLSAVELSAFWFFSK  534



>ref|NP_001169556.1| uncharacterized protein LOC100383435 [Zea mays]
 ref|XP_008658870.1| PREDICTED: uncharacterized protein LOC100383435 isoform X1 [Zea 
mays]
 gb|ACN34117.1| unknown [Zea mays]
Length=447

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 149/212 (70%), Gaps = 14/212 (7%)
 Frame = -2

Query  748  TKQGMTMKRSIG-----PNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGV  584
            TKQGM M  +IG      +  IPPA LQS+ITVSIILL+P+YD+  +PL    T    G+
Sbjct  236  TKQGMLMNHTIGVGVGSGSLVIPPAMLQSSITVSIILLVPMYDRMIVPLTNAVTGGSDGI  295

Query  583  TVRQRMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISD  404
            TV QR+G+GM LSV+AMV AA  +++RL          +E   +SIFWLLPQY+LLG+SD
Sbjct  296  TVLQRIGVGMVLSVVAMVAAALVESRRLR---------AEPALLSIFWLLPQYVLLGVSD  346

Query  403  IFTVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFS  224
            +FTVVGMQEFFYS+VPA+MRT GI LY SVFG G F  + LI+++E  T+   N  GWFS
Sbjct  347  VFTVVGMQEFFYSQVPASMRTTGIGLYLSVFGVGGFLGASLITLLEMATARPGNARGWFS  406

Query  223  DDMKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            DD +EAR+DN+YWFLA+L  VS  +F   CK+
Sbjct  407  DDPREARIDNFYWFLALLCFVSFVVFTHLCKY  438



>dbj|BAK01715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 147/208 (71%), Gaps = 11/208 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIGPN-FKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQ  572
            TKQG  M   +G   F IPPA LQS ITVSII++MPLYD+  IPL+ V T N KG+TV Q
Sbjct  323  TKQGTLMDHCVGGGAFVIPPATLQSTITVSIIIIMPLYDRVIIPLIGVVTRNSKGITVLQ  382

Query  571  RMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            R+G+GM  S++AMVIAA  +++R   +            M+I WLLPQY+LLG+SD+FTV
Sbjct  383  RIGVGMVFSIVAMVIAALVESRRRHEAAG---------QMNIAWLLPQYVLLGVSDVFTV  433

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQ-HGWFSDDM  215
            VGMQEFFYS+VP  MRT+GI LY SVFG GS   +LLI+ +E  T+  A + HGWFSDD 
Sbjct  434  VGMQEFFYSQVPDTMRTIGIGLYLSVFGVGSLVGTLLIAAIEVATAGGAGKGHGWFSDDP  493

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            +E RLDNYYWFL +LS++S  +F   C+
Sbjct  494  REERLDNYYWFLVLLSSISFLIFTQLCR  521



>dbj|BAJ94556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 147/208 (71%), Gaps = 11/208 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIGPN-FKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQ  572
            TKQG  M   +G   F IPPA LQS ITVSII++MPLYD+  IPL+ V T N KG+TV Q
Sbjct  323  TKQGTLMDHRVGGGAFVIPPATLQSTITVSIIIIMPLYDRVIIPLIGVVTRNSKGITVLQ  382

Query  571  RMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTV  392
            R+G+GM  S++AMVIAA  +++R   +            M+I WLLPQY+LLG+SD+FTV
Sbjct  383  RIGVGMVFSIVAMVIAALVESRRRHEAAG---------QMNIAWLLPQYVLLGVSDVFTV  433

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQ-HGWFSDDM  215
            VGMQEFFYS+VP  MRT+GI LY SVFG GS   +LLI+ +E  T+  A + HGWFSDD 
Sbjct  434  VGMQEFFYSQVPDTMRTIGIGLYLSVFGVGSLVGTLLIAAIEVATAGGAGKGHGWFSDDP  493

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            +E RLDNYYWFL +LS++S  +F   C+
Sbjct  494  REERLDNYYWFLVLLSSISFLIFTQLCR  521



>ref|XP_010245117.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X3 [Nelumbo 
nucifera]
Length=530

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+RSI P F+IPPA LQS I+++I++ +P+YD+  +P+ R +T    G+T+ QR
Sbjct  314  TKQGLTMERSITPGFEIPPATLQSFISIAIVVFIPIYDRIIVPIARAYTGKPSGITMLQR  373

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS+I+MV+AA  + +RL+++R+    ++   T+PMS++WL+PQY+L G+SD+FT
Sbjct  374  IGTGMFLSLISMVVAAIVEKERLKVARDSGLVDMPQVTLPMSVWWLVPQYVLFGVSDVFT  433

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG G+F SS LIS++E  T S   Q  WF++++
Sbjct  434  MVGLQEFFYDQVPNGLRSMGLSLYLSIFGIGNFLSSFLISVIEKAT-SRGGQDSWFANNL  492

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LS + L L++ F K
Sbjct  493  NRAHLDWFYWLLAGLSVIELILYLYFAK  520



>gb|KHN47085.1| Putative peptide/nitrate transporter [Glycine soja]
Length=563

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM R I P F +PPA+LQS I++SI+L +P+YD+  +P+ R FT    G+T+ QR
Sbjct  348  TKQGVTMDREILPGFYVPPASLQSIISLSIVLFIPIYDRIIVPVARAFTGKPSGITMLQR  407

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM LS I+MVIAAF + KRL+++R+    ++ + T+PMSI+WL+PQY L GI+D+F 
Sbjct  408  IGTGMLLSAISMVIAAFVEMKRLKVARDCGLIDMPNVTIPMSIWWLVPQYALFGIADVFA  467

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG GSF S  LIS +E+ T    N+H WFS ++
Sbjct  468  MVGLQEFFYDQVPQELRSVGLSLYLSIFGVGSFLSGFLISAIENVTGKD-NRHSWFSSNL  526

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +Y  LA LSAV L++F  F K
Sbjct  527  NRAHLDYFYALLAALSAVELSVFWFFSK  554



>emb|CBI39334.3| unnamed protein product [Vitis vinifera]
Length=755

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG    IP ++LQ  I +SI+L++P+YD+  +P+ R  T    G+T+ QR
Sbjct  356  TKQGITMDRSIGWGIDIPASSLQGFIGLSIVLIVPIYDRILVPIARTLTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MV+AA  + KRL+ ++     ++ + T+PMS++WLLPQYIL G+SD+ T
Sbjct  416  IGTGMFLSAISMVVAALVEMKRLKTAQEHGLVDMPNVTLPMSVWWLLPQYILFGVSDVVT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++GIALY S+ G G+F SS LIS +E  T     QH WF+D++
Sbjct  476  IVGLQEFFYDQVPTELRSVGIALYLSILGVGNFLSSFLISAIEKATGGDG-QHSWFNDNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LDNYYW LA LSAV L+L++ F K
Sbjct  535  NRAHLDNYYWVLAGLSAVGLSLYLYFAK  562



>ref|XP_003523479.1| PREDICTED: probable peptide/nitrate transporter At1g22540 [Glycine 
max]
Length=563

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM R I P F +PPA+LQS I++SI+L +P+YD+  +P+ R FT    G+T+ QR
Sbjct  348  TKQGVTMDREILPGFYVPPASLQSIISLSIVLFIPIYDRIIVPVARAFTGKPSGITMLQR  407

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM LS I+MVIAAF + KRL+++R+    ++ + T+PMSI+WL+PQY L GI+D+F 
Sbjct  408  IGTGMLLSAISMVIAAFVEMKRLKVARDCGLIDMPNVTIPMSIWWLVPQYALFGIADVFA  467

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG GSF S  LIS +E+ T    N+H WFS ++
Sbjct  468  MVGLQEFFYDQVPQELRSVGLSLYLSIFGVGSFLSGFLISAIENVTGKD-NRHSWFSSNL  526

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +Y  LA LSAV L++F  F K
Sbjct  527  NRAHLDYFYALLAALSAVELSVFWFFSK  554



>ref|XP_002265311.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X1 [Vitis vinifera]
 emb|CBI39336.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSIG  F IP A+LQ+ I +SI+L++P+YD+ F+P+ R  T    G+T+ QR
Sbjct  358  TKQGFTMDRSIGSGFDIPAASLQAFIGLSIVLIIPIYDRIFVPIARTLTRKPSGITMLQR  417

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MVIAA  + KRL+ ++     ++ + T+PM ++WLLPQYIL GI+D+FT
Sbjct  418  IGTGMFLSGISMVIAALVEMKRLKTAQEHSLVDVPNATLPMKVWWLLPQYILFGITDVFT  477

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFY +VP  +R++G+AL   +FG GSF SS LIS +E  T     QH WF++++
Sbjct  478  VVGLQEFFYDQVPTELRSVGLALCHCIFGVGSFLSSFLISGIEKATGGDG-QHSWFNNNV  536

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD YYW LA LSAV L+L++ F +
Sbjct  537  NRAHLDYYYWVLAGLSAVGLSLYLYFAR  564



>ref|XP_008658869.1| PREDICTED: uncharacterized protein LOC100383435 isoform X2 [Zea 
mays]
 gb|ACN35262.1| unknown [Zea mays]
 gb|AFW85189.1| hypothetical protein ZEAMMB73_094848 [Zea mays]
Length=542

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 149/212 (70%), Gaps = 14/212 (7%)
 Frame = -2

Query  748  TKQGMTMKRSIG-----PNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGV  584
            TKQGM M  +IG      +  IPPA LQS+ITVSIILL+P+YD+  +PL    T    G+
Sbjct  331  TKQGMLMNHTIGVGVGSGSLVIPPAMLQSSITVSIILLVPMYDRMIVPLTNAVTGGSDGI  390

Query  583  TVRQRMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISD  404
            TV QR+G+GM LSV+AMV AA  +++RL          +E   +SIFWLLPQY+LLG+SD
Sbjct  391  TVLQRIGVGMVLSVVAMVAAALVESRRLR---------AEPALLSIFWLLPQYVLLGVSD  441

Query  403  IFTVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFS  224
            +FTVVGMQEFFYS+VPA+MRT GI LY SVFG G F  + LI+++E  T+   N  GWFS
Sbjct  442  VFTVVGMQEFFYSQVPASMRTTGIGLYLSVFGVGGFLGASLITLLEMATARPGNARGWFS  501

Query  223  DDMKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            DD +EAR+DN+YWFLA+L  VS  +F   CK+
Sbjct  502  DDPREARIDNFYWFLALLCFVSFVVFTHLCKY  533



>ref|XP_010245116.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Nelumbo 
nucifera]
Length=578

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+RSI P F+IPPA LQS I+++I++ +P+YD+  +P+ R +T    G+T+ QR
Sbjct  362  TKQGLTMERSITPGFEIPPATLQSFISIAIVVFIPIYDRIIVPIARAYTGKPSGITMLQR  421

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS+I+MV+AA  + +RL+++R+    ++   T+PMS++WL+PQY+L G+SD+FT
Sbjct  422  IGTGMFLSLISMVVAAIVEKERLKVARDSGLVDMPQVTLPMSVWWLVPQYVLFGVSDVFT  481

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG G+F SS LIS++E  T S   Q  WF++++
Sbjct  482  MVGLQEFFYDQVPNGLRSMGLSLYLSIFGIGNFLSSFLISVIEKAT-SRGGQDSWFANNL  540

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LS + L L++ F K
Sbjct  541  NRAHLDWFYWLLAGLSVIELILYLYFAK  568



>ref|XP_010245115.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Nelumbo 
nucifera]
Length=580

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 156/208 (75%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+RSI P F+IPPA LQS I+++I++ +P+YD+  +P+ R +T    G+T+ QR
Sbjct  364  TKQGLTMERSITPGFEIPPATLQSFISIAIVVFIPIYDRIIVPIARAYTGKPSGITMLQR  423

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS+I+MV+AA  + +RL+++R+    ++   T+PMS++WL+PQY+L G+SD+FT
Sbjct  424  IGTGMFLSLISMVVAAIVEKERLKVARDSGLVDMPQVTLPMSVWWLVPQYVLFGVSDVFT  483

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG G+F SS LIS++E  T S   Q  WF++++
Sbjct  484  MVGLQEFFYDQVPNGLRSMGLSLYLSIFGIGNFLSSFLISVIEKAT-SRGGQDSWFANNL  542

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LS + L L++ F K
Sbjct  543  NRAHLDWFYWLLAGLSVIELILYLYFAK  570



>gb|KDO43629.1| hypothetical protein CISIN_1g042477mg, partial [Citrus sinensis]
Length=478

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 7/172 (4%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLND--KGVTVR  575
            TKQGM MKR+IG  FKIPPA LQSAITVSIILLMPLYD   IP++++ T     KG++V 
Sbjct  311  TKQGMAMKRNIGSRFKIPPATLQSAITVSIILLMPLYDTVLIPIIQIITCYQFKKGISVM  370

Query  574  QRMGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            QRM IGMFL+ IAMVIAA  +TKRL+ S+      +E  P++IFWLLP+Y+LLGISDIFT
Sbjct  371  QRMRIGMFLTSIAMVIAAAVETKRLQRSKQ-----AEAKPITIFWLLPEYVLLGISDIFT  425

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQ  239
            VV MQEFFY+EVP  MRT+G ALYTSVFG GSF S+LLIS++E FTSS A Q
Sbjct  426  VVAMQEFFYNEVPVRMRTMGFALYTSVFGVGSFLSALLISVIEFFTSSRARQ  477



>ref|XP_006416186.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
 gb|ESQ34539.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
Length=435

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P +KI PA LQS I++SI++ +PLYD+  IP+ R +T    G+T+ QR
Sbjct  219  TKQGATMERSITPGYKISPATLQSFISLSIVIFLPLYDRVLIPIARSYTHKPGGITMLQR  278

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L G+SD+FT
Sbjct  279  IGTGLFLSFLAMVIAALVEMKRLKTAADYGLVDSPDATVPMSVWWLVPQYVLFGVSDVFT  338

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS +IS++E  TS S  Q  WF++++
Sbjct  339  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGSFLSSFMISVIEKATSQS-GQVSWFANNL  397

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA  S + L  ++ F K
Sbjct  398  NQAHLDYFYWLLACFSFIGLASYLYFAK  425



>gb|KEH16161.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=557

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +M+R+I P F IPPA+LQ+   VSI+L  P+YD+ F+PL R  T    G+T+ QR
Sbjct  338  TKQGSSMQRTIFPGFDIPPASLQTITNVSIVLFSPIYDRIFVPLARSITGKPSGITLLQR  397

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNP--ENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+F+S+  +V AAF + KRL+I++    ++  + TVPMSI+WL+PQY L G+S++FT
Sbjct  398  IGTGIFISIFTVVFAAFVEIKRLKIAQEHSLDDDPNATVPMSIWWLIPQYFLFGVSEVFT  457

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHF++   +   WF D++
Sbjct  458  MVGLQEFFYDQVPNELRSMGLALYLSIIGVGSFLSGFLISLIEHFSAKDGHD-SWFCDNI  516

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS +  TLF+ F K
Sbjct  517  NKAHLDYFYWLLAGLSVMGFTLFIYFAK  544



>ref|XP_010062425.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Eucalyptus grandis]
 gb|KCW69565.1| hypothetical protein EUGRSUZ_F02994 [Eucalyptus grandis]
Length=579

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSI P F +PPA+LQS I++S+++ +P+YD+ F+PL R FT    G+T+ QR
Sbjct  363  TKQGVTMDRSITPGFDVPPASLQSFISLSVVMFIPIYDRVFVPLARSFTQRPSGITMLQR  422

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGMFLS ++M +A   + KRLE +R     ++ + TVPMS++WL+PQY+L GISD+FT
Sbjct  423  IGIGMFLSAVSMAVATLVEIKRLETAREHGLVDMPNVTVPMSVWWLIPQYVLFGISDVFT  482

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G++LY S+FG GSF SS L+S +   T        WF++++
Sbjct  483  MVGLQEFFYDQVPSELRSVGLSLYLSIFGVGSFLSSFLVSAIATATGGDGGDS-WFANNL  541

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LSA  L +++ F +
Sbjct  542  NKAHLDYFYWLLAGLSAFELVVYLYFAR  569



>ref|XP_012084632.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Jatropha curcas]
 gb|KDP27340.1| hypothetical protein JCGZ_20272 [Jatropha curcas]
Length=569

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSI   F +PPA+LQS I+++I+L +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  357  TKQGVTMDRSISKGFDVPPASLQSFISLAIVLFVPIYDRVFVPIARTLTRKPSGITMLQR  416

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS ++M IAA  + +RLEISR     ++ + TVPMS++WL+PQY+L G++D+FT
Sbjct  417  IGTGMFLSALSMAIAALVEMRRLEISREYGLVDMPNVTVPMSVWWLIPQYVLFGVADVFT  476

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G++LY  +FG GSF SS L+S +E  T    +   WFS+++
Sbjct  477  MVGLQEFFYDQVPSELRSVGLSLYLGIFGVGSFISSFLVSAIEKATGGEGHDS-WFSNNL  535

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LS V L  F+ F K
Sbjct  536  NRAHLDYFYWLLAGLSIVQLIAFLYFAK  563



>gb|KEH29311.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=433

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +M+R+I P F IPPA+LQ+   V+I++   +YD+ F+PL R  T    G+T+ QR
Sbjct  214  TKQGSSMERTIFPGFDIPPASLQTINGVAIVVFSAIYDRIFVPLARAITGKTSGITMLQR  273

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+  +V+AAF + KRL++++    +   + TVPMSI WL+PQY+L G+S++FT
Sbjct  274  IGTGIFLSIFTVVLAAFVENKRLKVAQEHGLVDDPNATVPMSIGWLIPQYVLFGVSEVFT  333

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHFT    ++  WF D++
Sbjct  334  MVGLQEFFYDQVPNELRSMGLALYLSIIGVGSFLSGFLISLIEHFTGKDGHE-SWFCDNI  392

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS +  TLFV F K
Sbjct  393  NKAHLDYFYWLLAGLSVLGFTLFVYFAK  420



