BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12358

Length=909
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009759318.1|  PREDICTED: tip elongation aberrant protein 3...    335   1e-106   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...    335   2e-105   Nicotiana tomentosiformis
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...    327   1e-102   Solanum tuberosum [potatoes]
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...    323   3e-101   Solanum lycopersicum
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...    315   6e-98    Sesamum indicum [beniseed]
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...    295   3e-90    Prunus mume [ume]
gb|KDO75101.1|  hypothetical protein CISIN_1g0050432mg                  284   9e-90    Citrus sinensis [apfelsine]
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...    293   1e-89    Pyrus x bretschneideri [bai li]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...    293   1e-89    Pyrus x bretschneideri [bai li]
ref|XP_007222490.1|  hypothetical protein PRUPE_ppa004126mg             288   1e-89    
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...    291   1e-88    
emb|CDO98898.1|  unnamed protein product                                288   9e-88    Coffea canephora [robusta coffee]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...    288   1e-87    Vitis vinifera
emb|CAN77820.1|  hypothetical protein VITISV_043441                     288   2e-85    Vitis vinifera
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg             279   4e-84    Citrus clementina [clementine]
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...    279   5e-84    Citrus sinensis [apfelsine]
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...    275   8e-83    Nelumbo nucifera [Indian lotus]
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...    274   2e-82    Fragaria vesca subsp. vesca
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...    271   3e-81    
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...    270   6e-81    Solanum lycopersicum
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...    269   9e-81    Solanum tuberosum [potatoes]
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...    269   3e-80    Nelumbo nucifera [Indian lotus]
gb|KJB38636.1|  hypothetical protein B456_006G264600                    265   1e-79    Gossypium raimondii
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein      267   1e-79    Gossypium arboreum [tree cotton]
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...    267   2e-79    Elaeis guineensis
gb|KJB38635.1|  hypothetical protein B456_006G264600                    266   3e-79    Gossypium raimondii
ref|XP_011012826.1|  PREDICTED: acyl-CoA-binding domain-containin...    263   4e-79    Populus euphratica
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...    265   7e-79    Nelumbo nucifera [Indian lotus]
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...    264   2e-78    Populus euphratica
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...    264   2e-78    Populus euphratica
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...    264   2e-78    Nelumbo nucifera [Indian lotus]
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...    263   3e-78    
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...    264   3e-78    Populus euphratica
gb|KJB72601.1|  hypothetical protein B456_011G187500                    262   3e-78    Gossypium raimondii
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...    263   4e-78    Elaeis guineensis
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg                263   5e-78    Erythranthe guttata [common monkey flower]
gb|KJB72599.1|  hypothetical protein B456_011G187500                    262   6e-78    Gossypium raimondii
gb|KJB72596.1|  hypothetical protein B456_011G187500                    262   6e-78    Gossypium raimondii
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4            261   1e-77    Gossypium arboreum [tree cotton]
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...    261   2e-77    Cucumis melo [Oriental melon]
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4            261   2e-77    Gossypium arboreum [tree cotton]
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...    259   1e-76    
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    258   1e-76    
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g             258   2e-76    
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...    258   2e-76    Cucumis sativus [cucumbers]
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...    258   3e-76    Phoenix dactylifera
ref|XP_002516884.1|  acyl-CoA binding protein, putative                 254   6e-75    Ricinus communis
ref|XP_012069388.1|  PREDICTED: acyl-CoA-binding domain-containin...    253   2e-74    Jatropha curcas
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...    249   4e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...    249   9e-73    
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...    247   3e-72    
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...    247   4e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...    244   3e-71    Beta vulgaris subsp. vulgaris [field beet]
gb|EPS74438.1|  hypothetical protein M569_00314                         238   7e-71    Genlisea aurea
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...    243   1e-70    Camelina sativa [gold-of-pleasure]
dbj|BAH19562.1|  AT5G18590                                              243   2e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                             242   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                       242   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873905.1|  kelch repeat-containing protein                    240   1e-69    
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg             240   2e-69    Eutrema salsugineum [saltwater cress]
gb|KEH32273.1|  acyl-CoA-binding domain protein                         239   4e-69    Medicago truncatula
gb|AES91803.2|  acyl-CoA-binding domain protein                         239   4e-69    Medicago truncatula
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein         239   7e-69    
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...    238   8e-69    Glycine max [soybeans]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4            238   2e-68    Glycine soja [wild soybean]
gb|KJB72598.1|  hypothetical protein B456_011G187500                    236   2e-68    Gossypium raimondii
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...    236   4e-68    Elaeis guineensis
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g             235   8e-68    Phaseolus vulgaris [French bean]
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...    234   2e-67    Elaeis guineensis
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g             234   3e-67    Phaseolus vulgaris [French bean]
ref|XP_010931596.1|  PREDICTED: tip elongation aberrant protein 3...    232   4e-67    
ref|XP_004486044.1|  PREDICTED: acyl-CoA-binding domain-containin...    231   9e-67    Cicer arietinum [garbanzo]
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...    233   9e-67    Brassica rapa
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...    233   1e-66    
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...    232   1e-66    
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g             231   2e-66    
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...    231   3e-66    
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...    231   4e-66    Elaeis guineensis
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...    231   5e-66    Cicer arietinum [garbanzo]
emb|CDX92598.1|  BnaA10g16370D                                          228   6e-65    
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4            226   2e-64    Glycine soja [wild soybean]
emb|CDY13903.1|  BnaC09g39230D                                          223   2e-63    Brassica napus [oilseed rape]
ref|XP_004486293.1|  PREDICTED: uncharacterized protein LOC101494304    210   2e-63    
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...    218   3e-61    Glycine max [soybeans]
gb|AES91804.2|  acyl-CoA-binding domain protein                         217   6e-61    Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein         217   7e-61    
gb|KJB72597.1|  hypothetical protein B456_011G187500                    213   3e-60    Gossypium raimondii
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...    211   1e-58    Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...    210   1e-58    Populus euphratica
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...    210   1e-58    Glycine max [soybeans]
gb|AES64218.2|  acyl-CoA-binding domain protein                         208   6e-58    Medicago truncatula
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...    208   1e-57    
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   2e-57    Cicer arietinum [garbanzo]
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   3e-57    Cicer arietinum [garbanzo]
gb|KHN47303.1|  hypothetical protein glysoja_020171                     196   4e-57    Glycine soja [wild soybean]
ref|XP_010098333.1|  hypothetical protein L484_023581                   206   5e-57    
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...    207   5e-57    
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...    206   6e-57    
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...    206   7e-57    
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein         203   7e-56    
gb|KDO75103.1|  hypothetical protein CISIN_1g0050432mg                  192   2e-54    Citrus sinensis [apfelsine]
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...    197   5e-54    
gb|ERN16928.1|  hypothetical protein AMTR_s00057p00182130               197   5e-54    Amborella trichopoda
ref|XP_006855461.2|  PREDICTED: acyl-CoA-binding domain-containin...    197   9e-54    Amborella trichopoda
ref|XP_011627422.1|  PREDICTED: acyl-CoA-binding domain-containin...    195   5e-53    Amborella trichopoda
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...    181   3e-48    
ref|NP_001068393.1|  Os11g0657000                                       176   5e-47    
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...    178   5e-47    
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...    178   5e-47    Brachypodium distachyon [annual false brome]
gb|EEC68565.1|  hypothetical protein OsI_36893                          177   7e-47    Oryza sativa Indica Group [Indian rice]
gb|EEE52499.1|  hypothetical protein OsJ_34700                          176   2e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...    173   3e-45    
ref|XP_006663087.1|  PREDICTED: acyl-CoA-binding domain-containin...    164   3e-42    Oryza brachyantha
ref|XP_006663088.1|  PREDICTED: acyl-CoA-binding domain-containin...    164   3e-42    
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...    163   5e-42    Setaria italica
ref|XP_008677101.1|  PREDICTED: uncharacterized protein LOC100279...    162   1e-41    Zea mays [maize]
dbj|BAK00043.1|  predicted protein                                      151   8e-40    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575710.1|  PREDICTED: acyl-CoA-binding domain-containin...    156   2e-39    Brachypodium distachyon [annual false brome]
ref|XP_006664610.1|  PREDICTED: acyl-CoA-binding domain-containin...    150   2e-37    Oryza brachyantha
dbj|BAK00700.1|  predicted protein                                      150   3e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86800.1|  predicted protein                                      150   4e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW60227.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    150   5e-37    
ref|NP_001145999.1|  uncharacterized protein LOC100279529               149   7e-37    
ref|XP_002442260.1|  hypothetical protein SORBIDRAFT_08g017180          147   3e-36    
ref|NP_001066944.1|  Os12g0538800                                       146   7e-36    
gb|EEC69433.1|  hypothetical protein OsI_38606                          146   7e-36    Oryza sativa Indica Group [Indian rice]
gb|EMT26901.1|  hypothetical protein F775_29769                         144   2e-35    
ref|XP_004962837.1|  PREDICTED: acyl-CoA-binding domain-containin...    145   3e-35    
ref|NP_001146281.1|  uncharacterized protein LOC100279856               144   3e-35    Zea mays [maize]
ref|XP_004962833.1|  PREDICTED: acyl-CoA-binding domain-containin...    144   4e-35    Setaria italica
gb|EMS52652.1|  Acyl-CoA-binding domain-containing protein 4            136   7e-32    Triticum urartu
gb|AFW60226.1|  hypothetical protein ZEAMMB73_572222                    133   3e-31    
ref|XP_002977452.1|  hypothetical protein SELMODRAFT_417505             125   1e-28    Selaginella moellendorffii
ref|XP_002975032.1|  hypothetical protein SELMODRAFT_415315             125   1e-28    Selaginella moellendorffii
gb|EMT25879.1|  hypothetical protein F775_10881                         115   5e-25    
gb|EMS62709.1|  Acyl-CoA-binding domain-containing protein 4            114   2e-24    Triticum urartu
ref|XP_001759823.1|  predicted protein                                  114   2e-24    
ref|XP_001760924.1|  predicted protein                                  108   1e-22    
gb|ABA95166.1|  Kelch motif family protein, expressed                 97.4    5e-19    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751751.1|  predicted protein                                98.2    5e-19    
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        87.4    1e-15    
ref|XP_001761501.1|  predicted protein                                84.0    1e-15    
emb|CDY02611.1|  BnaC02g08240D                                        73.2    4e-13    
gb|ABR25493.1|  rangap1 interacting protein                           69.3    6e-12    Oryza sativa Indica Group [Indian rice]
ref|XP_001765510.1|  predicted protein                                67.0    4e-09    
gb|EEE53353.1|  hypothetical protein OsJ_36377                        66.2    8e-09    Oryza sativa Japonica Group [Japonica rice]
gb|KDO75105.1|  hypothetical protein CISIN_1g0050432mg                61.6    4e-08    Citrus sinensis [apfelsine]
gb|KDO75104.1|  hypothetical protein CISIN_1g0050432mg                60.5    1e-07    Citrus sinensis [apfelsine]
ref|XP_010241732.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    1e-05    Nelumbo nucifera [Indian lotus]