>ref|XP_010477514.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Camelina sativa]
 ref|XP_010477515.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Camelina sativa]
Length=563

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P++KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+T+ QR
Sbjct  347  TKQGATMERSITPSYKISPATLQSFISLSIVIFIPIYDRVLIPIARSFTHKPGGITMLQR  406

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ +     L S   TVPMS++WL+PQY+L GISD+F 
Sbjct  407  IGTGLFLSFLAMVIAALVEMKRLKTAAEYGLLDSPDATVPMSVWWLVPQYVLFGISDVFA  466

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS LIS++E  TS S  Q  WF++++
Sbjct  467  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGSFLSSFLISVIEKATSQS-GQVSWFANNL  525

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS + L  ++ F K
Sbjct  526  NQAHLDYFYWLLACLSFIGLASYMYFAK  553



>gb|KEH29310.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=459

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +M+R+I P F IPPA+LQ+   V+I++   +YD+ F+PL R  T    G+T+ QR
Sbjct  240  TKQGSSMERTIFPGFDIPPASLQTINGVAIVVFSAIYDRIFVPLARAITGKTSGITMLQR  299

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+  +V+AAF + KRL++++    +   + TVPMSI WL+PQY+L G+S++FT
Sbjct  300  IGTGIFLSIFTVVLAAFVENKRLKVAQEHGLVDDPNATVPMSIGWLIPQYVLFGVSEVFT  359

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHFT    ++  WF D++
Sbjct  360  MVGLQEFFYDQVPNELRSMGLALYLSIIGVGSFLSGFLISLIEHFTGKDGHE-SWFCDNI  418

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS +  TLFV F K
Sbjct  419  NKAHLDYFYWLLAGLSVLGFTLFVYFAK  446



>ref|XP_006416188.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
 gb|ESQ34541.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
Length=562

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P +KI PA LQS I++SI++ +PLYD+  IP+ R +T    G+T+ QR
Sbjct  346  TKQGATMERSITPGYKISPATLQSFISLSIVIFLPLYDRVLIPIARSYTHKPGGITMLQR  405

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L G+SD+FT
Sbjct  406  IGTGLFLSFLAMVIAALVEMKRLKTAADYGLVDSPDATVPMSVWWLVPQYVLFGVSDVFT  465

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS +IS++E  TS S  Q  WF++++
Sbjct  466  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGSFLSSFMISVIEKATSQS-GQVSWFANNL  524

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA  S + L  ++ F K
Sbjct  525  NQAHLDYFYWLLACFSFIGLASYLYFAK  552



>emb|CAN71099.1| hypothetical protein VITISV_000973 [Vitis vinifera]
Length=572

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG    IP ++LQ+ I++SI+L++P+YD+  +P+ R  T    G+T+ QR
Sbjct  356  TKQGITMDRSIGWGIDIPASSLQAFISLSIVLIVPIYDRILVPIARTLTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS I+MV+AA  + KRL+ ++     ++ + T+PMS++WLLPQYIL G+SD+FT
Sbjct  416  IGTGMFLSAISMVVAALVEMKRLKTAQEHGLVDMPNVTLPMSVWWLLPQYILFGVSDVFT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++GIALY S+ G GSF SS LIS +E  T     QH  F+D++
Sbjct  476  MVGLQEFFYDQVPIELRSVGIALYLSILGVGSFLSSFLISAIEKATGGDG-QHSXFNDNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD YYWFLA LS V L+L+  F K
Sbjct  535  NRAHLDYYYWFLAGLSVVGLSLYRYFAK  562



>ref|XP_010498728.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Camelina sativa]
 ref|XP_010498729.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Camelina sativa]
Length=562

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P++KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+T+ QR
Sbjct  346  TKQGATMERSITPSYKISPATLQSFISLSIVIFVPIYDRVLIPIARSFTHKPGGITMLQR  405

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L GISD+F 
Sbjct  406  IGTGLFLSFLAMVIAALVEMKRLKTAADYGLVDSPDATVPMSVWWLVPQYVLFGISDVFA  465

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG G+F SS +IS++E  TS S  Q  WF++++
Sbjct  466  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGNFLSSFVISVIEKATSQS-GQVSWFANNL  524

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS + L  ++ F K
Sbjct  525  NQAHLDYFYWLLACLSFIGLASYMYFAK  552



>ref|XP_010322772.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322773.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X2 [Solanum 
lycopersicum]
Length=485

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS+G NF++P A+LQS I++S+++ +P+YD+  +P+ R  T    G+T+ QR
Sbjct  269  TKQGATMDRSLGSNFEVPAASLQSFISLSVVIFIPIYDRILVPVARAITGKPSGITMLQR  328

Query  568  MGIGMFLSVIAMVIAAFTDTKRLE--ISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+++MV+AA  + KRL+  +  +  ++   TVPMSI WL+PQYIL GISD+FT
Sbjct  329  IGTGIFLSILSMVVAAIIEKKRLQTALEHSLVDMPKATVPMSICWLIPQYILFGISDVFT  388

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  ++++G++LY S+FG GSF SS LIS+ E  T     Q  WFSD++
Sbjct  389  MVGLQEFFYDQVPVELKSIGLSLYLSIFGIGSFLSSFLISVTESITGKDG-QTSWFSDNL  447

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LAVLS ++ T ++ F +
Sbjct  448  NRAHLDYFYWVLAVLSTIAFTAYLYFSR  475



>ref|XP_011464750.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Fragaria vesca 
subsp. vesca]
Length=552

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R+  P F IP AALQS I++ II+ +P+YD+ F+P+ R FT    G+T+ QR
Sbjct  336  TKQGATMDRTFVPGFDIPAAALQSFISLVIIVFIPIYDRIFVPIARSFTREPSGITMLQR  395

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR--NPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS+I M++AA  + +RL+ ++  N  +  S TVP+S++WL+PQY+L+G++D+FT
Sbjct  396  IGTGMFLSIICMIVAALVEIQRLKTAKDYNLVDKPSATVPLSVWWLVPQYLLIGLADVFT  455

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP ++R++G+ALY S+FG GSF SS LIS++E  T S A    WFS+++
Sbjct  456  MVGLQEFFYDQVPKDLRSIGLALYISIFGVGSFLSSFLISVIEEAT-SWAGHTSWFSNNL  514

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LAVLSAV   +++   K
Sbjct  515  NRAHLDYFYWLLAVLSAVQFAIYMCIAK  542



>ref|XP_010683224.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=576

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RS+GP+F IPPA+LQS I +S++L++P+YD+  +P+ R FT    G+TV QR
Sbjct  362  TKQGLTMDRSLGPSFSIPPASLQSFINISVVLVIPIYDRILVPISRSFTGKPGGITVLQR  421

Query  568  MGIGMFLSVIAMVIAAFTDTKRLE--ISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM +S ++M+ AA  + KRLE  +     +L   TVPMS++WL+PQY+LLGIS++FT
Sbjct  422  VGTGMLISTVSMITAAIVEKKRLETALENGLIDLPDVTVPMSVWWLVPQYVLLGISEVFT  481

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY SVFG GS  SSL+ISI++  T S+  Q  WFS ++
Sbjct  482  MVGLQEFFYDQVPTELRSVGLSLYLSVFGVGSLLSSLMISIIDKATGSNG-QDSWFSSNL  540

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
                LD +Y  LA  SA+ L +FV F K
Sbjct  541  NRGHLDYFYCMLAAFSAIQLMVFVYFAK  568



>ref|XP_010460012.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Camelina sativa]
Length=562

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P++KI PA LQS I++SI++++P+YD+  IP+ R FT    G+T+ QR
Sbjct  346  TKQGATMERSITPSYKISPATLQSFISLSIVIVIPIYDRVLIPIARSFTHKPGGITMLQR  405

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIA+  + KRL+ +     + S   TVPMS++WL+PQY+L GISD+F 
Sbjct  406  IGTGLFLSFLAMVIASLVEMKRLKTAAEYGLVDSPDATVPMSVWWLVPQYVLFGISDVFA  465

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFY +VP+ +R +G+ALY S+FG GSF SS LIS++E  TS S  Q  WF++++
Sbjct  466  VVGLQEFFYDQVPSELRNVGLALYLSIFGIGSFLSSFLISVIEKATSQS-GQVSWFANNL  524

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS + L  ++ F K
Sbjct  525  NQAHLDYFYWLLACLSFIGLASYMYFAK  552



>dbj|BAF02114.1| peptide transporter like protein [Arabidopsis thaliana]
Length=326

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI    ++P A LQ  I+++I++ +P+YD+ F+P+ R  T    G+T  QR
Sbjct  112  TKQGSTMDRSISSTLQVPAATLQCFISLAILVFIPIYDRLFVPIARSITRKPAGITTLQR  171

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+MVIAA  + KRL+ +R+   + S   TVPMS+ WL+PQYIL G+SD+FT
Sbjct  172  ISTGIFLSIISMVIAALVEMKRLKTARDHGLVDSPKATVPMSVCWLIPQYILFGVSDVFT  231

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY EVP  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WFS+++
Sbjct  232  MVGLQEFFYGEVPPQLRSMGLALYLSIIGIGNFLSSFMVSVIEEATSQSG-QVSWFSNNL  290

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS+++    V F K
Sbjct  291  NQAHLDYFYWLLACLSSLAFIFTVYFAK  318



>ref|XP_010665397.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=572

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RS+G  F IP A+LQS IT++II+ +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  356  TKQGITMDRSLGSGFVIPAASLQSFITLAIIIFIPIYDRIFVPIARSLTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS I+MVIAA  + KRL+ +      ++   TVPMS+ WL+PQYIL G+SD+FT
Sbjct  416  IGTGIFLSCISMVIAALVEMKRLKTAEEYGLIDMPKVTVPMSVCWLIPQYILFGVSDVFT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG G+F SS LIS+++  T++   Q  WF+D++
Sbjct  476  MVGLQEFFYDQVPNELRSVGLALYLSIFGVGNFLSSFLISVIDK-TTNGDGQGSWFNDNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LSAV L  ++ F K
Sbjct  535  NQAHLDYFYWLLAGLSAVGLATYLYFAK  562



>ref|XP_003597990.1| Peptide transporter PTR3-A [Medicago truncatula]
 gb|AES68241.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=547

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+T+ R I P F +PPA+LQS I++SI+L +P+YD+  +P+ R FT    G+T+ QR
Sbjct  332  TKQGVTLDRKILPGFYVPPASLQSFISLSIVLFIPVYDRIIVPIARTFTGKPSGITMLQR  391

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+  SVI+MVIAAF + KRL+++R+    ++   T+PMSI+WL+PQY+L G+SD+FT
Sbjct  392  IGAGILFSVISMVIAAFVEMKRLKVARDHGLIDMPDVTIPMSIWWLIPQYVLFGVSDVFT  451

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG GSF SS LIS ++  TS   +  GWF+ ++
Sbjct  452  MVGLQEFFYDQVPDELRSVGLSLYLSIFGVGSFLSSFLISAIQKGTSKDGHD-GWFASNL  510

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +Y  LA LSAV LT F  F K
Sbjct  511  NRAHLDYFYALLAALSAVGLTAFWFFSK  538



>ref|XP_009788012.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana sylvestris]
Length=568

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG T+ RS+G NF++P A+LQS I++S+++ +P+YD+  +P+ R  T    G+TV QR
Sbjct  352  TKQGATLDRSLGSNFEVPAASLQSFISLSVVVFIPIYDRILVPVARAITRKPSGITVLQR  411

Query  568  MGIGMFLSVIAMVIAAFTDTKRLE--ISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+++MVIAA  + KRLE  I     ++   T+PMSI WL+PQY+L GISD+FT
Sbjct  412  IGTGIFLSILSMVIAAIVEKKRLETAIQYGLVDMPKATIPMSICWLIPQYLLFGISDVFT  471

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  ++++G++LY S+FG GSF SS LIS++E+ T     Q  WFSD++
Sbjct  472  MVGLQEFFYDQVPVELKSIGLSLYLSIFGIGSFLSSFLISVIENITGKDG-QSSWFSDNL  530

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LAVLS ++ T ++ F +
Sbjct  531  NRAHLDYFYWVLAVLSTMAFTAYLYFSR  558



>gb|KEH29309.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=557

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +M+R+I P F IPPA+LQ+   V+I++   +YD+ F+PL R  T    G+T+ QR
Sbjct  338  TKQGSSMERTIFPGFDIPPASLQTINGVAIVVFSAIYDRIFVPLARAITGKTSGITMLQR  397

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+  +V+AAF + KRL++++     +  + TVPMSI WL+PQY+L G+S++FT
Sbjct  398  IGTGIFLSIFTVVLAAFVENKRLKVAQEHGLVDDPNATVPMSIGWLIPQYVLFGVSEVFT  457

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHFT    ++  WF D++
Sbjct  458  MVGLQEFFYDQVPNELRSMGLALYLSIIGVGSFLSGFLISLIEHFTGKDGHES-WFCDNI  516

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS +  TLFV F K
Sbjct  517  NKAHLDYFYWLLAGLSVLGFTLFVYFAK  544



>ref|XP_006356504.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Solanum tuberosum]
Length=568

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS+G NF++P A+LQS I++S+++ +P+YD+  +P+ R  T    G+T+ QR
Sbjct  352  TKQGATMDRSLGSNFEVPAASLQSFISLSVVIFIPIYDRILVPVARAITGKPSGITMLQR  411

Query  568  MGIGMFLSVIAMVIAAFTDTKRLE--ISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+++MV+AA  + KRL+  +     ++   TVPMSI WL+PQYIL GISD+FT
Sbjct  412  IGTGIFLSILSMVVAAIIEKKRLQTALEHGLVDMPKATVPMSICWLIPQYILFGISDVFT  471

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  ++++G++LY S+FG GSF SS LIS+ E+ T     Q  WFSD++
Sbjct  472  MVGLQEFFYDQVPVELKSIGLSLYLSIFGIGSFLSSFLISVTENITGKDG-QTSWFSDNL  530

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LAVLS ++ T ++ F +
Sbjct  531  NRAHLDYFYWVLAVLSTIAFTAYLYFSR  558



>gb|ACJ85853.1| unknown [Medicago truncatula]
Length=547

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+T+ R I P F +PPA+LQS I++SI+L +P+YD+  +P+ R FT    G+T+ QR
Sbjct  332  TKQGVTLDRKILPGFYVPPASLQSFISLSIVLFIPVYDRIIVPIARTFTGKPSGITMLQR  391

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+  SVI+MVIAAF + KRL+++R+    ++   T+PMSI+WL+PQY+L G+SD+FT
Sbjct  392  IGAGILFSVISMVIAAFVEMKRLKVARDHGLIDMPDVTIPMSIWWLIPQYVLFGVSDVFT  451

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG GSF SS LIS ++  TS   +  GWF+ ++
Sbjct  452  MVGLQEFFYDQVPDELRSVGLSLYLSIFGVGSFLSSFLISAIQKGTSKDGHD-GWFASNL  510

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +Y  LA LSAV LT F  F K
Sbjct  511  NRAHLDYFYALLAALSAVGLTPFWFFSK  538



>ref|XP_004241845.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X1 [Solanum 
lycopersicum]
Length=566

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS+G NF++P A+LQS I++S+++ +P+YD+  +P+ R  T    G+T+ QR
Sbjct  350  TKQGATMDRSLGSNFEVPAASLQSFISLSVVIFIPIYDRILVPVARAITGKPSGITMLQR  409

Query  568  MGIGMFLSVIAMVIAAFTDTKRLE--ISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+++MV+AA  + KRL+  +  +  ++   TVPMSI WL+PQYIL GISD+FT
Sbjct  410  IGTGIFLSILSMVVAAIIEKKRLQTALEHSLVDMPKATVPMSICWLIPQYILFGISDVFT  469

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  ++++G++LY S+FG GSF SS LIS+ E  T     Q  WFSD++
Sbjct  470  MVGLQEFFYDQVPVELKSIGLSLYLSIFGIGSFLSSFLISVTESITGKDG-QTSWFSDNL  528

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LAVLS ++ T ++ F +
Sbjct  529  NRAHLDYFYWVLAVLSTIAFTAYLYFSR  556



>ref|XP_011001076.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
Length=567

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSI P+  +P A+LQS I++SI+L +P+YD+  +P+ R  T    G+T+ QR
Sbjct  351  TKQGVTMDRSISPSLDLPAASLQSFISLSIVLFIPIYDRVLVPIARALTRKPSGITMLQR  410

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMF+SV+AM++AA  + KRL+ ++     +L + T+PMS++WL+PQY+L G+++ FT
Sbjct  411  IGSGMFISVVAMIVAALVEMKRLKTAQEHGLVDLPNVTIPMSVWWLIPQYVLFGVAEAFT  470

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+++R++G++LY S+FG GSF SS LISI+E  T     Q+ WF++++
Sbjct  471  MVGLQEFFYDQVPSDLRSVGLSLYLSIFGVGSFLSSFLISIIEKATGGDG-QYSWFANNL  529

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LSAV L ++V F K
Sbjct  530  NRAHLDYFYWLLAGLSAVQLVVYVCFAK  557



>gb|AFK47483.1| unknown [Medicago truncatula]
Length=340

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +M+R+I P F IPP++LQ+   ++I+L  P+Y+  F+PL RV T    G+T+ QR
Sbjct  121  TKQGTSMERTIFPGFDIPPSSLQTIKWLAIVLFCPIYEHIFVPLARVITGKPSGITMLQR  180

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+F+S+  +V AAF +TKRL+I++     +  + TVPMSI+WL+PQY L G+ ++FT
Sbjct  181  IGTGIFISIFMVVFAAFVETKRLKIAQKYGLVDDPNATVPMSIWWLVPQYFLFGVFEVFT  240

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHF+    ++  WF D++
Sbjct  241  MVGLQEFFYDQVPNELRSMGLALYLSIVGVGSFLSGFLISLIEHFSGKDGHET-WFCDNI  299

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
             +A  D +YW LA LS +  TL++ F KF
Sbjct  300  NKAHFDYFYWLLAGLSVMGFTLYIYFAKF  328



>gb|KEH29305.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=495

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +M+R+I P F IPPA+LQS   ++I+L  P+YD+ F+PL R  T    G+T+ QR
Sbjct  276  TKQGSSMQRTIFPGFDIPPASLQSINGLAILLFSPIYDRIFVPLARAITGKPSGITMLQR  335

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+F+S+I +  AAF + KRL+I++     +  + TVPMSI+WL+PQY L G+S++FT
Sbjct  336  IGTGIFISIITVTFAAFVEMKRLKIAQEYGIVDDPNATVPMSIWWLVPQYFLFGVSEVFT  395

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHF+    ++  WF D++
Sbjct  396  MVGLQEFFYDQVPNELRSMGLALYLSIVGVGSFLSGFLISLIEHFSGKDGHET-WFCDNI  454

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A  D +YW LA LS +  TLFV F K
Sbjct  455  NKAHFDYFYWLLAGLSLMGFTLFVYFAK  482



>gb|KEH29314.1| peptide/nitrate transporter plant-like protein [Medicago truncatula]
Length=460

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +++R+I P F IPPA+L S   V+I+L  P+YD+ F+PL RV T    G+T+ QR
Sbjct  241  TKQGSSLERTIFPGFNIPPASLGSIGGVAIVLFTPIYDRLFVPLARVITGKSSGITMLQR  300

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+  +V+AAF + KRL+I++     +  +  VPMSI+WL+PQY L G+S++FT
Sbjct  301  IGTGIFLSIFTVVLAAFVEMKRLKIAQEHGLVDDPNAIVPMSIWWLVPQYFLFGVSEVFT  360

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHF+    +   WF D++
Sbjct  361  MVGLQEFFYDQVPNELRSMGLALYLSIIGVGSFLSGFLISLIEHFSGKDGHD-SWFCDNI  419

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +  LD +YW L+ LS +  TLF+ F K
Sbjct  420  NKTHLDYFYWLLSGLSVIGFTLFIYFAK  447



>emb|CDY04807.1| BnaC05g17820D [Brassica napus]
Length=561

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P++KI PA LQS I++SI++ +P+YD   IP+ R FT    G+T+ QR
Sbjct  345  TKQGATMERSITPSYKISPATLQSFISLSIVIFIPVYDCVLIPIARSFTHKPGGITMLQR  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE--TVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L GISD+F 
Sbjct  405  IGTGIFLSFLAMVIAALVEMKRLKTAADYGLIDSPDVTVPMSVWWLVPQYVLFGISDVFA  464

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS +IS+++  TS S  Q  WF++++
Sbjct  465  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGSFLSSFMISVIDEATSRS-GQVSWFANNL  523

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA+LS + L  ++ F K
Sbjct  524  NQAHLDYFYWLLALLSFIGLASYLYFAK  551



>ref|XP_007204887.1| hypothetical protein PRUPE_ppa003472mg [Prunus persica]
 gb|EMJ06086.1| hypothetical protein PRUPE_ppa003472mg [Prunus persica]
Length=572

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R+I P   IP A+LQ+ I+++I++ +P+YD+ F+P+ RVFT    G+T+ QR
Sbjct  356  TKQGATMDRTIAPGLDIPAASLQTFISITIVIFVPIYDRIFVPIARVFTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGMF+S+I+MV+AA  + KRL+ +++    ++ S TVPMSI+WL+PQY+L G++D+FT
Sbjct  416  IGIGMFISIISMVVAALVEMKRLKTAKDYGLLDMPSATVPMSIWWLVPQYLLAGLADVFT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  ++++G+ALY S+FG GSF SS LIS ++  T + A +  WFS ++
Sbjct  476  MVGLQEFFYDQVPNELKSIGLALYLSIFGVGSFLSSFLISAIDDAT-TWAGETSWFSTNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW L  +S V L +++ F K
Sbjct  535  NRAHLDYFYWLLGGISVVELAIYLYFAK  562



>gb|KFK44349.1| hypothetical protein AALP_AA1G246100 [Arabis alpina]
Length=558

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI PN+KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+T+ QR
Sbjct  342  TKQGATMERSITPNYKISPATLQSFISLSIVIFIPVYDRILIPIARSFTHKPSGITMLQR  401

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+F+S +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L GI+D+F 
Sbjct  402  IGTGIFISFLAMVIAALVEMKRLKTATDYGLVDSPDATVPMSVWWLVPQYVLFGITDVFA  461

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG G+F SS +IS++E  TS S  +  WF++++
Sbjct  462  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGNFLSSFMISVIEKATSQS-GRVSWFANNL  520

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS ++   ++ F K
Sbjct  521  NQAHLDYFYWLLACLSFIAFVSYLYFAK  548



>ref|XP_010245114.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=577

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 152/207 (73%), Gaps = 3/207 (1%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG+TM RSI   F+IPPA+LQS I  +II+ +P+YD+  +P+ R +T    G+T+ QR+
Sbjct  362  KQGLTMDRSITSGFEIPPASLQSLIGAAIIVFIPIYDRIIVPIARAYTGKPSGITMLQRI  421

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFTV  392
            G GMFLS+I+MV+AA  + +RL+++R+    ++   T+PMS++WL+PQY+L GISD+FT+
Sbjct  422  GTGMFLSLISMVVAAIVEKERLKVARDSGLVDMPQVTLPMSVWWLVPQYVLFGISDVFTM  481

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VG+QEFFY +VP  +R++G++LY S+FG G+F SS LIS++E  T S   Q  WF++++ 
Sbjct  482  VGLQEFFYDQVPNGLRSMGLSLYLSIFGIGNFLSSFLISVIEKET-SRGGQDSWFANNLN  540

Query  211  EARLDNYYWFLAVLSAVSLTLFVIFCK  131
             A LD +YW L+ LS + L L++ F K
Sbjct  541  RAHLDWFYWLLSGLSVIELVLYLYFSK  567



>gb|KEH29306.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
 gb|KEH29307.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=559

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG +M+R+I P F IPPA+LQS   ++I+L  P+YD+ F+PL R  T    G+T+ QR
Sbjct  340  TKQGSSMQRTIFPGFDIPPASLQSINGLAILLFSPIYDRIFVPLARAITGKPSGITMLQR  399

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            +G G+F+S+I +  AAF + KRL+I++    +   + TVPMSI+WL+PQY L G+S++FT
Sbjct  400  IGTGIFISIITVTFAAFVEMKRLKIAQEYGIVDDPNATVPMSIWWLVPQYFLFGVSEVFT  459

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G GSF S  LIS++EHF+    ++  WF D++
Sbjct  460  MVGLQEFFYDQVPNELRSMGLALYLSIVGVGSFLSGFLISLIEHFSGKDGHET-WFCDNI  518

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A  D +YW LA LS +  TLFV F K
Sbjct  519  NKAHFDYFYWLLAGLSLMGFTLFVYFAK  546



>ref|XP_006307141.1| hypothetical protein CARUB_v10008731mg [Capsella rubella]
 gb|EOA40039.1| hypothetical protein CARUB_v10008731mg [Capsella rubella]
Length=561

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P++KI PA LQS I++SI++ +P+YD+  IP+ R  T    G+T+ QR
Sbjct  345  TKQGATMERSITPSYKISPATLQSFISLSIVIFIPIYDRVLIPVARSITHKPGGITMLQR  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPM ++WL+PQY+L GISD+F 
Sbjct  405  IGTGLFLSFLAMVIAALVEMKRLKTAADYGLIDSPDATVPMRVWWLVPQYVLFGISDVFA  464

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS LISI+E  TS S  Q  WF++++
Sbjct  465  IVGLQEFFYDQVPTELRSVGLALYLSIFGIGSFLSSFLISIIEKVTSQS-GQVSWFANNL  523

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS + L  ++ F K
Sbjct  524  NQAHLDYFYWLLACLSFIGLASYMYFAK  551



>emb|CDY21370.1| BnaA09g30570D [Brassica napus]
Length=561

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P++KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+T+ QR
Sbjct  345  TKQGATMERSITPSYKISPATLQSFISLSIVIFIPVYDRVLIPIARSFTHKPGGITMLQR  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE--TVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L GISD+F 
Sbjct  405  IGTGIFLSFLAMVIAALVEMKRLKTAADYGLIDSPDVTVPMSVWWLVPQYVLFGISDVFA  464

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS +IS+++  TS S  Q  WF++++
Sbjct  465  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGSFLSSFMISVIDKATSRS-GQVSWFANNL  523

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA  S + L  ++ F K
Sbjct  524  NKAHLDYFYWLLACFSFIGLASYLYFAK  551



>ref|XP_006295948.1| hypothetical protein CARUB_v10025090mg [Capsella rubella]
 gb|EOA28846.1| hypothetical protein CARUB_v10025090mg [Capsella rubella]
Length=462

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI PN  +P A LQ  I+++I++ +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  248  TKQGSTMDRSISPNILVPAATLQCFISLAILIFIPIYDRIFVPIARSITHKPAGITMLQR  307

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            + IG+FLS+++MVIAA  + KRL+ +R+   + S    VPMSI WL+PQY++ G+SD+FT
Sbjct  308  ISIGLFLSIVSMVIAALVEMKRLKTARDHGLVDSPQSIVPMSICWLIPQYVVYGVSDVFT  367

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            VVG+QEFFY +VP  +R+LG+++Y SV G G+F SS ++S++E  TS S   + WF +++
Sbjct  368  VVGLQEFFYGQVPVELRSLGLSMYLSVLGLGNFLSSFMVSVIEKATSQSGEVN-WFDNNL  426

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA+ S+++   FV F K
Sbjct  427  HKAHLDYFYWLLALFSSIAFLFFVYFAK  454



>ref|XP_006376225.1| hypothetical protein POPTR_0013s11120g [Populus trichocarpa]
 gb|ERP54022.1| hypothetical protein POPTR_0013s11120g [Populus trichocarpa]
Length=567

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSI P+  +P A+LQS I++SI+L +P+YD+  +P+ R  T    G+T+ QR
Sbjct  351  TKQGVTMDRSISPSLDLPAASLQSFISLSIVLFIPIYDRVLVPIARALTRKPSGITMLQR  410

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMF+SV+AM++AA  + KRL+ ++     +L + T+PMS++WL+PQY+L G+++ FT
Sbjct  411  IGSGMFISVVAMIVAALVEMKRLKTAQEHGLVDLPNVTIPMSVWWLIPQYVLFGVAEAFT  470

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+++R++G++LY S+FG GSF SS LISI+E  T  +  ++ WF++++
Sbjct  471  MVGLQEFFYDQVPSDLRSVGLSLYLSIFGVGSFLSSFLISIIEKATGGNG-RYSWFANNL  529

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LSAV L  +V F K
Sbjct  530  NRAHLDYFYWLLAGLSAVQLVAYVCFAK  557



>ref|XP_009115625.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Brassica rapa]
Length=561

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 151/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P++KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+TV QR
Sbjct  345  TKQGATMERSITPSYKISPATLQSFISLSIVIFIPVYDRVLIPIARSFTHKPGGITVLQR  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE--TVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L GISD+F 
Sbjct  405  IGTGIFLSFLAMVIAALVEMKRLKTAADYGLIDSPDVTVPMSVWWLVPQYVLFGISDVFA  464

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS +IS+++   S S  Q  WF++++
Sbjct  465  MVGLQEFFYDQVPSELRSVGLALYLSIFGIGSFLSSFMISVIDKAMSRS-GQVSWFANNL  523

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA  S + L  ++ F K
Sbjct  524  NQAHLDYFYWLLACFSFIGLASYLYFAK  551



>ref|XP_008240575.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Prunus mume]
Length=572

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R+I P   IP A+LQ+ I+++I++ +P+YD+ F+P+ RVFT    G+T+ QR
Sbjct  356  TKQGATMDRTIAPGLDIPAASLQTFISITIVIFVPIYDRIFVPIARVFTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGMF+S+I+M +AA  + KRL+ +++    ++ S TVPMSI+WL+PQY+L G++D+FT
Sbjct  416  IGIGMFISIISMAVAALVEMKRLKTAKDYGLLDMPSATVPMSIWWLVPQYLLAGLADVFT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  ++++G+ALY S+FG GSF SS LIS ++  T + A +  WFS ++
Sbjct  476  MVGLQEFFYDQVPNELKSIGLALYLSIFGVGSFLSSFLISAIDDAT-TWAGETSWFSTNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW L  +S V L +++ F K
Sbjct  535  NRAHLDYFYWLLGGISVVELAIYLYFAK  562



>ref|XP_002890519.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66778.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=561

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P +KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+T+ QR
Sbjct  345  TKQGATMERSITPGYKISPATLQSFISLSIVIFIPIYDRVLIPIARSFTHKPGGITMLQR  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMVIAA  + KRL+ + +   + S   TVPMS++WL+PQY+L GI+D+F 
Sbjct  405  IGTGIFLSFLAMVIAALVEMKRLKTAADYGLIDSPDATVPMSVWWLVPQYVLFGITDVFA  464

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG G+F SS +ISI+E  TS S  Q  WF++++
Sbjct  465  MVGLQEFFYDQVPNELRSVGLALYLSIFGIGNFLSSFMISIIERATSQS-GQVSWFANNL  523

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS + L  ++   K
Sbjct  524  NQAHLDYFYWLLACLSFIGLASYLYVAK  551



>ref|NP_173670.2| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q0WP01.1|PTR9_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.10; Short=AtNPF5.10 
[Arabidopsis thaliana]
 dbj|BAF01148.1| similar to peptide transporter [Arabidopsis thaliana]
 gb|ACE79042.1| At1g22540 [Arabidopsis thaliana]
 gb|AEE30254.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=557

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P +KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+T+ QR
Sbjct  341  TKQGATMERSITPGYKISPATLQSFISLSIVIFIPIYDRVLIPIARSFTHKPGGITMLQR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMV+AA  + KRL+ + +   + S   TVPMS++WL+PQY+L GI+D+F 
Sbjct  401  IGTGIFLSFLAMVVAALVEMKRLKTAADYGLVDSPDATVPMSVWWLVPQYVLFGITDVFA  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG G+F SS +ISI+E  TS S  Q  WF++++
Sbjct  461  MVGLQEFFYDQVPNELRSVGLALYLSIFGIGNFLSSFMISIIEKATSQS-GQASWFANNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS + L  ++   K
Sbjct  520  NQAHLDYFYWLLACLSFIGLASYLYVAK  547



>gb|EYU27212.1| hypothetical protein MIMGU_mgv1a017651mg, partial [Erythranthe 
guttata]
Length=548

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 140/208 (67%), Gaps = 2/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG +F +P A+LQ  I ++II+ +P+YD+ F+PL R+ T N  GVT  QR
Sbjct  328  TKQGITMDRSIGSSFDVPAASLQYIIGLTIIIFVPIYDRVFVPLGRIATGNPSGVTQLQR  387

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR--NPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM L  ++MVIAA  + KRL+ +       L    VPMS +WL+PQYI+ GISD+FT
Sbjct  388  IGTGMLLCTVSMVIAALVERKRLKTASQYGLAELGGAEVPMSFWWLIPQYIIFGISDVFT  447

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            ++G+QE FY EVP  ++T+ +++Y S+ G G+F SS LI I++  TS    Q GWFSD+ 
Sbjct  448  IIGLQELFYEEVPCGLKTVALSIYLSILGIGNFLSSFLIFIIQRVTSDQGGQGGWFSDNA  507

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA ++A  L  F+ F +
Sbjct  508  NGAHLDYFYWLLAGVNAAGLLAFLCFAR  535



>gb|AAF18524.1|AC006551_10 Similar to peptide transporter [Arabidopsis thaliana]
Length=570

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+RSI P +KI PA LQS I++SI++ +P+YD+  IP+ R FT    G+T+ QR
Sbjct  354  TKQGATMERSITPGYKISPATLQSFISLSIVIFIPIYDRVLIPIARSFTHKPGGITMLQR  413

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS +AMV+AA  + KRL+ + +   + S   TVPMS++WL+PQY+L GI+D+F 
Sbjct  414  IGTGIFLSFLAMVVAALVEMKRLKTAADYGLVDSPDATVPMSVWWLVPQYVLFGITDVFA  473

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG G+F SS +ISI+E  TS S  Q  WF++++
Sbjct  474  MVGLQEFFYDQVPNELRSVGLALYLSIFGIGNFLSSFMISIIEKATSQS-GQASWFANNL  532

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS + L  ++   K
Sbjct  533  NQAHLDYFYWLLACLSFIGLASYLYVAK  560



>ref|XP_009613182.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana tomentosiformis]
Length=569

 Score =   191 bits (484),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG T+ R +G NF++P A+LQS I++S+++ +P+YD+  +P+ RV T    G+TV QR
Sbjct  353  TKQGATLDRYLGSNFEVPAASLQSFISLSVVVFIPIYDRILVPVARVITRKPSGITVLQR  412

Query  568  MGIGMFLSVIAMVIAAFTDTKRLE--ISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+++ VIAA  + KRL+  I     ++   T+PMSI WL+PQY+L GISD+FT
Sbjct  413  IGTGIFLSILSTVIAAIVEKKRLQTAIEYGLVDMPKATIPMSICWLIPQYLLFGISDVFT  472

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  ++++G++LY S+FG GSF SS LIS++E+ T     Q  WFSD++
Sbjct  473  MVGLQEFFYDQVPVELKSIGLSLYLSIFGIGSFLSSFLISVIENITGKDG-QSSWFSDNL  531

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LAVLS ++ T ++ F +
Sbjct  532  NRAHLDYFYWVLAVLSTMAFTAYLYFSR  559



>emb|CDP10688.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIGP+F++P A+L+S I++SI++ + +YD+  +P+ R  T    G+T+ QR
Sbjct  361  TKQGVTMDRSIGPSFEVPAASLESFISLSIVVFIAIYDRILVPIARSITTRPSGITLLQR  420