>ref|XP_009759318.1| PREDICTED: tip elongation aberrant protein 3-like [Nicotiana 
sylvestris]
Length=634

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 198/269 (74%), Positives = 230/269 (86%), Gaps = 4/269 (1%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DP+SV+GNVSLRKQF N+E+   K+PK+S DES SQ  E+G +QLD G
Sbjct  368  SGRKSLSESLLVDPSSVSGNVSLRKQFSNDEDAGAKIPKTSGDESPSQ--EQGAKQLDVG  425

Query  729  LEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
            ++   S  K + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K G++A  G  
Sbjct  426  IKTSSSGGKIVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYKAGLTASSGAC  485

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q YEAKL+AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++LLK
Sbjct  486  QQYEAKLSALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDMEKRMGDTVKEVELLK  545

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERARAF
Sbjct  546  EKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERARAF  605

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  606  QLQVEVFHLKQRLQSLENRSPTPRKPFHV  634



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 198/269 (74%), Positives = 229/269 (85%), Gaps = 4/269 (1%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DP+SV+GNVSLRKQF N+E+   K PK+S DES SQ  E+G +QLD G
Sbjct  441  SGRKSLSESLLVDPSSVSGNVSLRKQFSNDEDAGAKRPKTSGDESPSQ--EQGAKQLDIG  498

Query  729  LEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
            ++   S  K + EE+ TI ESG++  H +Q SGNF  D+DDFVFQESD K G++A  G  
Sbjct  499  IKTSSSGGKIVTEEMSTITESGHLPNHYRQASGNFFQDTDDFVFQESDYKAGLTASSGAC  558