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR--NPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS ++MVIAA  +TKRL+ ++    ++    T+PMS+FWL PQY++LG+S++F 
Sbjct  421  IGTGIFLSFLSMVIAALVETKRLQTAQEYGLDDKPKATIPMSVFWLTPQYLVLGVSEVFA  480

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQEFFY +VP+ +++ G ALY S+ G GSF SS+LIS+++  TS   ++  WFSD++
Sbjct  481  IVGMQEFFYDQVPSGLKSTGFALYLSILGIGSFLSSILISVLQKATSRHGHES-WFSDNL  539

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +Y+ LA LSA++L  F  F K
Sbjct  540  NKAHLDYFYFLLAGLSAIALAAFAYFAK  567



>ref|NP_974129.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 gb|AEE35279.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=420

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQS I +S+++ +P+YD+  +P  R FT N  G+T  QR
Sbjct  211  TKQGATMDRSISPGLLVPAATLQSFINLSVVVFIPIYDRLLVPFARSFTQNSSGITTLQR  270

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++AMV+AA  +TKRL+ +R+       ++PMS++WL+PQY++ G+SD+FT+V
Sbjct  271  IGTGIFLSILAMVLAALVETKRLQAARD-----ELSIPMSVWWLIPQYVIFGVSDMFTMV  325

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFY +VP+ +R++G+AL  S++G G++ SS +IS+++  T+    Q  WF +D+ +
Sbjct  326  GLQEFFYGQVPSELRSVGMALNLSIYGAGNYLSSFMISVIDKITNQYG-QRSWFDNDLDQ  384

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            A LD +YW LA L  +    ++ F K
Sbjct  385  AHLDYFYWLLACLGFIGFAFYLWFAK  410



>ref|NP_177359.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9C7U1.1|PTR25_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.12; Short=AtNPF5.12 
[Arabidopsis thaliana]
 gb|AAG51791.1|AC067754_7 peptide transporter PTR2-B, putative; 5822-8291 [Arabidopsis 
thaliana]
 gb|AAT85761.1| At1g72140 [Arabidopsis thaliana]
 gb|AEE35280.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=555

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI    ++P A LQ  I+++I++ +P+YD+ F+P+ R  T    G+T  QR
Sbjct  341  TKQGSTMDRSISSTLQVPAATLQCFISLAILVFIPIYDRLFVPIARSITRKPAGITTLQR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+MVIAA  + KRL+ +R+   + S   TVPMS+ WL+PQYIL G+SD+FT
Sbjct  401  ISTGIFLSIISMVIAALVEMKRLKTARDHGLVDSPKATVPMSVCWLIPQYILFGVSDVFT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY EVP  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WFS+++
Sbjct  461  MVGLQEFFYGEVPPQLRSMGLALYLSIIGIGNFLSSFMVSVIEEATSQSG-QVSWFSNNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS+++    V F K
Sbjct  520  NQAHLDYFYWLLACLSSLAFIFTVYFAK  547



>dbj|BAD43310.1| putative peptide transporter PTR2-B [Arabidopsis thaliana]
Length=555

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI    ++P A LQ  I+++I++ +P+YD+ F+P+ R  T    G+T  QR
Sbjct  341  TKQGSTMDRSISSTLQVPAATLQCFISLAILVFIPIYDRLFVPIARSITRKPAGITTLQR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+MVIAA  + KRL+ +R+   + S   TVPMS+ WL+PQYIL G+SD+FT
Sbjct  401  ISTGIFLSIISMVIAALVEMKRLKTARDHGLVDSPKATVPMSVCWLIPQYILFGVSDVFT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY EVP  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WFS+++
Sbjct  461  MVGLQEFFYGEVPPQLRSMGLALYLSIIGIGNFLSSFMVSVIEEATSQSG-QVSWFSNNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS+++    V F K
Sbjct  520  NQAHLDYFYWLLACLSSLAFIFTVYFAK  547



>ref|XP_010683004.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=579

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 144/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+T+ RS+G  F IP AALQS I + I++ +P+YD+  +P+ R  T N  G+++ QR
Sbjct  362  TKQGITLDRSVGSRFAIPAAALQSFIGICIVIFIPIYDRVLVPIARKLTGNPSGISMLQR  421

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+F+S+  MV+AA T+ KRLE +      +L   T+PMSI+WLLPQY+L GIS+ FT
Sbjct  422  IGTGLFISIFTMVVAAVTEKKRLETATRYGLIDLPKVTIPMSIWWLLPQYVLFGISEAFT  481

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG G   SS L+S++   T S   +  WFS+++
Sbjct  482  MVGLQEFFYDQVPNELRSVGLSLYLSIFGLGGLLSSFLVSVINKAT-SRGGEESWFSNNL  540

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA  SA+ L LFV F K
Sbjct  541  NRAHLDYFYWLLAGFSALGLALFVYFAK  568



>gb|KFK41643.1| hypothetical protein AALP_AA2G154400 [Arabis alpina]
Length=553

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS+     +P A LQ  I++SI++ +P+YD+ F+P+ R  T    G+T  QR
Sbjct  339  TKQGSTMDRSMSSTLLVPAATLQGFISLSILIFIPIYDRLFVPIARSITRKPAGITTLQR  398

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLSV++M+IAA  + KRL I+R+   + S   TVPMSI WL+PQY L GISD+FT
Sbjct  399  ISTGIFLSVLSMIIAALVEMKRLNIARDHGLVDSPKATVPMSICWLIPQYALYGISDVFT  458

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R+LG++LY SV G G+F SS ++S++E  TS S  Q  WF++++
Sbjct  459  MVGLQEFFYGQVPVELRSLGLSLYLSVIGIGNFLSSFMVSVIEKATSQSG-QVSWFANNL  517

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S   FV F K
Sbjct  518  NQAHLDYFYWLLACLSSISFVSFVYFAK  545



>ref|XP_010428077.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12-like [Camelina sativa]
Length=509

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I++ II  +P+YD+ F+P+VR FT    G+T  QR
Sbjct  295  TKQGSTMDRSISSTLIVPAATLQCFISLGIIFFIPIYDRLFVPIVRSFTHKPAGITTLQR  354

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+MV AA  + KRL+++R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  355  ISTGIFLSIISMVTAALVEMKRLKVARDNGLVDSPDATVPMSVCWLIPQYVLFGVSDVFT  414

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WF +++
Sbjct  415  MVGLQEFFYGQIPVELRSMGLALYLSIIGIGNFLSSFMVSVIEKATSQSG-QASWFDNNL  473

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V   K
Sbjct  474  NQAHLDYFYWLLACLSSISFVFIVHLAK  501



>ref|XP_002887414.1| hypothetical protein ARALYDRAFT_316182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63673.1| hypothetical protein ARALYDRAFT_316182 [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 146/206 (71%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQS I +SI++ +P+YD+  +P  R FT    G+T+ QR
Sbjct  326  TKQGATMDRSISPGLLVPAATLQSFINLSIVVFIPVYDRLLVPFARSFTQKPSGITMLQR  385

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++AMV+AA  +TKRL+ +R+       T+PMS++WL+PQY++LG+SD+FT+V
Sbjct  386  IGTGIFLSILAMVVAALIETKRLQTTRD-----DLTIPMSVWWLVPQYVILGVSDVFTMV  440

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFY +VP+ +R++G+AL  S++G G+F SS +IS+++  TS    Q  WF +D+ +
Sbjct  441  GLQEFFYDQVPSELRSIGMALNLSIYGAGNFLSSFMISVIDKITSQYG-QTSWFDNDLNQ  499

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            A LD +YW LA LS +    ++ F K
Sbjct  500  AHLDYFYWLLASLSFIGFASYLWFAK  525



>ref|XP_010911895.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Elaeis guineensis]
Length=558

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 150/208 (72%), Gaps = 4/208 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG T+ R IG NF++PPAALQS I+ SI+  +P+YD+  +P+VR ++    G T+ QR
Sbjct  340  TKQGSTLDRRIGSNFEVPPAALQSFISASIVAFIPIYDRILVPIVRKYSKKPAGFTMLQR  399

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR--NPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM +S+I+MVIAA  + KRLE +R     +  + T+PMS++WL+PQY+L GI+D+FT
Sbjct  400  IGTGMVISLISMVIAALVELKRLETAREFGLVDQPAATIPMSLWWLIPQYVLYGIADVFT  459

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R+LG+ALY S+FG GSF SS L+S+++  T+ S     WFS+++
Sbjct  460  MVGLQEFFYDQIPDALRSLGLALYLSIFGIGSFISSFLVSMIDKATAKSGES--WFSNNL  517

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LSA+ L +++   +
Sbjct  518  NRAHLDYFYWLLAGLSALELIIYLYLAR  545



>gb|AAV84496.1| At3g54450 [Arabidopsis thaliana]
 gb|AAW39013.1| At3g54450 [Arabidopsis thaliana]
Length=329

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 140/203 (69%), Gaps = 4/203 (2%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG  M R+IG +F IPPAA QS + V+I++L+PLYD+ F+P+VR  T +  G+T  QR+
Sbjct  107  KQGSMMDRTIGNHFTIPPAAFQSIVGVTILILIPLYDRVFVPMVRKITNHHSGITSLQRI  166

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFTV  392
            G+G+F++   MVI    + KRL+++R+   + S  E VPMS  WLLPQYIL+GI D+FT+
Sbjct  167  GVGLFVATFNMVICGLVEAKRLKVARDHGLIDSPKEVVPMSSLWLLPQYILVGIGDVFTI  226

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQE FY ++P  MR++G A++ SV G GSF S+ +IS V+  + S   +  W  +++ 
Sbjct  227  VGMQELFYDQMPETMRSIGAAIFISVVGVGSFVSTGIISTVQTISKSHGEE--WLVNNLN  284

Query  211  EARLDNYYWFLAVLSAVSLTLFV  143
             A LD YYW +A L+AVSL  ++
Sbjct  285  RAHLDYYYWIIASLNAVSLCFYL  307



>dbj|BAC42330.1| putative peptide transporter PTR2-B [Arabidopsis thaliana]
Length=499

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQS I +S+++ +P+YD+  +P  R FT N  G+T  QR
Sbjct  290  TKQGATMDRSISPGLLVPAATLQSFINLSVVVFIPIYDRSLVPFARSFTQNSSGITTLQR  349

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++AMV+AA  +TKRL+ +R+       ++PMS++WL+PQY++ G+SD+FT+V
Sbjct  350  IGTGIFLSILAMVLAALVETKRLQAARD-----ELSIPMSVWWLIPQYVIFGVSDMFTMV  404

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFY +VP+ +R++G+AL  S++G G++ SS +IS+++  T+    Q  WF +D+ +
Sbjct  405  GLQEFFYGQVPSELRSVGMALNLSIYGAGNYLSSFMISVIDKITNQYG-QRSWFDNDLDQ  463

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            A LD +YW LA L  +    ++ F K
Sbjct  464  AHLDYFYWLLACLGFIGFAFYLWFAK  489



>emb|CDX68284.1| BnaA07g23240D [Brassica napus]
Length=261

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 143/205 (70%), Gaps = 6/205 (3%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG TM RSI P F +P A  QS I +SI++ +P+YD+  +P  R FT    G+T+ QR+
Sbjct  53   KQGATMDRSISPGFLVPSATFQSFINISIVIFIPIYDRVLVPAARSFTQIPSGITMLQRI  112

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVVG  386
            G G+FLS+IAMV+AA  +TKRL+ +++       T+PMS++WL+PQY++ G++D+FT+ G
Sbjct  113  GTGIFLSIIAMVVAALVETKRLQTAKD-----DLTIPMSVWWLVPQYVIYGVADVFTMAG  167

Query  385  MQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKEA  206
            +QEFFY +VP+ +R++G+AL  S+FG G+F SS +IS+++  TS S  Q  WF +++ + 
Sbjct  168  LQEFFYDQVPSELRSVGMALNLSIFGAGNFLSSFMISVIDRVTSQSG-QTSWFDNNLNKG  226

Query  205  RLDNYYWFLAVLSAVSLTLFVIFCK  131
             LD +YW LA LS +    ++ F K
Sbjct  227  HLDYFYWLLASLSLIGFAFYLGFTK  251



>ref|XP_009783108.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana sylvestris]
Length=588

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQ +TM RSI P+FKIP AALQS I VSI++ +P+Y++  +P+ R  T    G+T  QR
Sbjct  370  TKQAVTMDRSITPSFKIPSAALQSFINVSIVIFIPIYEQILVPIARTITGTPSGITKLQR  429

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR--NPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLSV+ M IAA  + KRLEI+R     ++ + TVPM+I+WL+PQY+L+GISD FT
Sbjct  430  VGTGIFLSVLTMAIAALVEKKRLEIAREYGSADVPNATVPMTIWWLVPQYLLIGISDAFT  489

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP   R++G++LY S+FG GSF SS LI ++E  T+    + GW SD++
Sbjct  490  MVGLQEFFYDQVPREFRSIGLSLYLSIFGVGSFLSSFLIFVIEK-TTGGKGRDGWISDNL  548

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +  LD +YW L  LSA+    ++ F +
Sbjct  549  NKGHLDYFYWLLCGLSALGFMTYLYFTR  576



>ref|XP_006301502.1| hypothetical protein CARUB_v10021928mg [Capsella rubella]
 gb|EOA34400.1| hypothetical protein CARUB_v10021928mg [Capsella rubella]
Length=454

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 141/208 (68%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQ  I+++I+  +P+YD+ F+P+ R FT    G+T  QR
Sbjct  240  TKQGSTMDRSITPTLLVPAATLQCFISLAILFFIPIYDRLFVPIARSFTHKPAGITTLQR  299

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+MV AA  + KRL+ +R+   L S    VPMS+ WL+PQY+L G+SD+FT
Sbjct  300  ISTGIFLSIISMVTAALVEMKRLKTARDHGMLDSPEAIVPMSVCWLIPQYVLFGVSDVFT  359

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R++G+ALY SV G G+F SS ++S +E  TS S  Q  WF +++
Sbjct  360  MVGLQEFFYGQIPVELRSMGLALYLSVIGIGNFLSSFMVSAIEIATSQSG-QASWFDNNL  418

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V   K
Sbjct  419  NQAHLDYFYWLLACLSSISFVCLVHLAK  446



>ref|XP_010415947.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12-like [Camelina sativa]
Length=555

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 142/208 (68%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I++ II  +P+YD+ F+P+VR FT    G+T  QR
Sbjct  343  TKQGSTMDRSISSTLIVPAATLQCFISLGIIFFIPIYDRLFVPIVRSFTHKPAGITTLQR  402

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+M  AA  + KRL+++R+   + S   TVPMS+ WL+PQYIL G+SD+FT
Sbjct  403  ISTGIFLSIISMATAALVEMKRLKVARDHGLVDSPDATVPMSVCWLIPQYILFGVSDVFT  462

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            ++G+QEFFY E+P  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WF +++
Sbjct  463  MIGLQEFFYGEIPVELRSMGLALYLSIIGIGNFLSSFIVSVIEKATSQSG-QASWFDNNL  521

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V   K
Sbjct  522  NQAHLDYFYWLLACLSSISFVFIVHLAK  549



>ref|XP_002887417.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63676.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=555

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I+++I++ +P+YD+ F+P+ R  T    G+T  QR
Sbjct  341  TKQGSTMDRSISSTLLVPAATLQCFISLAILVFIPIYDRVFVPIARSITRKPAGITTLQR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+MVIAA  + KRL+ +R+   + S   TVPMS+ WL+PQYIL G+SD+FT
Sbjct  401  ISTGIFLSIISMVIAALVEMKRLKTARDHGLVDSPKATVPMSVCWLIPQYILFGVSDVFT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WFS+++
Sbjct  461  MVGLQEFFYGQVPPELRSMGLALYLSIIGIGNFLSSSMVSVIEEATSQSG-QVSWFSNNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS+++    V F K
Sbjct  520  NQAHLDYFYWLLACLSSLAFIFIVYFAK  547



>ref|XP_006856672.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Amborella trichopoda]
 gb|ERN18139.1| hypothetical protein AMTR_s00054p00083290 [Amborella trichopoda]
Length=580

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R +G +F++P AALQS I++ I+L++P YD+ F+P+ R  T    G+++ QR
Sbjct  363  TKQGKTMDRYLGSSFQVPAAALQSFISLGIMLIVPFYDRIFVPIARKITSKPSGISMLQR  422

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +GIGM +SVI+MV+AA  ++KRL+I++    L      VPMS  WL+PQY+  G++D+FT
Sbjct  423  IGIGMVISVISMVLAALVESKRLQIAKEHGLLDDPYAMVPMSFCWLIPQYLFFGMADVFT  482

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY+++P  +R+LG ALY S+ G GSF SS +I+IVE  +++S  +  WF+D++
Sbjct  483  MVGLQEFFYNQMPDGLRSLGAALYLSIIGVGSFLSSAVITIVEMVSTTSGGES-WFADNL  541

Query  214  KEARLDNYYWFLAVLSAVSLTLFVI  140
              A LD +YW LAVLS V   LFV 
Sbjct  542  NRAHLDYFYWLLAVLSGVFFCLFVC  566



>ref|NP_177358.2| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q8RX67.1|PTR24_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.11; Short=AtNPF5.11 
[Arabidopsis thaliana]
 gb|AAL91259.1| At1g72130/F28P5.1 [Arabidopsis thaliana]
 gb|AAN33211.1| At1g72130/F28P5.1 [Arabidopsis thaliana]
 gb|AEE35278.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=538

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQS I +S+++ +P+YD+  +P  R FT N  G+T  QR
Sbjct  329  TKQGATMDRSISPGLLVPAATLQSFINLSVVVFIPIYDRLLVPFARSFTQNSSGITTLQR  388

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++AMV+AA  +TKRL+ +R+       ++PMS++WL+PQY++ G+SD+FT+V
Sbjct  389  IGTGIFLSILAMVLAALVETKRLQAARD-----ELSIPMSVWWLIPQYVIFGVSDMFTMV  443

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFY +VP+ +R++G+AL  S++G G++ SS +IS+++  T+    Q  WF +D+ +
Sbjct  444  GLQEFFYGQVPSELRSVGMALNLSIYGAGNYLSSFMISVIDKITNQYG-QRSWFDNDLDQ  502

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            A LD +YW LA L  +    ++ F K
Sbjct  503  AHLDYFYWLLACLGFIGFAFYLWFAK  528



>ref|XP_010665402.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=574

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            T+QGMTM RSIG  F IP ++L+S +T++++L +P+YD  F+P+  VFT    G+T+ QR
Sbjct  357  TEQGMTMDRSIGSGFDIPSSSLKSFLTITVVLFIPIYDLVFVPIATVFTRKPSGITMLQR  416

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGMFLS I++ IAA  + KRL+I++     ++ + TVPM ++WL+PQY+L G+ ++FT
Sbjct  417  IGIGMFLSTISIAIAALVEMKRLKIAQEHGLVDMPNATVPMRVWWLVPQYVLFGLCNVFT  476

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
             +G+QEFFY +VP  +R++G++LY S+ G GSF SS LI  +E  T     Q  WF+D++
Sbjct  477  TIGLQEFFYDQVPNELRSIGVSLYLSIIGVGSFLSSFLIYFIEKATGGDG-QDSWFNDNL  535

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW L+ L+AV L  ++ F K
Sbjct  536  NKAHLDYFYWLLSGLNAVGLATYMHFAK  563



>ref|XP_010428068.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like isoform X2 [Camelina 
sativa]
Length=468

 Score =   186 bits (472),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 148/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+R+I P  KIPPA+LQ  I +SI++ +P+YD+  +P+ R+ T +  G+T+ +R
Sbjct  252  TKQGVTMERTIFPGVKIPPASLQILIGISIVIFVPIYDRVLVPIARLITKDPCGLTMLRR  311

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G+GM LS + MVIAA  ++KRLE ++     +    TVPMSI+WL+PQY+LLG++D+ T
Sbjct  312  IGVGMVLSALTMVIAALVESKRLETAKEHGLIDQPKATVPMSIWWLVPQYLLLGLADVHT  371

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFYS+VP  +R++G+ALY SV G GS  SSLLIS+++  T  +A    WF+ ++
Sbjct  372  IVGLQEFFYSQVPTELRSIGLALYLSVLGVGSLLSSLLISLIDLATGGNAGDS-WFNSNL  430

Query  214  KEARLDNYYWFLAVLSAVSLTL  149
              A LD +YW LAVLSAV + +
Sbjct  431  NRAHLDYFYWLLAVLSAVGVIM  452



>ref|XP_012084631.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Jatropha curcas]
 gb|KDP27339.1| hypothetical protein JCGZ_20271 [Jatropha curcas]
Length=579

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI   F IPPA+LQS  T++ +L +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  360  TKQGKTMDRSITKGFAIPPASLQSFSTIASVLFVPIYDRVFVPVARALTRKTSGITMLQR  419

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIGM LS +++VI A  + KRLEI+R     ++ + TVPMS++WL+PQY+L G+SD+FT
Sbjct  420  IGIGMALSSLSLVICALVEMKRLEIAREYGLVDMPNVTVPMSVWWLVPQYVLFGVSDVFT  479

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G++LY S+FG GS+ SS L+S +E  T     +  WF+++M
Sbjct  480  MVGLQEFFYDQVPSELRSVGLSLYLSIFGVGSYISSFLVSAIEKATGGE-GRDSWFANNM  538

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
                LD +YW LA +S V L  +  F K
Sbjct  539  NRGHLDYFYWLLAGMSTVQLLAYFYFAK  566



>gb|ERM97847.1| hypothetical protein AMTR_s00118p00123380 [Amborella trichopoda]
Length=398

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 148/206 (72%), Gaps = 4/206 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+R+I   F++P A+L+  I+++ +LL+P+YD+ F PL R  T  + G+TV QR
Sbjct  188  TKQGKTMERTIAYGFQLPAASLRVFISLTAVLLLPVYDRLFAPLCRKLTGKEGGITVLQR  247

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            MG G+FL V++MV A   +T+RL+ + +   L   S TVP+SI WLLPQY+L+G++D+F 
Sbjct  248  MGFGIFLCVLSMVAAGIVETRRLKTASDYGQLDEPSATVPISICWLLPQYVLIGVADVFI  307

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
             VG+QEFFY ++P  +R+LG A+  S+ G GSF SS+LIS++E++  S+A    WFSD++
Sbjct  308  KVGLQEFFYDQMPDGLRSLGAAIEMSIVGLGSFMSSILISMIENW--STARGGNWFSDNL  365

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIF  137
             +A LD +YW LA+LS VSL  ++ F
Sbjct  366  NQAHLDYFYWLLALLSGVSLCFYMYF  391



>ref|XP_006302084.1| hypothetical protein CARUB_v10020071mg [Capsella rubella]
 gb|EOA34982.1| hypothetical protein CARUB_v10020071mg [Capsella rubella]
Length=564

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 145/203 (71%), Gaps = 3/203 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+R+I P  KIPPA+LQ  I +SI+L +P+YD+ F+P+ R  T +  G+T  +R
Sbjct  350  TKQGVTMERTILPGVKIPPASLQVFIGISIVLFVPIYDRVFVPIARSITKDPCGITTLKR  409

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM LS I MVIAA  ++KRLE ++     +    TVPMSI+WL+PQY+LLG++D++ 
Sbjct  410  IGTGMVLSCITMVIAALVESKRLETAKEHGLIDQPEATVPMSIWWLIPQYLLLGLADVYF  469

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQEFFYS+VP  +R++G++LY SV G GS  SSLLIS+++   +   +   WF+ ++
Sbjct  470  IVGMQEFFYSQVPTELRSIGLSLYLSVLGVGSLLSSLLISLID-LATGGDDGDSWFNSNL  528

Query  214  KEARLDNYYWFLAVLSAVSLTLF  146
             +A LD +YW LAVLSAV    F
Sbjct  529  NKAHLDCFYWLLAVLSAVGFLTF  551



>ref|XP_010414835.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12-like [Camelina sativa]
Length=557

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 142/208 (68%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I++ II  +P+YD+ F+P+VR FT    G+T  QR
Sbjct  343  TKQGSTMDRSISSTLIVPAATLQCFISLGIIFFIPIYDRLFVPIVRSFTHKPAGITTLQR  402

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+M  AA  + KRL+++R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  403  ISTGIFLSIISMATAALVEMKRLKVARDNGLVDSPDATVPMSVCWLIPQYVLFGVSDVFT  462

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WF +++
Sbjct  463  MVGLQEFFYGQIPVELRSMGLALYLSIIGIGNFLSSFMVSVIEKATSQSG-QASWFDNNL  521

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V   K
Sbjct  522  NQAHLDYFYWLLACLSSISFVFIVHLAK  549



>gb|KFK35753.1| hypothetical protein AALP_AA4G032000 [Arabis alpina]
Length=451

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 147/206 (71%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQ  I +S++  +P+YD+  IP+ R FT N  G+T+ QR
Sbjct  242  TKQGATMDRSILPGLVVPAATLQCLINLSVVAFIPIYDRILIPITRSFTQNPSGITMLQR  301

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++AMVIAA  +TKRL+ +R+       T+P++++WL+PQY++ G+S++FT+V
Sbjct  302  IGTGIFLSILAMVIAALVETKRLQATRD-----DVTIPITVWWLVPQYVIDGVSNVFTIV  356

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFY +VP+ +R++G+AL  S+FG G+F SS +IS+++  TS S  +  WF +D+ +
Sbjct  357  GLQEFFYDQVPSELRSVGMALNLSIFGVGNFLSSFIISVIDKVTSQSG-KTSWFDNDLNQ  415

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            A LD +YW LA LS + L  ++ F K
Sbjct  416  AHLDYFYWLLACLSTIGLASYLWFAK  441



>ref|XP_010428074.1| PREDICTED: protein NRT1/ PTR FAMILY 5.14 [Camelina sativa]
Length=566

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 146/203 (72%), Gaps = 3/203 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+R+I P  KIPPA+LQ  I +SI++ +P+YD+  +P+ R  T +  G+T+ +R
Sbjct  350  TKQGVTMERTIFPGVKIPPASLQVLIGISIVIFVPIYDRVLVPIARSITKDPCGLTMLRR  409

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G+GM LS + MVIAA  ++KRLE ++     +    TVPMSI+WL+PQY+LLG++D+ T
Sbjct  410  IGVGMVLSALTMVIAALVESKRLETAKEHGLIDQPQATVPMSIWWLIPQYLLLGLADVHT  469

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQEFFYS+VP  +R++G+ALY S  G GS  SSLLIS+++  T   A  + WF+ ++
Sbjct  470  LVGMQEFFYSQVPTELRSIGLALYLSALGVGSLLSSLLISVIDLATGGDAG-NSWFNSNL  528

Query  214  KEARLDNYYWFLAVLSAVSLTLF  146
             +A LD +YW LAVLSAV    F
Sbjct  529  NKAHLDYFYWLLAVLSAVGFLTF  551



>ref|XP_010471232.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12 [Camelina sativa]
Length=557

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I+++II  +P+YD+ F+P+VR FT    G+T  QR
Sbjct  343  TKQGSTMDRSISSTLIVPAATLQCFISLAIIFFIPIYDRLFVPIVRSFTHKPAGITTLQR  402

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+M  AA  + KRL+++R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  403  ISTGIFLSIISMATAALVEMKRLKVARDHGLVGSPDATVPMSVCWLIPQYVLFGVSDVFT  462

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R++G+ALY S+ G G+F SS ++S++E  TS S  Q  WF +++
Sbjct  463  MVGLQEFFYGQIPVELRSMGLALYLSIIGIGNFLSSFMVSVIEKATSQSG-QPSWFDNNL  521

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V   K
Sbjct  522  NQAHLDYFYWLLACLSSISFVFIVHLAK  549



>gb|EMT32230.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=417

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 146/206 (71%), Gaps = 4/206 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQ  T+ R +G   ++PPAALQS I+++I+L MP+YD+  +PL R  T    G+T+ QR
Sbjct  198  TKQAATLDRHVGKRVQVPPAALQSFISITIVLFMPIYDRAIVPLARRCTGVSSGITMLQR  257

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNP--ENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G+GM LS+++MV+AA  +T+RL I+ +    +L    VPMS++W++PQY+L G +D+FT
Sbjct  258  IGVGMVLSLVSMVVAALVETRRLRIAADAGLADLPRVPVPMSLWWMVPQYVLFGAADVFT  317

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS L+S ++ +  SS     WFS+++
Sbjct  318  MVGLQEFFYDQVPDKLRSIGLALYLSIFGIGSFISSGLVSGIDKW--SSERGQSWFSNNL  375

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIF  137
                LD +YW +A LSA+ L ++V F
Sbjct  376  NRGHLDYFYWLIAALSALELVVYVFF  401



>ref|XP_007133765.1| hypothetical protein PHAVU_011G207100g [Phaseolus vulgaris]
 gb|ESW05759.1| hypothetical protein PHAVU_011G207100g [Phaseolus vulgaris]
Length=605

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 145/203 (71%), Gaps = 4/203 (2%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG TM RSIGP+F+IPPA+LQ  + V+I+  +P YD+ F+PL R FT    G+TV QR+
Sbjct  371  KQGATMVRSIGPHFQIPPASLQGLVGVTILFAVPFYDRVFVPLARKFTGKASGITVLQRI  430

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFTV  392
            G+G+FLSV+ MV++A  + KR+ +++    +      +P++I+WLLPQY++ G+SD FT+
Sbjct  431  GVGLFLSVLNMVVSAIVEAKRVGVAKEHGLIDDPKAVLPITIWWLLPQYMITGMSDAFTI  490

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VG+QE FY ++P ++R+LG A Y S+ G GSF  +++I +VE  TS S  +  W  D++ 
Sbjct  491  VGLQELFYDQMPHSLRSLGAAAYISIVGVGSFLGNIVIVVVETITSRSGEK--WLGDNIN  548

Query  211  EARLDNYYWFLAVLSAVSLTLFV  143
            +A LD +YW LAVLSAV+L L+V
Sbjct  549  KAHLDYFYWVLAVLSAVNLGLYV  571



>ref|XP_010521166.1| PREDICTED: protein NRT1/ PTR FAMILY 5.14-like [Tarenaya hassleriana]
 ref|XP_010521167.1| PREDICTED: protein NRT1/ PTR FAMILY 5.14-like [Tarenaya hassleriana]
Length=566

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 144/210 (69%), Gaps = 11/210 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQGM+M R I P  K+ PA+LQ  I +SII+L+P YD+ F+P+ R FT    G+ + QR
Sbjct  350  TKQGMSMDRDIFPGVKVSPASLQILIGLSIIVLVPFYDRVFVPIARSFTKETSGIKMLQR  409

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSET---VPMSIFWLLPQYILLGISDIF  398
            +G GM +S + MV+AA  + KRL+ +R    L+ +    VPMSI+WL+PQY+LLG++D+F
Sbjct  410  IGTGMIVSAVTMVVAALVEAKRLKTARE-HGLTEQKDAMVPMSIWWLIPQYLLLGLADVF  468

Query  397  TVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDD  218
            T++GMQEFFYS+VP  +R++G+ALY+SV G GS  S +LIS+++  T   A    WF D+
Sbjct  469  TLIGMQEFFYSQVPTELRSIGLALYSSVLGVGSILSGVLISVIDSAT-IGAGGLSWFDDN  527

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
            + +A LD +YW LA LSAV       FC F
Sbjct  528  LNKAHLDYFYWLLAALSAVG------FCAF  551



>ref|XP_009593536.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana tomentosiformis]
Length=588

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQ +TM RSI P+F+IP AALQS I VSI++ +P+Y++  +P+ R  T    G+T  QR
Sbjct  371  TKQAVTMDRSITPSFRIPSAALQSFINVSIVIFIPIYEQILVPIARTITGTPSGITKLQR  430

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR--NPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLSV+ M IAA  + KRLEI+R     ++ + TVPM+I+WL+PQY+L+GISD FT
Sbjct  431  VGTGIFLSVLTMAIAALVEKKRLEIAREYGSADVPNATVPMTIWWLVPQYLLIGISDAFT  490

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP   R++G++LY S+FG GSF SS LI +VE  T+    + GW SD++
Sbjct  491  MVGLQEFFYDQVPREFRSIGLSLYLSIFGVGSFLSSFLIFVVEK-TTGGKGEDGWISDNL  549

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +  LD +YW L  +SA+    ++ F +
Sbjct  550  NKGHLDYFYWLLCGVSALGFMTYLYFTR  577



>ref|XP_009127904.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12 [Brassica rapa]
Length=555

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI   F IP A LQ  I+V+I++ +P+YD+  +P+ R  T    G+T  QR
Sbjct  341  TKQGATMDRSISSTFSIPAATLQGFISVAILVFIPIYDRVLVPIARSITHKPAGITTLQR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+++MVIAA  + KRL+ +R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  401  ISTGIFLSILSMVIAALVEMKRLKTARDHRLVDSPNATVPMSVCWLIPQYVLYGVSDVFT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R+LG+++Y SV G G++ SS ++S++E  T S   Q  WF +++
Sbjct  461  MVGLQEFFYGQIPVELRSLGLSMYLSVIGIGNYLSSFMVSVIEKAT-SQPGQASWFDNNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V F K
Sbjct  520  NQAHLDYFYWLLACLSSISFVSLVYFAK  547



>ref|XP_010428067.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like isoform X1 [Camelina 
sativa]
Length=558

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 148/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+R+I P  KIPPA+LQ  I +SI++ +P+YD+  +P+ R+ T +  G+T+ +R
Sbjct  342  TKQGVTMERTIFPGVKIPPASLQILIGISIVIFVPIYDRVLVPIARLITKDPCGLTMLRR  401

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G+GM LS + MVIAA  ++KRLE ++     +    TVPMSI+WL+PQY+LLG++D+ T
Sbjct  402  IGVGMVLSALTMVIAALVESKRLETAKEHGLIDQPKATVPMSIWWLVPQYLLLGLADVHT  461

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFYS+VP  +R++G+ALY SV G GS  SSLLIS+++  T  +A    WF+ ++
Sbjct  462  IVGLQEFFYSQVPTELRSIGLALYLSVLGVGSLLSSLLISLIDLATGGNAGDS-WFNSNL  520

Query  214  KEARLDNYYWFLAVLSAVSLTL  149
              A LD +YW LAVLSAV + +
Sbjct  521  NRAHLDYFYWLLAVLSAVGVIM  542



>ref|XP_010272857.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=579

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI   F+IPPA+LQS I +SI++ +P+YD+  +P+ R +T    G+T+ QR
Sbjct  363  TKQGYTMDRSITSGFEIPPASLQSIIFLSIVIFIPIYDRVIVPIARAYTRKPSGITILQR  422

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS+I+MV+AA  +  RL ++R     ++   T+PM ++WL+PQY L G++D F 
Sbjct  423  IGTGMFLSIISMVVAAVVEKVRLRVARESGLIDMPQATLPMKVWWLIPQYFLFGVADAFA  482

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG G+F SS LI ++E  TS    Q  WF++++
Sbjct  483  MVGLQEFFYDQVPKGLRSMGLSLYLSIFGMGNFLSSFLIFVIEKATSREG-QENWFANNL  541

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD YY  L  LSAV L L++ F K
Sbjct  542  NQAHLDWYYCLLTGLSAVELALYLYFAK  569



>ref|XP_006403574.1| hypothetical protein EUTSA_v10010667mg [Eutrema salsugineum]
 gb|ESQ45027.1| hypothetical protein EUTSA_v10010667mg [Eutrema salsugineum]
Length=242

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 139/202 (69%), Gaps = 4/202 (2%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG  M R+IG +F IPPAA QS + V+I++L+P YD+ F+P +R  T +  G+T  QR+
Sbjct  15   KQGSMMNRTIGDHFTIPPAAFQSIVGVTILILIPFYDRVFVPTLRKITNHHSGITSLQRI  74