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q YEAKL+AL+RKN +LEGQLAAALA+REAA+K+LSSALKSKQD EK++ D +KE++LLK
Sbjct  559  QQYEAKLSALMRKNEILEGQLAAALANREAAEKNLSSALKSKQDVEKRMGDTVKEVELLK  618

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELH+TRG+L GERARAF
Sbjct  619  EKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHTTRGVLAGERARAF  678

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  679  QLQVEVFHLKQRLQSLENRSPTPRKPFHV  707



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/270 (67%), Positives = 208/270 (77%), Gaps = 12/270 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DP+SV+GNVSLRKQF N+E+ S KM K+S DES SQ  E+G +QLD G
Sbjct  441  SGRKSLSESLLIDPSSVSGNVSLRKQFSNDEDASAKMTKTSGDESPSQ--EQGAKQLDIG  498

Query  729  LEHIDS---KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGL  559
                 S   K + EE+ TI ESG++ TH +Q S NF  D+DDFVFQE D K G+ A  G 
Sbjct  499  GPKTSSNGGKIMSEEMSTISESGHLPTHYRQASANFFQDTDDFVFQEGDYKAGLPASSGA  558

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
             Q YEAKL++L+RKN                A     +A+KSKQD EKK+ADA+KE++LL
Sbjct  559  CQQYEAKLSSLMRKN-------GILEGQLATALAGREAAVKSKQDMEKKMADAVKEMELL  611

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            KEKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERARA
Sbjct  612  KEKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERARA  671

Query  198  FQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            FQLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  672  FQLQVEVFHLKQRLQSLENRSPTPRKPFHV  701



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score =   323 bits (829),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 179/269 (67%), Positives = 211/269 (78%), Gaps = 11/269 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DP+SV+GNVSLRKQF N+E+TS KM K+S DES SQ  E+G +QLD G
Sbjct  441  SGRKSLSESLLIDPSSVSGNVSLRKQFSNDEDTSAKMTKTSGDESPSQ--EQGAKQLDIG  498

Query  729  LEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
            L+   +  K + EE+ TI ESG++ TH +Q S NF  D+DDFV QE D K G+ A  G  
Sbjct  499  LKTCSNGGKIMSEEMSTISESGHLPTHYRQASANFFQDTDDFVSQEGDYKAGLPASSGAC  558

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q +EAKL++L+RKN               AA     +A++SKQD EKK++DA+KE++LLK
Sbjct  559  QQHEAKLSSLMRKN-------GILEGQLAAALAGREAAVRSKQDMEKKMSDAVKEMELLK  611

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG+L GERARAF
Sbjct  612  EKLASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRGVLAGERARAF  671

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  672  QLQVEVFHLKQRLQSLENRSPTPRKPFHV  700



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score =   315 bits (808),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 193/269 (72%), Positives = 222/269 (83%), Gaps = 3/269 (1%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDESSSQVMERGTRQLDS  733
            SGRKSLSESLL DP+S  GNVSLRKQFYNEEE +     KSS+D + S++ME+ T+ LDS
Sbjct  445  SGRKSLSESLLVDPHSAPGNVSLRKQFYNEEENADATTTKSSEDTNLSRMMEQNTKPLDS  504

Query  732  GLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
            G+        I EE   + ES N+    K GSG+  L+S+D VFQE+D K  ISAP G+Y
Sbjct  505  GIGVSYSGDRITEETSLVSESDNL-NLDKHGSGSLSLESEDLVFQETDGKSRISAPSGVY  563

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q YEAKL +LLRKNG+LEGQLAAALA+REAA+K+LS A+KS+QD E+KL +AM+EI+LLK
Sbjct  564  QIYEAKLASLLRKNGILEGQLAAALAAREAAEKNLSLAIKSRQDMERKLGEAMREIELLK  623

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAF
Sbjct  624  EKLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAF  683

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVFHLKQRLQ+LE RAPTPRKPFHV
Sbjct  684  QLQVEVFHLKQRLQTLETRAPTPRKPFHV  712



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 185/271 (68%), Positives = 224/271 (83%), Gaps = 7/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSESLL DPN V+GNVSLRKQF+N+EE  T++K+ KSS+DESS SQ  E+   Q 
Sbjct  445  SGRKSLSESLLVDPNPVSGNVSLRKQFHNDEEYNTTVKVVKSSEDESSFSQPTEKKNSQS  504

Query  738  DSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAP  568
            DSG++   + S+   EE+ +  E  N + H   G GN  +D++D +F E+D K G +SAP
Sbjct  505  DSGVQTNVLGSRLYSEEMLSGYEYEN-SNHHNHGIGNLSVDNNDAMFLETDSKPGALSAP  563

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +Y  YE+K+ +L+RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E+KLAD  KE+
Sbjct  564  SSIYHYYESKMASLIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEMERKLADTAKEM  623

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  624  ELLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  683

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  684  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  714



>gb|KDO75101.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
 gb|KDO75102.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=365

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 179/273 (66%), Positives = 213/273 (78%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSE  L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q 
Sbjct  96   SGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQS  155

Query  738  DSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
            D G +    +    I E      E+ N      QG GNF +D+D+ +F ++D    +S P
Sbjct  156  DLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGP  212

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE+K+ AL+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE+
Sbjct  213  SSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEM  272

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  273  ELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  332

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  333  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  365



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 221/271 (82%), Gaps = 7/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSESLL DPN V+GNVSLRKQF+NEEE  T++K+ KS++DESS SQ +E+ T Q 
Sbjct  442  SGRKSLSESLLVDPNPVSGNVSLRKQFHNEEEFNTTVKVAKSTEDESSFSQPIEKKTSQS  501

Query  738  DSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAP  568
            DSG++      +   EEI +  +  N   H   G+GN  +D++D VF E+D K G +S  
Sbjct  502  DSGVQTNIYGGRLFSEEILSGYDFENSNPHH-HGTGNLSMDNNDAVFPENDSKLGALSTA  560

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +Y  YE+K+ AL+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E+KL+D+ KE+
Sbjct  561  SSMYHYYESKMAALIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEMERKLSDSAKEM  620

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            + LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  621  EFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  680

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  681  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 178/271 (66%), Positives = 221/271 (82%), Gaps = 7/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSESLL DPN V+GNVSLRKQF+NEEE  T++K+ KS++DESS SQ +E+ T Q 
Sbjct  442  SGRKSLSESLLVDPNPVSGNVSLRKQFHNEEEFNTTVKVAKSTEDESSFSQPIEKKTSQS  501

Query  738  DSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAP  568
            DSG++      +   EEI +  +  N   H   G+GN  +D++D VF E+D K G +S  
Sbjct  502  DSGVQTNIYGGRLFSEEILSGYDFENSNPHH-HGTGNLSMDNNDAVFPENDSKLGALSTA  560

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +Y  YE+K+ AL+RKNG+LEG+LA  +A++EAA+K+LSSALKS+Q+ E+KL+D+ KE+
Sbjct  561  SSMYHYYESKMAALIRKNGILEGKLATVMANQEAAEKNLSSALKSRQEMERKLSDSAKEM  620

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            + LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  621  EFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  680

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  681  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  711



>ref|XP_007222490.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
 gb|EMJ23689.1| hypothetical protein PRUPE_ppa004126mg [Prunus persica]
Length=528

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 182/271 (67%), Positives = 221/271 (82%), Gaps = 7/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSESLL DPN V+GNVSLRKQF+N+EE  T++K+ KSS+DESS SQ  E+   + 
Sbjct  259  SGRKSLSESLLVDPNPVSGNVSLRKQFHNDEEYNTTVKVVKSSEDESSFSQPTEKKNSRS  318

Query  738  DSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAP  568
            DSG++   + ++   EE+ +  E  N + H   G GN  +D++D +F E+D K G +SAP
Sbjct  319  DSGVQTNVLGNRLYSEEMLSGYEYEN-SNHHNHGIGNLSVDNNDAMFLETDSKPGALSAP  377

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +Y  YE+K+   +RKNG+LEGQLAAAL SREAA+K+LSSALKS+Q+ E+KLAD  KE+
Sbjct  378  SSIYHYYESKMATQIRKNGILEGQLAAALTSREAAEKNLSSALKSRQEMERKLADTAKEM  437

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEK AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  438  ELLKEKAAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  497

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  498  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  528



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 218/271 (80%), Gaps = 7/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSESLL DPN V+GNVSLRKQF+NEEE  T++K+ KSS+DESS SQ +E+ T Q 
Sbjct  446  SGRKSLSESLLVDPNPVSGNVSLRKQFHNEEEFNTTVKVAKSSEDESSFSQPIEKKTSQS  505

Query  738  DSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAP  568
            DSG++      +   EEI +  +  N   H   G+GN   D++D VF E+D K G +S  
Sbjct  506  DSGVQTNIYGGRLFSEEILSGYDFENSNPHX-HGTGNLSXDNNDAVFPENDSKLGALSTA  564

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +Y  YE+K+  L+RKNG+LEG+LA  +AS+EAA+K+LSSALKS+Q+ E+KL+D  KE+
Sbjct  565  SSMYHYYESKMAXLIRKNGILEGKLATVMASQEAAEKNLSSALKSRQEMERKLSDTAKEM  624

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            + LKEK+AGVE+AQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  625  EFLKEKVAGVEIAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  684

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  685  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  715



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   288 bits (738),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 187/271 (69%), Positives = 227/271 (84%), Gaps = 9/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDD-ESSSQVMERGTRQLDS  733
            SGR+SLSESLL DPNS  GNVSLRKQF+++E+ +  +P  S   E   ++ + G+ Q  +
Sbjct  445  SGRRSLSESLLIDPNSSAGNVSLRKQFHDKEDPTNNVPNFSKGVEQKPRIHDTGS-QAYT  503

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQ  553
             +++ ++K    EI +  ESGN+ TH++QGSG+  LDSDD +FQESD K G+S P  ++Q
Sbjct  504  NVDNYNAK----EISSASESGNLETHRRQGSGSLSLDSDDLLFQESDGKAGVSVPSNVHQ  559

Query  552  ---SYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
               SYE KL AL+RKNG+LEGQLAAA++SRE+A+K+LS+A+KS+Q+ EKKLADAMKE++L
Sbjct  560  FHQSYELKLGALIRKNGILEGQLAAAISSRESAEKNLSTAVKSRQEMEKKLADAMKEMEL  619

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  620  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  679

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV
Sbjct  680  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  710



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 182/273 (67%), Positives = 215/273 (79%), Gaps = 7/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDES-SSQVMERGTRQL  739
            SGRKSLSES L DPN   GNVSLRKQF+NEEE  T++K  +S +DE  SSQ  E   +  
Sbjct  446  SGRKSLSESSLVDPNPAPGNVSLRKQFHNEEEYNTAVKTLRSLEDECYSSQASEHRMKLF  505

Query  738  DSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAP  568
            D+G+       K   +EI ++ +S N   +  QG+GN  +D+DD VF ES  K    SAP
Sbjct  506  DTGIHGSLAGCKINVDEIPSVLDSENSNAYN-QGNGNLLVDNDDEVFPESHGKSVAFSAP  564

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE K+ AL+RKNG+LEGQL AALASREA +K+LSS LK++Q+ EKKLAD +KE+
Sbjct  565  SSIYQLYETKMAALIRKNGILEGQLTAALASREAVEKNLSSVLKNRQEMEKKLADTLKEM  624

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            ++LKEKLAGVELAQEEAN+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  625  EMLKEKLAGVELAQEEANNLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  684

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  685  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  717



>emb|CAN77820.1| hypothetical protein VITISV_043441 [Vitis vinifera]
Length=1034

 Score =   288 bits (737),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 182/273 (67%), Positives = 214/273 (78%), Gaps = 7/273 (3%)
 Frame = -1

Query  909   SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDES-SSQVMERGTRQL  739
             SGRKSLSES L DPN   GNVSLRKQF+NEEE  T++K  +S +DE  SSQ  E   +  
Sbjct  763   SGRKSLSESSLVDPNPAPGNVSLRKQFHNEEEYNTAVKTLRSLEDECYSSQASEHRMKLF  822

Query  738   DSGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAP  568
             D+G+       K   + I ++ +S N   +  QG+GN  +D+DD VF ES  K    SAP
Sbjct  823   DTGIHGSLAGCKINVDXIPSVLDSENSNAYN-QGNGNLLVDNDDEVFPESHGKSVAFSAP  881

Query  567   IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
               +YQ YE K+ AL+RKNG+LEGQL AALASREA +K+LSS LK++Q+ EKKLAD +KE+
Sbjct  882   SSIYQLYETKMAALIRKNGILEGQLTAALASREAVEKNLSSVLKNRQEMEKKLADTLKEM  941