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFTV  392
            G+G+F++ + M+I    + KRL+++R+   + S  E VPMS  WLLPQYIL+GI D+FT+
Sbjct  75   GVGLFVATLNMMICGLVEAKRLKVARDHGLIDSPKEVVPMSSLWLLPQYILVGIGDVFTI  134

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQE FY ++P  MR++G A++ SV G GSF S+ +IS V+  + S   +  W  +++ 
Sbjct  135  VGMQELFYDQMPETMRSIGAAIFISVVGVGSFVSTGIISAVQTISKSHGEE--WLVNNLN  192

Query  211  EARLDNYYWFLAVLSAVSLTLF  146
             A LD +YW +A+L+AVSL  +
Sbjct  193  RAHLDYFYWVIALLNAVSLCFY  214



>ref|XP_010534099.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Tarenaya hassleriana]
Length=561

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS  P FKIP A LQS I+++I++ +P+YD+  IP+ R  T    G+T+ Q 
Sbjct  345  TKQGATMDRSFLPGFKIPAATLQSFISLAIVIFIPIYDRILIPVARSMTHKPAGITMLQS  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS++AMVIAA  + KRL+ + +    +L++ T+PMS++WL+PQY+L GISD+F 
Sbjct  405  IGTGIFLSLVAMVIAALVEMKRLKTAEDYGLVDLANATIPMSVWWLIPQYVLFGISDVFA  464

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G++LY S+FG G+F SS +IS++E  TS S     WF++D+
Sbjct  465  MVGLQEFFYDQVPSELRSVGLSLYLSIFGIGNFLSSFMISVIEKATSQSGGVS-WFANDL  523

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +  LD +YW LA LS + L  +  F K
Sbjct  524  NKGHLDYFYWLLAGLSFIGLASYSYFAK  551



>ref|XP_004511030.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Cicer arietinum]
Length=571

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 150/212 (71%), Gaps = 12/212 (6%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG T+  +IG NF+ PPA+LQ  + V+I+ ++P+YD+ F+PL R FT +  G+TV QR
Sbjct  339  TKQGGTLIHTIGSNFQFPPASLQGLVGVTILFVVPIYDRVFVPLARKFTHHPNGITVLQR  398

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR------NPENLSSETVPMSIFWLLPQYILLGIS  407
            +G+G+FLS++ MV++A  +TKR+ +++      NP    SE +PMSI+WLLPQY++ G+S
Sbjct  399  IGVGLFLSILTMVVSALVETKRVTVAKSHGLIDNP----SEILPMSIWWLLPQYMITGVS  454

Query  406  DIFTVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWF  227
            D FT+VG+QE FY ++P  +R+LG A Y S+ G GSF S+++I IVE  TS S  +  W 
Sbjct  455  DAFTIVGLQELFYDQMPEGLRSLGAAAYISIVGVGSFVSNIIIVIVEVITSKSGEK--WL  512

Query  226  SDDMKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +++  A LD+YYW +AVL A++L +++   K
Sbjct  513  GNNINRAHLDDYYWVMAVLCALNLGVYMWIAK  544



>ref|XP_011096252.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Sesamum indicum]
Length=563

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM R I P F+IP A+LQS I++SI++ +P+YD+  +P+ R  +    G+++ QR
Sbjct  347  TKQGVTMDRYITPTFQIPAASLQSVISLSIVIFIPVYDRILVPIARAISGKPSGISMLQR  406

Query  568  MGIGMFLSVIAMVIAAFTDTKRLE--ISRNPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+++MVIAA  + KRL+  I     ++   TVPMS++WL PQY+L G+SD+FT
Sbjct  407  IGTGIFLSLLSMVIAALVERKRLQTAIQYGLVDMPKATVPMSVWWLTPQYLLFGVSDVFT  466

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP+ +R++G+ALY S+FG GSF SS LIS++E  T     Q  WFS+++
Sbjct  467  MVGLQEFFYDQVPSELRSIGLALYLSIFGVGSFISSFLISVIEKATGGQG-QDSWFSNNL  525

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LS  +   ++ F K
Sbjct  526  NRAHLDYFYWLLAGLSTAAFITYLYFAK  553



>emb|CDY03656.1| BnaA02g15810D [Brassica napus]
Length=555

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI   F +P A LQ  I+V+I++ +P+YD+  +P+ R  T    G+T  QR
Sbjct  341  TKQGATMDRSISSTFSVPAATLQGFISVAILVFIPIYDRVLVPIARSITHKPAGITTLQR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+++MVIAA  + KRL+ +R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  401  ISTGIFLSILSMVIAALVEMKRLKTARDHRLVDSPNATVPMSVCWLIPQYVLYGVSDVFT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R+LG+++Y SV G G++ SS ++S++E  T S   Q  WF +++
Sbjct  461  MVGLQEFFYGQIPVELRSLGLSMYLSVIGIGNYLSSFMVSVIEKAT-SQPGQASWFDNNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V F K
Sbjct  520  NQAHLDYFYWLLACLSSISFVSLVYFAK  547



>ref|XP_009362428.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Pyrus x bretschneideri]
Length=557

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 150/208 (72%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R+I P F +P A+LQ+  +++II+ +P+YD+ F+P+ R FT    G+++ QR
Sbjct  342  TKQGATMDRTIVPGFDVPAASLQTLSSIAIIISLPIYDRIFVPVARSFTRIPSGISMLQR  401

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            +G GMF+S+I+MVIAA  + KRL+ +++   L   S TVPM I+WL+PQY+L GISDIFT
Sbjct  402  IGTGMFMSIISMVIAALVEMKRLKTAKDYGLLDTPSATVPMCIWWLVPQYLLTGISDIFT  461

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS LIS+++  T S   +  WFS+++
Sbjct  462  MVGLQEFFYDQVPNELRSVGLALYLSIFGVGSFISSCLISVIDDIT-SLPGESSWFSNNL  520

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW L  +S V L +++ F K
Sbjct  521  NRAHLDYFYWLLGGISLVQLVIYLYFVK  548



>ref|NP_177357.2| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q8VZE2.2|PTR22_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.14; Short=AtNPF5.14; 
AltName: Full=Nitrate transporter 1.15 [Arabidopsis thaliana]
 gb|AEE35276.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=557

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM R+I P  KIPPA+LQ  I +SI+L +P+YD+ F+P+ R+ T    G+T  +R
Sbjct  341  TKQGVTMDRTILPGVKIPPASLQVFIGISIVLFVPIYDRVFVPIARLITKEPCGITTLKR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+ LS I MVIAA  + KRLE ++     +    T+PMSI+WL+PQY+LLG++D++T
Sbjct  401  IGTGIVLSTITMVIAALVEFKRLETAKEHGLIDQPEATLPMSIWWLIPQYLLLGLADVYT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQEFFYS+VP  +R++G+ALY S  G GS  SSLLIS+++  T   A  + WF+ ++
Sbjct  461  LVGMQEFFYSQVPTELRSIGLALYLSALGVGSLLSSLLISLIDLATGGDAG-NSWFNSNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA++SAV    F+   K
Sbjct  520  NRAHLDYFYWLLAIVSAVGFFTFLFISK  547



>emb|CDX82183.1| BnaC02g21070D [Brassica napus]
Length=554

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI   F +P A LQ  I+VSI++ +P+YD+  +P+ R  T    G+T  QR
Sbjct  340  TKQGATMDRSISSTFSVPAATLQGFISVSILVFIPIYDRVLVPIARSITHKPAGITTLQR  399

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+++MVIAA  + KRL+ +R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  400  ITTGIFLSILSMVIAALVEMKRLKTARDHGLVDSPNATVPMSVCWLIPQYVLYGVSDVFT  459

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R+LG+++Y SV G G++ SS ++S++E  T S   Q  WF +++
Sbjct  460  MVGLQEFFYGQIPVELRSLGLSMYLSVIGIGNYLSSFMVSVIEKAT-SQPGQASWFDNNL  518

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V F K
Sbjct  519  NQAHLDYFYWLLACLSSISFVSLVYFAK  546



>gb|AAL57662.1| At1g72120/F28P5_2 [Arabidopsis thaliana]
 gb|AAN46774.1| At1g72120/F28P5_2 [Arabidopsis thaliana]
Length=557

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM R+I P  KIPPA+LQ  I +SI+L +P+YD+ F+P+ R+ T    G+T  +R
Sbjct  341  TKQGVTMDRTILPGVKIPPASLQVFIGISIVLFVPIYDRVFVPIARLITKEPCGITTLKR  400

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+ LS I MVIAA  + KRLE ++     +    T+PMSI+WL+PQY+LLG++D++T
Sbjct  401  IGTGIVLSTITMVIAALVEFKRLETAKEHGLIDQPEATLPMSIWWLIPQYLLLGLADVYT  460

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQEFFYS+VP  +R++G+ALY S  G GS  SSLLIS+++  T   A  + WF+ ++
Sbjct  461  LVGMQEFFYSQVPTELRSIGLALYLSALGVGSLLSSLLISLIDLATGGDAG-NSWFNSNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA++SAV    F+   K
Sbjct  520  NRAHLDYFYWLLAIVSAVGFFTFLFISK  547



>emb|CAN63511.1| hypothetical protein VITISV_031692 [Vitis vinifera]
Length=532

 Score =   185 bits (469),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS+G  F +P A+ QS I ++I+L +P+YD  F+P  R FT N  G+T+ QR
Sbjct  316  TKQGATMDRSVGLGFDLPAASSQSFIGITIVLFVPIYDCIFVPSARAFTRNQSGITMLQR  375

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FL  ++MV+AA  + KRL+ ++     ++ +  VPM ++WLLPQYIL GI+D+FT
Sbjct  376  IGTGIFLYAVSMVVAALVEMKRLKTAQEYGLVDMPNALVPMKLWWLLPQYILFGIADVFT  435

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG GSF SSLLI+++E  T     Q  WF+D++
Sbjct  436  MVGLQEFFYDQVPNELRSVGLSLYLSIFGVGSFLSSLLIAVIEKATGGDG-QDSWFTDNL  494

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LS V L  ++ F K
Sbjct  495  NRAHLDYFYWLLAGLSTVELAAYLYFAK  522



>gb|ERM97848.1| hypothetical protein AMTR_s00118p00128710 [Amborella trichopoda]
Length=263

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 144/209 (69%), Gaps = 7/209 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGP-NFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLND--KGVTV  578
            TKQG  M R +G   F+IPPAA+Q+  ++S +  +P+YD   +P+ R  +  D  KG+T+
Sbjct  44   TKQGTMMDRRVGSRGFEIPPAAMQTFTSISSVSFVPIYDLVIVPIARKLSSKDSGKGITM  103

Query  577  RQRMGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISD  404
             QR+GIG+ LS++ MV+AA  ++KRLEI+R     ++    VPMS  WL+PQY+L G+S+
Sbjct  104  LQRIGIGISLSILTMVVAALVESKRLEIARELGLIDVPGAVVPMSCLWLIPQYMLFGVSE  163

Query  403  IFTVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFS  224
            +FT+VG+QEFFY ++P  +R+LG ALY SV G GS  SS+LIS++E   +S A    WFS
Sbjct  164  VFTIVGLQEFFYDQMPDALRSLGAALYLSVIGIGSLLSSILISLIER--ASIAGGESWFS  221

Query  223  DDMKEARLDNYYWFLAVLSAVSLTLFVIF  137
            D++  A LD +YW LA+L+  SL LFV F
Sbjct  222  DNLNRAHLDYFYWLLALLTTFSLCLFVFF  250



>ref|XP_009362432.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Pyrus x bretschneideri]
Length=557

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 148/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R+I P F +P A+LQ+ I+ +I++ +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  342  TKQGATMDRTIVPGFNVPAASLQTFISFAIVIFLPIYDRIFVPIARSVTGKPAGITMLQR  401

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            +G GM LS+I MVIAA  + KRL+ +++   L   S TVPMSI+WL+PQY+L GI+D+FT
Sbjct  402  IGTGMVLSIILMVIAALVEMKRLKTAKDYGLLDTPSATVPMSIWWLVPQYLLAGIADVFT  461

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS LIS+++  T S A +  WFS ++
Sbjct  462  MVGLQEFFYDQVPNELRSVGLALYLSIFGVGSFLSSFLISVIDDIT-SLAGESSWFSSNL  520

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW L  +S V L +++ F K
Sbjct  521  NRAHLDYFYWLLGGISLVQLVIYLYFAK  548



>ref|XP_009104872.1| PREDICTED: protein NRT1/ PTR FAMILY 5.11-like [Brassica rapa]
 emb|CDX68282.1| BnaA07g23220D [Brassica napus]
Length=522

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 145/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A+L    +++II+ +PLYD   +P+ ++FT N  G+T+ QR
Sbjct  313  TKQGATMNRSISPGLLVPAASLHGVTSLTIIVFIPLYDHLRVPMGKLFTHNSSGITMLQR  372

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++AMV+AA  + KRL+ +++       TVP+S++WL+PQY+ +G+SD+FT +
Sbjct  373  IGTGIFLSILAMVVAALVEIKRLQAAKD-----DVTVPISVWWLIPQYVFIGLSDVFTRI  427

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QE FY +VP  +R+LG+AL  S++G G+F SS +IS+++  TS S  Q  WF +D+ E
Sbjct  428  GLQELFYDQVPCELRSLGMALNLSIYGVGNFLSSFMISVIDKVTSHSG-QTSWFDNDLNE  486

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
              LD +YW LA LS+++L  ++ F K
Sbjct  487  GHLDYFYWLLACLSSIALAFYLWFAK  512



>gb|AAG51788.1|AC067754_4 peptide transporter PTR2-B, putative; 1146-4383 [Arabidopsis 
thaliana]
Length=812

 Score =   187 bits (474),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQS I +S+++ +P+YD+  +P  R FT N  G+T  QR
Sbjct  329  TKQGATMDRSISPGLLVPAATLQSFINLSVVVFIPIYDRLLVPFARSFTQNSSGITTLQR  388

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++AMV+AA  +TKRL+ +R+       ++PMS++WL+PQY++ G+SD+FT+V
Sbjct  389  IGTGIFLSILAMVLAALVETKRLQAARD-----ELSIPMSVWWLIPQYVIFGVSDMFTMV  443

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFY +VP+ +R++G+AL  S++G G++ SS +IS+++  T+    Q  WF +D+ +
Sbjct  444  GLQEFFYGQVPSELRSVGMALNLSIYGAGNYLSSFMISVIDKITNQYG-QRSWFDNDLDQ  502

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            A LD +YW LA L  +    ++ F K
Sbjct  503  AHLDYFYWLLACLGFIGFAFYLWFAK  528



>ref|XP_008783395.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Phoenix dactylifera]
Length=558

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 147/204 (72%), Gaps = 4/204 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG T+ R IG N ++ PAALQS I+ SI+  +P+YD+  +P+ R FT    G T+ QR
Sbjct  340  TKQGSTLDRRIGSNLEVSPAALQSFISASIVAFIPIYDRILVPIARKFTKKPAGFTMLQR  399

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM +S+I+MV+AA  + KRLE +R+    +  + T+PMS++WL+PQY+L GI+D+FT
Sbjct  400  IGTGMVISLISMVVAALVELKRLETARDFGLVDQPTATIPMSLWWLVPQYVLYGIADVFT  459

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R+LG+ALY S+FG GSF SS L+S+++  T+ S     WFS+++
Sbjct  460  MVGLQEFFYDQIPDALRSLGLALYLSIFGIGSFISSFLVSMIDKATAESGES--WFSNNL  517

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
              A LD +YW LA LSAV L +++
Sbjct  518  NRAHLDYFYWLLAGLSAVELVIYL  541



>gb|KHG19841.1| hypothetical protein F383_03296 [Gossypium arboreum]
Length=571

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 144/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI   FKIP A+L S I+++I++ +P+YD+ F+PL R  T    G+T+ QR
Sbjct  355  TKQGATMDRSITAGFKIPAASLLSFISLTIMIFIPIYDRIFVPLARALTGKPAGITMLQR  414

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM LS I+M+IAA  + +RL+ +      +  + TVPMSI+WLLPQYIL G+SD+F 
Sbjct  415  IGTGMLLSAISMLIAALVEMRRLKTAEEYGLVDKPNVTVPMSIWWLLPQYILSGLSDVFA  474

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS LIS +E  T     Q  WF++++
Sbjct  475  MVGLQEFFYHQVPKELRSVGLALYLSIFGVGSFLSSFLISAIEKMT-GEGGQDSWFANNL  533

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LSA+ L LF+   K
Sbjct  534  NRAHLDYFYWLLAALSAMGLALFLSSAK  561



>ref|XP_009593533.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana tomentosiformis]
Length=572

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 146/212 (69%), Gaps = 11/212 (5%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG NFKIP A+LQ  + +S + L+P+YD   IPL R  T    G+T+ QR
Sbjct  356  TKQGVTMDRSIGSNFKIPAASLQCFLGISTVFLIPIYDCILIPLARSITRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEIS------RNPENLSSETVPMSIFWLLPQYILLGIS  407
            +G G+F+S++A+V AA  +  RL+ +       NP+     T+PMSI+WL+PQY+L GIS
Sbjct  416  IGTGIFVSILAIVTAAIVEKIRLQTALEYGLLDNPK----ATIPMSIWWLIPQYLLYGIS  471

Query  406  DIFTVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWF  227
            +IFT+VG+QEFFY +VP  +R++G+ALY S+ G G+F SS LIS +   T+ +  Q  WF
Sbjct  472  EIFTLVGLQEFFYDQVPVELRSVGLALYLSLAGVGNFLSSFLISFIAKATAKNG-QDSWF  530

Query  226  SDDMKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            SD++  A LD +YW L+ LS +S TL++ F +
Sbjct  531  SDNLNRAHLDYFYWLLSGLSVLSFTLYLYFAR  562