Query  387   DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
             ++LKEKLAGVELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  942   EMLKEKLAGVELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  1001

Query  207   ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
             ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  1002  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  1034



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 178/273 (65%), Positives = 211/273 (77%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSE  L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q 
Sbjct  448  SGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQS  507

Query  738  DSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
            D G +    +    I E      E+ N      QG GNF +D+D+ +F ++D    +S P
Sbjct  508  DLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGP  564

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE K+  L+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE+
Sbjct  565  SSIYQFYETKMADLIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEM  624

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  625  ELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  684

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  685  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score =   279 bits (713),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 178/273 (65%), Positives = 211/273 (77%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSE  L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q 
Sbjct  448  SGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQS  507

Query  738  DSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
            D G +    +    I E      E+ N      QG GNF +D+D+ +F ++D    +S P
Sbjct  508  DLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGP  564

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE K+  L+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE+
Sbjct  565  SSIYQFYETKMADLIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEM  624

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  625  ELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  684

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  685  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  717



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score =   275 bits (704),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 177/273 (65%), Positives = 215/273 (79%), Gaps = 15/273 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS----QVMERGT  748
            SGRKS+S+ LL D N  +GNVSLRKQF+NEEE  TSLK+ K+ +DE+SS    +V++ G 
Sbjct  444  SGRKSISDCLL-DTNPTSGNVSLRKQFHNEEECNTSLKILKNIEDENSSSQRTKVLDMGV  502

Query  747  RQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
            +   +GL      +  EE   + +S N    +KQ + N   +SD+    E+D   G SAP
Sbjct  503  QTDIAGL-----MSSAEETPFVFDSENTRPLQKQANVNLLSESDEIAIPETD---GKSAP  554

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ Y++K+ AL+RKNG+LE QLAA+LA REAA+K+LSS +KS+QD EKKLAD MKE+
Sbjct  555  SNVYQLYDSKIAALVRKNGILEAQLAASLAGREAAEKNLSSVIKSRQDIEKKLADTMKEM  614

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            ++LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  615  EMLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  674

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  675  ARAFQLQVEVFHLKQRLQSVENRAPTPRKPFHM  707



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 185/272 (68%), Positives = 219/272 (81%), Gaps = 14/272 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQL  739
            SGRKSLSESLL D N V GNVSLRKQF+N+EE  T++K+ K S+DESS  Q  E+   Q 
Sbjct  445  SGRKSLSESLLVDANPVPGNVSLRKQFHNDEEYNTAVKVTKGSEDESSLLQPSEKKNSQS  504

Query  738  DSGLE---HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISA  571
            +S ++   H   +   E+I +  E  N  ++   G GNFP+D++D +F ESD K G +SA
Sbjct  505  ESAVQTNIH-GGRLYSEDILSAYEFEN--SNHNHGLGNFPVDNNDALFPESDGKPGALSA  561

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
            P  +YQ YE     L+RKNG+LEGQLAAALASREAA+K+LSSALKS+Q+ EKKLAD+ KE
Sbjct  562  PSSMYQYYEK----LIRKNGVLEGQLAAALASREAAEKNLSSALKSRQEIEKKLADSGKE  617

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            I+LLK+KLAGVELAQEEAN+LS+IVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  618  IELLKDKLAGVELAQEEANNLSSIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  677

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  678  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  709



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 172/273 (63%), Positives = 211/273 (77%), Gaps = 8/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGR+SLSE    D N ++GN SLRKQF+NEEE  T+ K+ K  +DESS  Q  E    Q 
Sbjct  446  SGRRSLSELSFVDQNPLSGNFSLRKQFHNEEEYNTTFKITKCLEDESSIVQATEPKPNQS  505

Query  738  DSGLE--HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAP  568
            D+ ++     +K   +E       G++   + +G  N P+D+D+FVF E+D K   +SAP
Sbjct  506  DTSIQINAPGTKISSDESFLFEPEGSIP--QIEGIANVPVDNDNFVFPEADGKSAALSAP  563

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE ++ AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE+
Sbjct  564  SSIYQFYETRMAALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKEM  623

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  624  ELLKEKLAGIELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  683

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQSLENRAPTPRKPF+V
Sbjct  684  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV  716



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score =   270 bits (689),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 160/267 (60%), Positives = 185/267 (69%), Gaps = 46/267 (17%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DP+SV+GNVSLRKQF N+E+TS KM K+S DES SQ  E+G +QLD G
Sbjct  441  SGRKSLSESLLIDPSSVSGNVSLRKQFSNDEDTSAKMTKTSGDESPSQ--EQGAKQLDIG  498

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  550
            L+            T    G                         D K G+ A  G  Q 
Sbjct  499  LK------------TCSNGG-------------------------DYKAGLPASSGACQQ  521

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            +EAKL++L+RKN               AA     +A++SKQD EKK++DA+KE++LLKEK
Sbjct  522  HEAKLSSLMRKN-------GILEGQLAAALAGREAAVRSKQDMEKKMSDAVKEMELLKEK  574

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            LA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELHSTRG+L GERARAFQL
Sbjct  575  LASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHSTRGVLAGERARAFQL  634

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  635  QVEVFHLKQRLQSLENRSPTPRKPFHV  661



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score =   269 bits (687),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 180/267 (67%), Gaps = 45/267 (17%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DP+SV+GNVSLRKQF N+E+ S KM K+S DES SQ  E+G +QLD G
Sbjct  441  SGRKSLSESLLIDPSSVSGNVSLRKQFSNDEDASAKMTKTSGDESPSQ--EQGAKQLDIG  498

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  550
                 S                                       D K G+ A  G  Q 
Sbjct  499  GPKTSS------------------------------------NGGDYKAGLPASSGACQQ  522

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            YEAKL++L+RKN                A     +A+KSKQD EKK+ADA+KE++LLKEK
Sbjct  523  YEAKLSSLMRKN-------GILEGQLATALAGREAAVKSKQDMEKKMADAVKEMELLKEK  575

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            LA VE+AQEEANSLSNIVHSDNVRLEHDVAFLKAV+DDTQKELH+TRG+L GERARAFQL
Sbjct  576  LASVEMAQEEANSLSNIVHSDNVRLEHDVAFLKAVMDDTQKELHTTRGVLAGERARAFQL  635

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QVEVFHLKQRLQSLENR+PTPRKPFHV
Sbjct  636  QVEVFHLKQRLQSLENRSPTPRKPFHV  662



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 209/272 (77%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS---QVMERGTR  745
            SGRKS+S  L  DPN  TGN+SL KQF+NEEE   S KM K+ +DESSS    VM++  +
Sbjct  444  SGRKSISNCLHVDPNPTTGNISLYKQFHNEEEFNMSFKMLKNLEDESSSSQFHVMKQRAK  503

Query  744  QLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPI  565
             LD G++  D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P 
Sbjct  504  ALDMGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPS  558

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             + Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE++
Sbjct  559  NVSQLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVE  618

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            +LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERA
Sbjct  619  ILKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERA  678

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  679  RAFQLQVEVFQLKQRLQTVENQAPTPRKPFHM  710



>gb|KJB38636.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=632

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 167/274 (61%), Positives = 214/274 (78%), Gaps = 9/274 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESSS-QVMERGTRQL  739
            SGR+SLS+  L+D N ++GNVSLRKQF+N+E   TS+++ KSS+D SS  Q  E+ T Q 
Sbjct  361  SGRRSLSDLSLADQNPLSGNVSLRKQFHNKEGYNTSVRITKSSEDLSSILQATEQKTNQT  420

Query  738  DSGLEHIDSKT---IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISA  571
            D+G+E     T     E      E+ N +  + +G  + P+ +D+FVF E + K G +SA
Sbjct  421  DTGVEVNAPGTKIRSDESFLYECENSNPSNPRVEGITSIPVGNDNFVFPEMEGKAGALSA  480

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
            P  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE
Sbjct  481  PSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKE  538

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            +DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GE
Sbjct  539  MDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGE  598

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  599  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  632



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 168/272 (62%), Positives = 217/272 (80%), Gaps = 8/272 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQL  739
            SGR+SLS+  L+D N ++GNVSLRKQF+N+EE  TS+++ KSS+D SS  Q  E+ T Q 
Sbjct  435  SGRRSLSDLSLADQNPLSGNVSLRKQFHNKEEYNTSVRITKSSEDLSSILQATEQKTNQT  494

Query  738  DSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPI  565
            D+G+E +     I  +   + E  N +  + +G  + P+ +D+FVF E + K G +SAP 
Sbjct  495  DTGVEVNAPGTKIRSDESFLYECEN-SNPRVEGITSVPVGNDNFVFPEVEGKAGALSAPS  553

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +Y  YE ++ AL RKNG+LE QL AA+ASR++ +++L+SALKSK++ EK+LAD +KE+D
Sbjct  554  SIY--YEMRMAALSRKNGILEVQLGAAMASRDSIERNLASALKSKEEMEKRLADTVKEMD  611

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            L+KEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  612  LVKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  671

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  672  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  703



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 170/281 (60%), Positives = 211/281 (75%), Gaps = 15/281 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------S  772
            SGRKSLS+S + DP+S +GNVSLRKQF++EE+   +LKM KS  D+             S
Sbjct  450  SGRKSLSDSSI-DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPS  508

Query  771  SQVMERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESD  592
            SQ ME+ +++ ++ ++   +  +      + +S N   ++KQG+ N   DS+     E D
Sbjct  509  SQAMEQRSKKHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPPEID  568

Query  591  CKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKK  412
             +  ++ P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+TEKK
Sbjct  569  NRSVLTNPSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQETEKK  628

Query  411  LADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHST  232
            LADA+KE++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHST
Sbjct  629  LADAIKEVELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHST  688

Query  231  RGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  689  RGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  729



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 167/274 (61%), Positives = 214/274 (78%), Gaps = 9/274 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESSS-QVMERGTRQL  739
            SGR+SLS+  L+D N ++GNVSLRKQF+N+E   TS+++ KSS+D SS  Q  E+ T Q 
Sbjct  435  SGRRSLSDLSLADQNPLSGNVSLRKQFHNKEGYNTSVRITKSSEDLSSILQATEQKTNQT  494

Query  738  DSGLEHIDSKT---IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISA  571
            D+G+E     T     E      E+ N +  + +G  + P+ +D+FVF E + K G +SA
Sbjct  495  DTGVEVNAPGTKIRSDESFLYECENSNPSNPRVEGITSIPVGNDNFVFPEMEGKAGALSA  554

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
            P  +Y  YE ++ AL R+NG+LE QL AA+ASR+  +++L+SALKSK++ EK+LAD +KE
Sbjct  555  PSSIY--YEMRMAALSRRNGILEVQLGAAMASRDTIERNLASALKSKEEMEKRLADTVKE  612

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            +DLLKEKLAG+ELAQEEAN++SNIVHSDNVRLEHDVAF+KAVLDDTQKELHSTRG+L GE
Sbjct  613  MDLLKEKLAGIELAQEEANNISNIVHSDNVRLEHDVAFVKAVLDDTQKELHSTRGVLAGE  672

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  673  RARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  706



>ref|XP_011012826.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=616

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 172/271 (63%), Positives = 205/271 (76%), Gaps = 6/271 (2%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKS---SDDESSSQVMERGTRQL  739
            SGRKSLS+SL  DPNS + NVS RK+F++EEE  +    +    +D SSS   E  +   
Sbjct  347  SGRKSLSDSLFVDPNSASRNVSHRKEFHHEEENRIAAKTARNLENDNSSSPAAEHQSNHS  406

Query  738  DSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
            D  ++ +     I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   
Sbjct  407  DISIQPNNQVGKINAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARAS  464

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +YQ YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DL
Sbjct  465  IYQLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDL  524

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  525  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  584

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQVEVFHLKQRLQS+ENR  TPRKPFHV
Sbjct  585  AFQLQVEVFHLKQRLQSMENRTSTPRKPFHV  615



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score =   265 bits (677),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 207/269 (77%), Gaps = 9/269 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGRKS+S  L  DPN  TGN+SL KQF+NEEE   S KM K+ +DESSS   ++  + LD
Sbjct  444  SGRKSISNCLHVDPNPTTGNISLYKQFHNEEEFNMSFKMLKNLEDESSSS--QQRAKALD  501

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
             G++  D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + 
Sbjct  502  MGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVS  556

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LK
Sbjct  557  QLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILK  616

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAF
Sbjct  617  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAF  676

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  677  QLQVEVFQLKQRLQTVENQAPTPRKPFHM  705



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 204/271 (75%), Gaps = 6/271 (2%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLS+SLL DPNS +GNVS  K F+++EE  T+ K+ K+ D   +S   E      D
Sbjct  451  SGRKSLSQSLLVDPNSASGNVSRHKDFHHKEENTTAGKIAKNLDGNFASLATELQRNHSD  510