>ref|XP_006387190.1| hypothetical protein POPTR_1576s00200g, partial [Populus trichocarpa]
 gb|ERP46104.1| hypothetical protein POPTR_1576s00200g, partial [Populus trichocarpa]
Length=271

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 140/208 (67%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG T+ R+I   FKIP A+LQ  I  +IIL +P+YD+  +P+ R  T    G+T+ QR
Sbjct  55   TKQGATLDRTIVSGFKIPAASLQIFIGFAIILFIPVYDRIVVPISRGLTRKPSGITMLQR  114

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM  S I+MV AA  + KRLE ++     +L + TVPMSI+WL+PQYIL GI+D+ T
Sbjct  115  IGTGMVFSAISMVTAALVEMKRLETAKEHGLVDLPNVTVPMSIWWLVPQYILCGIADVLT  174

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEF Y +VP  +R+LGI+LY S+ G G+F SS L+S+++  TS    Q  WF++++
Sbjct  175  IVGLQEFCYDQVPKELRSLGISLYLSILGVGNFLSSFLVSVIDEATSGDG-QESWFANNL  233

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA LSAV    ++ F +
Sbjct  234  NRAHLDYFYWLLAGLSAVGFIAYLYFAR  261



>dbj|BAD82718.1| oligopeptide transporter-like protein [Oryza sativa Japonica 
Group]
Length=300

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 147/212 (69%), Gaps = 13/212 (6%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQ  T+ R IG    IP AALQS I+VSI++ +P+YD+  +PL R ++ N +G+T  QR
Sbjct  84   TKQASTLDRWIG-KVHIPAAALQSLISVSIVISVPIYDRILVPLTRRYSKNPRGITTLQR  142

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR------NPENLSSETVPMSIFWLLPQYILLGIS  407
            +GIG+ +SVI MV++A  +T+RL ++R      NPE     T+PMS +W++PQ+IL G++
Sbjct  143  IGIGLIISVILMVVSALVETRRLMVARDFGLVDNPE----ATIPMSFWWVVPQFILTGLA  198

Query  406  DIFTVVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWF  227
            D+FT+VG+QEFFY +VP  +R+LG+ALY S+FG GSF SS L+  ++  TS + +   WF
Sbjct  199  DMFTMVGLQEFFYDQVPDGLRSLGLALYLSIFGIGSFISSFLVYAIDKVTSMTGDS--WF  256

Query  226  SDDMKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            SD++    LD +YW LAVLS + L  ++ F +
Sbjct  257  SDNLNRGHLDYFYWLLAVLSVLGLAAYLHFSR  288



>ref|XP_006376230.1| hypothetical protein POPTR_0013s11170g [Populus trichocarpa]
 gb|ERP54027.1| hypothetical protein POPTR_0013s11170g [Populus trichocarpa]
Length=491

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 144/209 (69%), Gaps = 5/209 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A+LQS I++SI+ L+P YD+  +P  R  T    G+T+ QR
Sbjct  275  TKQGATMDRSISPGLDVPAASLQSLISLSIVFLIPFYDRVLVPTARAITRKPSGITMLQR  334

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS ++MV++A  + KRL+ +R     +L + T+PMS+ WL+PQYI+ G +D+F 
Sbjct  335  IGTGIFLSALSMVLSAVVEMKRLKTAREYGLVDLPNTTIPMSVCWLVPQYIVYGAADVFA  394

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHG-WFSDD  218
            +VG+QEFFY +VP+ +R++G++LY S+FG GSF SS LIS +E  T    + HG WF+D+
Sbjct  395  MVGLQEFFYDQVPSELRSVGLSLYLSIFGVGSFLSSFLISGIEKAT--GGDGHGSWFADN  452

Query  217  MKEARLDNYYWFLAVLSAVSLTLFVIFCK  131
            +  A LD +YW LA LS V L  F+ F K
Sbjct  453  LNRAHLDYFYWLLAGLSVVQLVAFLYFSK  481



>gb|EYU22787.1| hypothetical protein MIMGU_mgv1a003626mg [Erythranthe guttata]
Length=573

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM R I   F+IPPA+LQS I++SI+L +P+YD+  +P+ R  +    G+++ QR
Sbjct  357  TKQGVTMDRHITSTFQIPPASLQSLISLSIVLFIPIYDRILVPIARSISRKPSGISMLQR  416

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+FLS+++MVIAA  + KRL  +      +     VPMS++WL PQY+L G+SD+FT
Sbjct  417  IGSGIFLSLLSMVIAALVERKRLATAAEHGLVDDPKAVVPMSVWWLAPQYLLFGVSDVFT  476

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS LIS++E +T S  ++  WFSD++
Sbjct  477  MVGLQEFFYDQVPTELRSIGLALYLSIFGVGSFISSFLISVIEKYT-SGPSKDSWFSDNL  535

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A +D +YW LA  S V+   +V F K
Sbjct  536  NRAHIDYFYWLLAGFSGVAFIAYVYFAK  563



>gb|KHN37667.1| Putative peptide/nitrate transporter [Glycine soja]
Length=561

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 143/203 (70%), Gaps = 2/203 (1%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG TM+RSIGP+F++PPA+LQ  + V+I+  +P YD+ F+PL R  T    G+TV QR+
Sbjct  326  KQGATMERSIGPHFQVPPASLQGLVGVTILFAVPFYDRVFVPLARKITGKPTGITVLQRI  385

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFTV  392
            G+G+FLS++ MV++A  + KR+ +++    +      +P+SI+WLLPQY++ GISD FT+
Sbjct  386  GVGLFLSILNMVVSALVEDKRVGVAKEFGLIDDPKAVLPISIWWLLPQYMITGISDAFTI  445

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VG+QE FY ++P ++R+LG A Y S+ G GSF  +++I +VE  TS + +   W  +++ 
Sbjct  446  VGLQELFYDQMPESLRSLGAAAYISIVGVGSFVGNIVIIVVEAVTSRAGDGEKWLGNNLN  505

Query  211  EARLDNYYWFLAVLSAVSLTLFV  143
             A LD +YW LA LSAV+L ++V
Sbjct  506  RAHLDYFYWVLAGLSAVNLCVYV  528



>emb|CBI39325.3| unnamed protein product [Vitis vinifera]
Length=2163

 Score =   190 bits (482),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = -2

Query  748   TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
             TKQG+TM RS+G  F IP A+LQS IT++II+ +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  894   TKQGITMDRSLGSGFVIPAASLQSFITLAIIIFIPIYDRIFVPIARSLTRKPSGITMLQR  953

Query  568   MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
             +G G+FLS I+MVIAA  + KRL+ +      ++   TVPMS+ WL+PQYIL G+SD+FT
Sbjct  954   IGTGIFLSCISMVIAALVEMKRLKTAEEYGLIDMPKVTVPMSVCWLIPQYILFGVSDVFT  1013

Query  394   VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
             +VG+QEFFY +VP  +R++G+ALY S+FG G+F SS LIS+++  T++   Q  WF+D++
Sbjct  1014  MVGLQEFFYDQVPNELRSVGLALYLSIFGVGNFLSSFLISVIDK-TTNGDGQGSWFNDNL  1072

Query  214   KEARLDNYYWFLAVLSAVSL  155
              +A LD +YW LA LSAV  
Sbjct  1073  NQAHLDYFYWLLAGLSAVGC  1092


 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 145/204 (71%), Gaps = 3/204 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RS G  FK+P A+LQ  I+ SI+L +P+YD+  +P+ RV T    G+T+ QR
Sbjct  356  TKQGVTMDRSFGSGFKVPAASLQCFISFSILLFVPIYDRILVPIARVLTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS+IAMV AA  + +RL+ +      ++ + T+PM+++WL+PQY++ G++ +FT
Sbjct  416  IGTGMFLSIIAMVFAALVEVQRLKTAEQYGLVDMPNATIPMAVWWLIPQYVIFGVAQVFT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY EVP  +R++G++LY S+FG GSF SS LIS++   T+    Q  WF+D++
Sbjct  476  MVGLQEFFYDEVPNELRSVGLSLYLSIFGVGSFLSSFLISVINK-TTGGDGQTSWFNDNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
             +A LD +YW LA LS V  + ++
Sbjct  535  NQAHLDYFYWLLAGLSTVGFSTYL  558


 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 126/190 (66%), Gaps = 3/190 (2%)
 Frame = -2

Query  748   TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
             TKQG+TM RS G  F IP A+LQS  T +I++ +P+YD+  +P+ R  T    G+++ QR
Sbjct  1947  TKQGITMDRSTGLGFDIPAASLQSLNTTTIVIFIPIYDRILVPIARHLTRKPSGLSMLQR  2006

Query  568   MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
             +G GMFL +I+MVIAA  + KRL+ +      +  + T+PMS++WL+PQY+L G+ D   
Sbjct  2007  IGTGMFLYIISMVIAALIEVKRLKKAEEHGLVDTPNVTIPMSVWWLVPQYVLSGVGDALA  2066

Query  394   VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
             +VG QEFFY + P  +R++GIAL  S+FG GSF SS LIS  +  T    +   WF+D++
Sbjct  2067  MVGFQEFFYDQAPNELRSVGIALNLSIFGLGSFLSSFLISATDKVTGGDGHDS-WFNDNL  2125

Query  214   KEARLDNYYW  185
              +A LD +YW
Sbjct  2126  NKAHLDYFYW  2135


 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 111/200 (56%), Gaps = 32/200 (16%)
 Frame = -2

Query  748   TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
             TKQG T+ RSIG  F IP A+LQ    +++++ +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  1437  TKQGTTLDRSIGSGFHIPAASLQFFRALTVLIFIPIYDRIFVPIARSLTRKPSGITMLQR  1496

Query  568   MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
             +GIG+FL  I MVIAA  + KRL+ +   E  ++   T+PM                   
Sbjct  1497  IGIGIFLIAITMVIAALVELKRLKTAEEYELLDMPKTTLPM-------------------  1537

Query  394   VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
                       ++P+ +R++G++L  S+ G G   S+ LIS++   TS    +  WFSD++
Sbjct  1538  ----------KIPSELRSVGVSLQLSIVGLGRLLSTSLISVIGKITSGDG-RDSWFSDNL  1586

Query  214   KEARLDNYYWFLAVLSAVSL  155
               A LD +YW LA ++A+ L
Sbjct  1587  NRAHLDYFYWLLAGVTAIGL  1606



>ref|XP_010418901.1| PREDICTED: protein NRT1/ PTR FAMILY 5.11-like [Camelina sativa]
Length=523

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 147/206 (71%), Gaps = 6/206 (3%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQ  I++++++ +PLYD+  +P+ R FT N  G+T+ QR
Sbjct  310  TKQGATMNRSILPGLLVPAATLQCFISLTMVIFIPLYDRLLVPVARSFTQNPSGITMLQR  369

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSETVPMSIFWLLPQYILLGISDIFTVV  389
            +G G+FLS++A+V+AA  +T+RL+ +R+       T+ MS++WL+PQY++ G++D+FT+V
Sbjct  370  IGTGIFLSILAIVVAALVETQRLQTARD-----DVTILMSVWWLVPQYVIFGVADVFTMV  424

Query  388  GMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMKE  209
            G+QEFFY +VP  +R++G+AL  S++G G+F SS +ISI++  TS S  Q  WF +D+ +
Sbjct  425  GLQEFFYDQVPCELRSVGMALNLSIYGVGNFLSSFMISIIDKVTSQSG-QTSWFDNDLNQ  483

Query  208  ARLDNYYWFLAVLSAVSLTLFVIFCK  131
            A LD +YW LA LS+  L  ++ F K
Sbjct  484  AHLDYFYWLLACLSSTGLASYLWFAK  509



>ref|XP_010095905.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62499.1| putative peptide/nitrate transporter [Morus notabilis]
Length=590

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM+R+I P F IPPA+LQS  +++I++ +P+YD+  +P+ R FT    G+T+ QR
Sbjct  380  TKQGATMERTIVPGFDIPPASLQSFESLAILVSIPIYDRAIVPIARAFTGKPSGITMLQR  439

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLSVI+MVIAA  + KRL+ ++  +  +    TVPMS+ WL+PQY+L GIS+ FT
Sbjct  440  IGTGMFLSVISMVIAALVEIKRLQTTQEYDLVDTPGVTVPMSVGWLVPQYLLFGISEAFT  499

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G++LY S+FG GSF SS LISI+E  T     +  WFS+++
Sbjct  500  MVGLQEFFYDQVPTELRSVGLSLYLSIFGVGSFLSSFLISIIEEATGGDG-RDSWFSNNL  558

Query  214  KEARLDNYYWFLAVLSAVSLTL  149
              A LD YYW L  LS+V+L L
Sbjct  559  NRAHLDYYYWLLTGLSSVALLL  580



>emb|CDX68281.1| BnaA07g23210D [Brassica napus]
Length=551

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I +SI+  +P+YD+ F+P+ R  T    G+T  QR
Sbjct  337  TKQGSTMDRSISSTLLVPAATLQCFINLSILAFIPIYDRLFVPMARSITHRPAGITTLQR  396

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+ ++VIAA  + KRL+ +R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  397  ISTGIFLSIPSLVIAALVEMKRLKTARDHGLVDSPEATVPMSVCWLIPQYVLYGVSDVFT  456

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R+LG++LY SV G G+F SS +++++E  TS S  Q  WF++++
Sbjct  457  MVGLQEFFYGQVPVELRSLGLSLYLSVVGIGNFLSSFMVAVIEKATSQSG-QVSWFANNL  515

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS+V+   FV F K
Sbjct  516  NQAHLDYFYWLLACLSSVAFVSFVYFAK  543



>ref|XP_009104873.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12-like [Brassica rapa]
Length=552

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I +SI+  +P+YD+ F+P+ R  T    G+T  QR
Sbjct  338  TKQGSTMDRSISSTLLVPAATLQCFINLSILAFIPIYDRLFVPMARSITHRPAGITTLQR  397

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+ ++VIAA  + KRL+ +R+   + S   TVPMS+ WL+PQY+L G+SD+FT
Sbjct  398  ISTGIFLSIPSLVIAALVEMKRLKTARDHGLVDSPEATVPMSVCWLIPQYVLYGVSDVFT  457

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R+LG++LY SV G G+F SS +++++E  TS S  Q  WF++++
Sbjct  458  MVGLQEFFYGQVPVELRSLGLSLYLSVVGIGNFLSSFMVAVIEKATSQSG-QVSWFANNL  516

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS+V+   FV F K
Sbjct  517  NQAHLDYFYWLLACLSSVAFVSFVYFAK  544



>ref|XP_007131295.1| hypothetical protein PHAVU_011G001900g [Phaseolus vulgaris]
 gb|ESW03289.1| hypothetical protein PHAVU_011G001900g [Phaseolus vulgaris]
Length=565

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 148/208 (71%), Gaps = 5/208 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+T+KR+I P   IPPA+LQ+ +TV+I+   P+YD+ F+PL R  T    G+T+ QR
Sbjct  349  TKQGVTLKRTILPGIDIPPASLQTLMTVAIVFFSPIYDRLFVPLARAITGKPSGITMLQR  408

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+ +SV ++V+AA  +TKRL+I++     + +   VPMSI+WL+PQY+L G+S++FT
Sbjct  409  IGTGILISVSSIVVAALVETKRLKIAQESGLVDDAEAIVPMSIWWLVPQYLLFGMSEVFT  468

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG G+F SS LIS++E  T     +  WF++++
Sbjct  469  MVGLQEFFYDQVPNELRSMGLALYLSIFGAGNFISSFLISVIEEVT---GKEDSWFANNL  525

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A L+ +YW LA LS + L  F  F K
Sbjct  526  NKAHLNYFYWLLAALSVMGLAFFTFFSK  553



>ref|XP_007131296.1| hypothetical protein PHAVU_011G002000g [Phaseolus vulgaris]
 gb|ESW03290.1| hypothetical protein PHAVU_011G002000g [Phaseolus vulgaris]
Length=566

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 148/208 (71%), Gaps = 5/208 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+T++R+I P   IPPA+LQ+ ITV+I+L   +YD+ F+PL R  T    G+T+ QR
Sbjct  350  TKQGVTLERTILPGIDIPPASLQTLITVAIVLFSLIYDRLFVPLARAITGKPSGITMLQR  409

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G G+ +SV ++V+AA  +TKRL+I++     + +  TVPMSI+WL+PQY+L G+S++FT
Sbjct  410  IGTGILISVFSIVLAALVETKRLKIAKESGVVDEADATVPMSIWWLVPQYLLFGMSEVFT  469

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF S  LIS++E  T     +  WF++++
Sbjct  470  MVGLQEFFYDQVPNELRSMGLALYLSIFGVGSFISGFLISVIEKVT---GKEDSWFANNL  526

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A L+ +YW LA LS + L  F  F K
Sbjct  527  NKAHLNYFYWLLAALSVMGLAFFTFFGK  554



>ref|XP_006302093.1| hypothetical protein CARUB_v10020083mg [Capsella rubella]
 gb|EOA34991.1| hypothetical protein CARUB_v10020083mg [Capsella rubella]
Length=556

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 143/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI P   +P A LQ  I+++I++ +P+YD+ F+P+ + FT    G+T  QR
Sbjct  342  TKQGSTMDRSITPTLLVPAATLQCFISLAILIFIPIYDRLFVPIAQSFTHKPAGITTLQR  401

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+FLS+I+MV AA  + KRL+ +R+   L +    VPMS+ WL+PQY+L G+SD+FT
Sbjct  402  ISTGIFLSIISMVTAALVEMKRLKTARDHGLLDTPEAIVPMSVCWLIPQYVLFGVSDVFT  461

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+ G G+F SS +IS++E  TS S  Q  WF +++
Sbjct  462  MVGLQEFFYGQVPVELRSMGLALYISIIGIGNFLSSFMISVIEMATSQSG-QASWFDNNL  520

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS++S    V   K
Sbjct  521  NQAHLDYFYWLLACLSSMSFVCIVYLSK  548