Query  735  SGLEHID--SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
              ++  +   K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   
Sbjct  511  VSVQPSNPVGKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHAS  568

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  689  AFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  719



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 203/271 (75%), Gaps = 6/271 (2%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLS+SLL DPNS +GNVS  K F+++EE  T+ K  K+ D   +S   E      D
Sbjct  451  SGRKSLSQSLLVDPNSASGNVSRHKDFHHKEENTTAAKTAKNLDGNFASLATELQRNHSD  510

Query  735  SGLEHID--SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
              ++  +   K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   
Sbjct  511  VSVQPSNPVGKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHAS  568

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQ+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  689  AFQLQIEVFHLKQRLQSMENRTPTPRKPFHV  719



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 206/269 (77%), Gaps = 10/269 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGRKS+S  L  DPN  TGN+SL KQF+NEEE   S KM K+ +DESSS    +  + LD
Sbjct  444  SGRKSISNCLHVDPNPTTGNISLYKQFHNEEEFNMSFKMLKNLEDESSSS---QRAKALD  500

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
             G++  D   I  E   + +SGN +  +KQ S N   ++D+ V  E+  K   S P  + 
Sbjct  501  MGVQ-TDIAGIAGETPFVFDSGN-SKLQKQASANLLSENDEIVIMETGDK---SVPSNVS  555

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q YE+K+ AL++KNG+LEGQ AAA A  EAA+K+LSS +KS+QD EKKLAD +KE+++LK
Sbjct  556  QLYESKMAALIKKNGILEGQFAAASAGCEAAEKNLSSVIKSRQDMEKKLADTIKEVEILK  615

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAF
Sbjct  616  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAF  675

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVF LKQRLQ++EN+APTPRKPFH+
Sbjct  676  QLQVEVFQLKQRLQTVENQAPTPRKPFHM  704



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 212/284 (75%), Gaps = 18/284 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------S  772
            SGRKSLS+S + DP+S +GNVSLRKQF++EE+   +LKM KS  D+             S
Sbjct  424  SGRKSLSDSSI-DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPS  482

Query  771  SQV---MERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQ  601
            SQV   ME+ +++ ++ ++   +  +      + +S N   ++KQG+ N   DS+     
Sbjct  483  SQVSNAMEQRSKKHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPP  542

Query  600  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  421
            E D +  ++ P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+T
Sbjct  543  EIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQET  602

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            EKKLADA+KE++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKEL
Sbjct  603  EKKLADAIKEVELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKEL  662

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            HSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  663  HSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  706



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 172/271 (63%), Positives = 205/271 (76%), Gaps = 6/271 (2%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKS---SDDESSSQVMERGTRQL  739
            SGRKSLS+SL  DPNS + NVS RK+F++EEE  +    +    +D SSS   E  +   
Sbjct  452  SGRKSLSDSLFVDPNSASRNVSHRKEFHHEEENRIAAKTARNLENDNSSSPAAEHQSNHS  511

Query  738  DSGLEHIDS-KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
            D  ++  +    I  E+ +I E     +H  QG GN  +D++D V  +SDC  G  A   
Sbjct  512  DISIQPNNQVGKINAEMTSIFEMETPNSHN-QGIGNVSVDNEDVVSLDSDCTTG-GARAS  569

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +YQ YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E+DL
Sbjct  570  IYQLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMDL  629

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  630  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  689

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQVEVFHLKQRLQS+ENR  TPRKPFHV
Sbjct  690  AFQLQVEVFHLKQRLQSMENRTSTPRKPFHV  720



>gb|KJB72601.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=665

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 207/272 (76%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQL  739
            SGRKSLSE    D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E  T Q 
Sbjct  399  SGRKSLSELTFMDQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKTNQS  458

Query  738  DSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPI  565
            ++G+      T I  E  T  E  N      +G  N P+ +D+FVF E+D + G +SAP 
Sbjct  459  ETGVRISAPGTKISSEFGT--ECLNPLV---EGIANDPIGNDNFVFPEADDRSGALSAPT  513

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE++
Sbjct  514  SIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKEME  573

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  574  LLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  633

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  634  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  665



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 212/284 (75%), Gaps = 18/284 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------S  772
            SGRKSLS+S + DP+S +GNVSLRKQF++EE+   +LKM KS  D+             S
Sbjct  450  SGRKSLSDSSI-DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPS  508

Query  771  SQV---MERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQ  601
            SQV   ME+ +++ ++ ++   +  +      + +S N   ++KQG+ N   DS+     
Sbjct  509  SQVSNAMEQRSKKHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPP  568

Query  600  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  421
            E D +  ++ P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+T
Sbjct  569  EIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQET  628

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            EKKLADA+KE++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKEL
Sbjct  629  EKKLADAIKEVELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKEL  688

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            HSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  689  HSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  732



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score =   263 bits (671),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 207/269 (77%), Gaps = 14/269 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDESSSQVMERGTRQLDS  733
            SGRKSLSESLL DPN   GNVSLRKQFYNEEE +     K S D++S Q ME  T+  DS
Sbjct  446  SGRKSLSESLLVDPNPGPGNVSLRKQFYNEEENADATTTKISVDKNSFQTMEPNTKLSDS  505

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQ-GSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
            G               +  +G+ +T ++   S +   +++D + QE+D K  ++AP G+Y
Sbjct  506  GG------------VGVSYNGDRSTEERSYASESDKQETEDLILQENDGKSRMTAPPGVY  553

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q  EAKL +L+RKNG+LEGQLAAALA+REAA+K+LS+A++S+ + EKKL +AMKE+++L+
Sbjct  554  QVSEAKLASLMRKNGILEGQLAAALAAREAAEKNLSAAIRSRLEMEKKLGEAMKEMEMLR  613

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EK+  VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE  RAF
Sbjct  614  EKVTSVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGEHGRAF  673

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVFHLKQRLQSLE RAPTPRKP+HV
Sbjct  674  QLQVEVFHLKQRLQSLEPRAPTPRKPYHV  702



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score =   262 bits (670),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 207/272 (76%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQL  739
            SGRKSLSE    D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E  T Q 
Sbjct  440  SGRKSLSELTFMDQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKTNQS  499