>ref|NP_974431.2| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9M1I2.1|PTR46_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.4; Short=AtNPF5.4 [Arabidopsis 
thaliana]
 emb|CAB77565.1| oligopeptide transporter-like protein [Arabidopsis thaliana]
 gb|AEE79233.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=555

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 140/203 (69%), Gaps = 4/203 (2%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG  M R+IG +F IPPAA QS + V+I++L+PLYD+ F+P+VR  T +  G+T  QR+
Sbjct  333  KQGSMMDRTIGNHFTIPPAAFQSIVGVTILILIPLYDRVFVPMVRKITNHHSGITSLQRI  392

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFTV  392
            G+G+F++   MVI    + KRL+++R+   + S  E VPMS  WLLPQYIL+GI D+FT+
Sbjct  393  GVGLFVATFNMVICGLVEAKRLKVARDHGLIDSPKEVVPMSSLWLLPQYILVGIGDVFTI  452

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQE FY ++P  MR++G A++ SV G GSF S+ +IS V+  + S   +  W  +++ 
Sbjct  453  VGMQELFYDQMPETMRSIGAAIFISVVGVGSFVSTGIISTVQTISKSHGEE--WLVNNLN  510

Query  211  EARLDNYYWFLAVLSAVSLTLFV  143
             A LD YYW +A L+AVSL  ++
Sbjct  511  RAHLDYYYWIIASLNAVSLCFYL  533



>ref|XP_003542826.1| PREDICTED: probable peptide/nitrate transporter At3g54450-like 
[Glycine max]
Length=579

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 143/203 (70%), Gaps = 2/203 (1%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG TM+RSIGP+F++PPA+LQ  + V+I+  +P YD+ F+PL R  T    G+TV QR+
Sbjct  344  KQGATMERSIGPHFQVPPASLQGLVGVTILFAVPFYDRVFVPLARKITGKPTGITVLQRI  403

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFTV  392
            G+G+FLS++ MV++A  + KR+ +++    +      +P+SI+WLLPQY++ GISD FT+
Sbjct  404  GVGLFLSILNMVVSALVEDKRVGVAKEFGLIDDPKAVLPISIWWLLPQYMITGISDAFTI  463

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VG+QE FY ++P ++R+LG A Y S+ G GSF  +++I +VE  TS + +   W  +++ 
Sbjct  464  VGLQELFYDQMPESLRSLGAAAYISIVGVGSFVGNIVIIVVEAVTSRAGDGEKWLGNNLN  523

Query  211  EARLDNYYWFLAVLSAVSLTLFV  143
             A LD +YW LA LSAV+L ++V
Sbjct  524  RAHLDYFYWVLAGLSAVNLCVYV  546



>gb|KFK41632.1| hypothetical protein AALP_AA2G152900 [Arabis alpina]
Length=326

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 142/208 (68%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RSI     +P A LQ  I +SI++ +P+YD+ F+P+ R  T    G+T  QR
Sbjct  112  TKQGSTMDRSITSTLLVPAATLQCFINLSILVFIPIYDRLFVPVARSITHKPAGITTLQR  171

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFT  395
            +  G+F+S+ ++ IAA  + KRL+ +R+   + S   TVPMSI WL+PQY+L G+SD+FT
Sbjct  172  ISTGIFISIPSLGIAALVEMKRLKTARDHGLVDSPKATVPMSICWLIPQYVLYGVSDVFT  231

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R+LG++LY SV G G+F SS ++SI+E  TS S  Q  WF++++
Sbjct  232  MVGLQEFFYGQVPLELRSLGLSLYLSVVGIGNFLSSFMVSIIEKATSQSG-QVSWFANNL  290

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
             +A LD +YW LA LS ++   FV F K
Sbjct  291  NQAHLDYFYWLLACLSFIAFVSFVYFAK  318



>dbj|BAJ86454.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=578

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 146/206 (71%), Gaps = 4/206 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQ  T+ R +G   ++PPAALQS I+++I++ MP+YD+  +PL R  T    G+T+ QR
Sbjct  359  TKQAATLDRHVGKRLQVPPAALQSFISITIVIFMPIYDRAIVPLARRCTGVPSGITMLQR  418

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNP--ENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G+GM LS+++MV+AA  +T+RL I+ +    +L    VPMS++W++PQY+L G +D+FT
Sbjct  419  IGVGMVLSLVSMVVAALVETRRLRIATDAGLADLPKVPVPMSLWWMVPQYVLFGAADVFT  478

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS L+S ++ +TS       WFS+++
Sbjct  479  MVGLQEFFYDQVPDKLRSIGLALYISIFGIGSFISSGLVSGIDKWTSERGQS--WFSNNL  536

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIF  137
                LD +YW +A LSA+ L ++V F
Sbjct  537  NRGHLDYFYWLIAALSALELLVYVFF  562



>ref|XP_010427147.1| PREDICTED: protein NRT1/ PTR FAMILY 5.4-like [Camelina sativa]
Length=559

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 141/203 (69%), Gaps = 4/203 (2%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG  M R+IG +F IPPAA QS + V+I++L+PLYD+ F+P+VR  T +  G+T  QR+
Sbjct  335  KQGSMMNRTIGHHFTIPPAAFQSIVGVTILILIPLYDRVFVPMVRKITNHHSGITSLQRI  394

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPENLSS--ETVPMSIFWLLPQYILLGISDIFTV  392
            G+G+F++ I M+I    + KRL ++R+   + S  E VPMS  WLLPQYIL+GI D+FT+
Sbjct  395  GVGLFVATINMMICGLVEAKRLRVARDHGLIDSPKEVVPMSSLWLLPQYILVGIGDVFTI  454

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VGMQE FY ++P  MR++G A++ SV G GSF S+ +IS V+  + S   +  W  +++ 
Sbjct  455  VGMQELFYDQMPETMRSIGAAIFISVVGVGSFVSTGIISTVQTISKSHGEE--WLVNNLN  512

Query  211  EARLDNYYWFLAVLSAVSLTLFV  143
            +A LD +YW +A L+AVSL  ++
Sbjct  513  KAHLDYFYWVIASLNAVSLCFYL  535



>ref|XP_012075471.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Jatropha curcas]
 gb|KDP35100.1| hypothetical protein JCGZ_10942 [Jatropha curcas]
Length=552

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 144/203 (71%), Gaps = 3/203 (1%)
 Frame = -2

Query  745  KQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQRM  566
            KQG TM R+  P F+IP A+LQ+ I  +II+ MPLYD+ F+P  +  T N  G+T+ QR+
Sbjct  340  KQGSTMNRTFFPGFQIPAASLQTFIGFAIIIFMPLYDRIFVPYAKSLTGNPSGITMLQRI  399

Query  565  GIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFTV  392
            G GMF+S ++MVIAA  + KRLE ++     +L + T+PM+I+WL+PQY+L GI+++FT+
Sbjct  400  GTGMFVSGLSMVIAALVEKKRLETAKEYGLVDLPNMTIPMNIWWLVPQYVLCGIANVFTI  459

Query  391  VGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDMK  212
            VG+QEFFY +VP  +R++G++LY SV G GSF SS L+S+++  T     +  WFS+++ 
Sbjct  460  VGLQEFFYDQVPEELRSVGLSLYLSVIGVGSFLSSFLVSVIDKATDRDGKES-WFSNNLN  518

Query  211  EARLDNYYWFLAVLSAVSLTLFV  143
            +A LD YYW LA LS V L  ++
Sbjct  519  KAHLDYYYWLLAALSVVGLIAYL  541



>ref|XP_002266023.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Vitis vinifera]
 emb|CBI39324.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 145/204 (71%), Gaps = 3/204 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG  FK+P A+LQ  I++SI+L +P+YD+  +P  RV T    G+T+ QR
Sbjct  356  TKQGVTMDRSIGSGFKVPAASLQCFISLSILLFVPIYDRILVPTARVLTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM LSVIAMV AA  + +RL+ +      ++   TVPM+++WL+PQY++ G++ +FT
Sbjct  416  IGTGMLLSVIAMVFAALVEVQRLKTAEQYGLVDIPYATVPMAVWWLIPQYVIFGVAQVFT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY EVP  +R++G++LY S+FG GSF SS LIS++   T+    Q  WF+D++
Sbjct  476  MVGLQEFFYDEVPNELRSVGLSLYLSIFGVGSFLSSFLISVINK-TTGGDGQTSWFNDNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
             +A LD +YW LA LS V L+ ++
Sbjct  535  NQAHLDYFYWLLAGLSTVGLSTYL  558



>ref|XP_010665401.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
 emb|CAN63509.1| hypothetical protein VITISV_031690 [Vitis vinifera]
Length=569

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 145/208 (70%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG  F+IP A+L S I ++IIL +P+YD  F+ + R  T    G+T+ QR
Sbjct  354  TKQGITMDRSIGSGFRIPAASLLSFIPITIILFIPIYDCIFVRIARALTGKPSGITMLQR  413

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
             GIG  L V++MV AA  + KRL+ ++     ++ + TVPM ++WL+PQYILLGI+D+F 
Sbjct  414  SGIGFLLCVVSMVTAAIVEMKRLKTAKEYGLVDMPNVTVPMRVWWLIPQYILLGIADVFA  473

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R++G++LY S++G GSF S  LISI+E  T+    +  WF++++
Sbjct  474  MVGLQEFFYDQIPNELRSVGLSLYLSIYGVGSFLSGFLISIIEE-TTGGDGKTSWFNNNL  532

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A +DN+YW LA LSAV L  F+ F K
Sbjct  533  NRAHIDNFYWLLAGLSAVELAAFLYFAK  560



>ref|XP_008339153.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Malus 
domestica]
Length=684

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 147/208 (71%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R+I P F +P A+LQ+ I+++I++ +P+YD+ F+P+ R  T    G+T+ QR
Sbjct  342  TKQGATMDRTIVPGFNVPAASLQTFISIAIVIFLPIYDRIFVPIARYVTGKPAGITMLQR  401

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLS--SETVPMSIFWLLPQYILLGISDIFT  395
            +G GM LS+I MVIAA  + KRL+ +++   L   S TVPMSI+WL PQY+L GI+D FT
Sbjct  402  IGTGMVLSIILMVIAALVEMKRLKXAKDYGLLDTPSATVPMSIWWLAPQYLLAGIADGFT  461

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY +VP  +R++G+ALY S+FG GSF SS LISI++  T S A +  WFS ++
Sbjct  462  MVGLQEFFYDQVPNELRSVGLALYLSIFGVGSFLSSFLISIIDDIT-SLAGESSWFSSNL  520

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW L  +S V L +++ F K
Sbjct  521  NRAHLDYFYWLLGGISLVQLVIYLYFAK  548



>dbj|BAE99752.1| oligopeptide like transporter [Arabidopsis thaliana]
Length=440

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 144/208 (69%), Gaps = 3/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM+R+I P  +IPPA+LQ  I++SI+L +P+YD+  +P+ R  T +  G+T  +R
Sbjct  224  TKQGVTMERTIFPGVEIPPASLQVLISISIVLFVPIYDRVLVPIGRSITKDPCGITTLKR  283

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM L+ + MV+AA  ++KRLE ++     +    T+PMSI+WL PQY+LLG++D+ T
Sbjct  284  IGTGMVLATLTMVVAALVESKRLETAKEYGLIDQPKTTLPMSIWWLFPQYMLLGLADVHT  343

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQEFFYS+VP  +R+LG+A+Y S  G GS  SSLLI +++  T   A  + WF+ ++
Sbjct  344  LVGMQEFFYSQVPTELRSLGLAIYLSAMGVGSLLSSLLIYLIDLATGGDAG-NSWFNSNL  402

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LAV+SAV    F+   K
Sbjct  403  NRAHLDYFYWLLAVVSAVGFFTFLFISK  430



>ref|XP_002265992.2| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=572

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 145/204 (71%), Gaps = 3/204 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RS G  FK+P A+LQ  I+ SI+L +P+YD+  +P+ RV T    G+T+ QR
Sbjct  356  TKQGVTMDRSFGSGFKVPAASLQCFISFSILLFVPIYDRILVPIARVLTRKPSGITMLQR  415

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMFLS+IAMV AA  + +RL+ +      ++ + T+PM+++WL+PQY++ G++ +FT
Sbjct  416  IGTGMFLSIIAMVFAALVEVQRLKTAEQYGLVDMPNATIPMAVWWLIPQYVIFGVAQVFT  475

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY EVP  +R++G++LY S+FG GSF SS LIS++   T+    Q  WF+D++
Sbjct  476  MVGLQEFFYDEVPNELRSVGLSLYLSIFGVGSFLSSFLISVINK-TTGGDGQTSWFNDNL  534

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
             +A LD +YW LA LS V  + ++
Sbjct  535  NQAHLDYFYWLLAGLSTVGFSTYL  558



>gb|ABR17733.1| unknown [Picea sitchensis]
Length=573

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 149/204 (73%), Gaps = 8/204 (4%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM R IG  F+IPPA+LQS I ++IILL+P+YD+ F+P+ R  T N++G+T  QR
Sbjct  346  TKQGATMDRKIG-KFEIPPASLQSFINLTIILLLPVYDRIFVPIARNLTGNERGITFLQR  404

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GMF+S+++M++AA  + +R++ +++    ++   T+P+SI  LLPQYIL G++D+FT
Sbjct  405  IGTGMFISILSMIVAALAEIRRIKAAKDNGLIDMPKATIPLSISLLLPQYILFGLADVFT  464

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VGMQE+FY ++P  M+TLGIA+Y SV G GSF SS++I ++E    S      WF +++
Sbjct  465  MVGMQEYFYDQMPDTMKTLGIAVYLSVLGVGSFLSSIIILVIEKLGGSH-----WFVNNL  519

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
             +A LD +YW LA LSA++  +++
Sbjct  520  NKAHLDYFYWLLASLSAINFCIYM  543



>gb|KHG04630.1| hypothetical protein F383_29596 [Gossypium arboreum]
Length=598

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 146/209 (70%), Gaps = 3/209 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS    F+IP A+LQS I++SI+L +P+YD+ F+PL R  T    G+T+ QR
Sbjct  381  TKQGATMDRSTATGFEIPAASLQSFISLSIVLFIPIYDRIFVPLTRALTGEPAGITLLQR  440

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPENLSSE--TVPMSIFWLLPQYILLGISDIFT  395
            +G GM +S I++VIAA  + +RL+I+     +      VPMSI+WL+PQY L G++D+FT
Sbjct  441  IGSGMVISTISLVIAAVVEMRRLKIAEEHGLIDKPIVVVPMSIWWLVPQYALYGLADVFT  500

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            +VG+QEFFY ++P  +R++G+ALY S+FG GSF SS LIS +E+ TS    +  WF++++
Sbjct  501  MVGLQEFFYDQMPNELRSVGLALYLSIFGVGSFLSSFLISAIENLTSRD-GRDSWFANNL  559

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCKF  128
              A LD +Y  LA LSAV LTL+V   K+
Sbjct  560  NRAHLDYFYLLLAALSAVGLTLYVCCTKY  588



>gb|KHF99635.1| hypothetical protein F383_18770 [Gossypium arboreum]
Length=578

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 143/204 (70%), Gaps = 4/204 (2%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG TM RS+GPNF++PPAALQS + ++I++ +P+YD  F+P+ R  T N  G+T+ QR
Sbjct  344  TKQGSTMSRSLGPNFQVPPAALQSLVGLTILIAVPVYDCVFVPIARKLTKNPTGITMLQR  403

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISRNPE--NLSSETVPMSIFWLLPQYILLGISDIFT  395
            +GIG+F+S++ MV+A   +T R+  +R     +     +PMSI+WLLPQY+L GI D+FT
Sbjct  404  IGIGLFVSILNMVVAGIVETARVNTARKHGLIDTPKAVIPMSIWWLLPQYVLTGIGDVFT  463

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            ++G+QE FY ++P  MR++G A Y S+ G GSF ++ +IS+V+  +S    +  W  D++
Sbjct  464  IIGLQELFYDQMPEEMRSIGAAAYISIVGIGSFVNTGIISVVQMISSKHGKE--WLGDNL  521

Query  214  KEARLDNYYWFLAVLSAVSLTLFV  143
              + L+ +YW LA LSA++L +++
Sbjct  522  NRSNLNYFYWVLAGLSAINLCVYM  545



>gb|EYU28220.1| hypothetical protein MIMGU_mgv1a020668mg, partial [Erythranthe 
guttata]
Length=549

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 140/208 (67%), Gaps = 2/208 (1%)
 Frame = -2

Query  748  TKQGMTMKRSIGPNFKIPPAALQSAITVSIILLMPLYDKYFIPLVRVFTLNDKGVTVRQR  569
            TKQG+TM RSIG +F +P A+LQ  I ++II+ +P+YD+ F+PL R+ T N  GVT  QR
Sbjct  332  TKQGITMDRSIGSSFDVPAASLQYIIGLTIIIFIPIYDRVFVPLGRIATGNPSGVTQLQR  391

Query  568  MGIGMFLSVIAMVIAAFTDTKRLEISR--NPENLSSETVPMSIFWLLPQYILLGISDIFT  395
            +G GM L  ++MVIAA  + KRL+ +       L    VPMS +WL+PQYI+ GISD+FT
Sbjct  392  IGTGMLLCTVSMVIAALVERKRLKTASQYGLAELGGAEVPMSFWWLIPQYIIFGISDVFT  451

Query  394  VVGMQEFFYSEVPANMRTLGIALYTsvfgfgsffssllisiVEHFTSSSANQHGWFSDDM  215
            ++G+QE FY EVP  ++T+ +++Y S+ G G+F SS LI I++  TS    Q GWFSD+ 
Sbjct  452  IIGLQELFYEEVPCGLKTVALSIYLSILGIGNFLSSFLIFIIQRVTSDQGGQGGWFSDNT  511

Query  214  KEARLDNYYWFLAVLSAVSLTLFVIFCK  131
              A LD +YW LA ++A  L  F+ F +
Sbjct  512  NGAHLDYFYWLLAGVNAAGLLAFLCFAR  539



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427800438025