Query  738  DSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPI  565
            ++G+      T I  E  T  E  N      +G  N P+ +D+FVF E+D + G +SAP 
Sbjct  500  ETGVRISAPGTKISSEFGT--ECLNPLV---EGIANDPIGNDNFVFPEADDRSGALSAPT  554

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE++
Sbjct  555  SIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKEME  614

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  615  LLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  674

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  675  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  706



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score =   262 bits (670),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 207/272 (76%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQL  739
            SGRKSLSE    D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E  T Q 
Sbjct  443  SGRKSLSELTFMDQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKTNQS  502

Query  738  DSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPI  565
            ++G+      T I  E  T  E  N      +G  N P+ +D+FVF E+D + G +SAP 
Sbjct  503  ETGVRISAPGTKISSEFGT--ECLNPLV---EGIANDPIGNDNFVFPEADDRSGALSAPT  557

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK ADAMKE++
Sbjct  558  SIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFADAMKEME  617

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  618  LLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  677

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  678  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  709



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 170/272 (63%), Positives = 207/272 (76%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQL  739
            SGRKSLSE    D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E    Q 
Sbjct  443  SGRKSLSELTFMDQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKMNQS  502

Query  738  DSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPI  565
            ++G+      T I  E  T  E  N      +G  N P+D+D+FVF E+D + G +SAP 
Sbjct  503  ETGVRISAPGTKISSEFGT--ECLNPLV---EGIANDPVDNDNFVFPEADDRSGALSAPT  557

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ Y+ ++ +L RKNG+LE QLA ALASR+ A+++L++ALKSK++ EKK ADAMKE++
Sbjct  558  SIYQFYDTRMASLSRKNGILEVQLATALASRDTAERTLAAALKSKEEMEKKFADAMKEME  617

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  618  LLKEKLTGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  677

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  678  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  709



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 170/271 (63%), Positives = 212/271 (78%), Gaps = 13/271 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSS-DDESSSQVMERGTRQL  739
            SGRKS+SE+ L DPN + GN+SLRKQF+N+E  + + K+ K++ DD S+SQV E    Q 
Sbjct  416  SGRKSISETSLVDPNPIPGNISLRKQFHNDEAFDKTTKIAKTAEDDSSTSQVTENKLTQ-  474

Query  738  DSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG-  562
             SG E    +T+P       ES N     K+G G  P+D+ D +F E+  K   S+    
Sbjct  475  -SGGE-FHGETLPS--VYEYESSNPF---KEGVGYHPIDNTD-LFSENSGKIVTSSTFSS  526

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +YQ YEAK+ AL+RKNG+LEGQLAAA ASREA +K+LSSALK +Q+ EK++AD +KE+++
Sbjct  527  IYQFYEAKMAALIRKNGVLEGQLAAATASREAVEKNLSSALKIRQEMEKRIADMIKEMEM  586

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            L++KLAGVE+A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER+R
Sbjct  587  LRDKLAGVEIAKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERSR  646

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  647  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  677



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 170/272 (63%), Positives = 207/272 (76%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS-QVMERGTRQL  739
            SGRKSLSE    D N  + NVSLRKQF  EEE  T++++ K+SDD SS  Q  E    Q 
Sbjct  467  SGRKSLSELTFMDQNHPSENVSLRKQFRIEEEHNTTVRITKNSDDSSSILQATEEKMNQS  526

Query  738  DSGLEHIDSKT-IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPI  565
            ++G+      T I  E  T  E  N      +G  N P+D+D+FVF E+D + G +SAP 
Sbjct  527  ETGVRISAPGTKISSEFGT--ECLNPLV---EGIANDPVDNDNFVFPEADDRSGALSAPT  581

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ Y+ ++ +L RKNG+LE QLA ALASR+ A+++L++ALKSK++ EKK ADAMKE++
Sbjct  582  SIYQFYDTRMASLSRKNGILEVQLATALASRDTAERTLAAALKSKEEMEKKFADAMKEME  641

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  642  LLKEKLTGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  701

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  702  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  733



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 165/274 (60%), Positives = 202/274 (74%), Gaps = 20/274 (7%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEET-------SLKMPKSSDDESSSQVMERG  751
            SGR+SLSE    D N  +GNVSLRKQF NEEE         L +P+++DD +   +   G
Sbjct  438  SGRRSLSEIAFVDQNPSSGNVSLRKQFNNEEEYRAVIEEEELPLPRTADDRT--HINNSG  495

Query  750  TRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA  571
                  G   I S+  P        S N+   +KQ    FP+++ D +F E+D     S+
Sbjct  496  ------GANKITSEKTPSMSSDREFSSNL---QKQCPETFPMENADGIFLETDTSLASSS  546

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
             +  YQ +EAK+ AL+R+NG+LEGQL AALA REAA+++LS A+++KQ+TEKKLADAM+E
Sbjct  547  SV--YQFHEAKMAALIRRNGILEGQLTAALAGREAAERNLSVAMRTKQETEKKLADAMRE  604

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            ++L+KEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  605  VELMKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  664

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RARAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  665  RARAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  698



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 168/272 (62%), Positives = 204/272 (75%), Gaps = 21/272 (8%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLSES L D N  +GNVSLRKQF NEEE S   K+ K  +DE SS           
Sbjct  441  SGRKSLSESTLIDLNPSSGNVSLRKQFSNEEEYSXTQKVAKHLEDEGSS-----------  489

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP---I  565
              L+  + K+I EE     E  N++  +  G+ + P+++DD  + E++CK G  AP    
Sbjct  490  --LQATECKSIGEETALAFEDENLSP-RINGNDSLPVNNDDLAYAETNCKVG--APPSTS  544

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             + Q Y+ K+ +L+RKNG+LEGQLAAALA++EA +KS SS LKSKQ+ +KKLAD MKE++
Sbjct  545  SICQLYKTKIDSLIRKNGILEGQLAAALANQEATEKSFSSILKSKQEVDKKLADTMKEME  604

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            +LKEKLA +E+ QEEANSL+NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  605  VLKEKLADLEVTQEEANSLNNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  664

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            R FQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  665  RTFQLQVEVFHLKQRLQSIENRAPTPRKPFHV  696



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score =   258 bits (660),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 205/269 (76%), Gaps = 16/269 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLS+SLL DPNS + NVS RK+F++EEE  +  K  ++ +D++SS        +++
Sbjct  452  SGRKSLSDSLLVDPNSASRNVSHRKEFHHEEENRIAAKTARNLEDDNSSSPPNNPVSKIN  511

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
            +            E+ +I E     +H  QG GN  +D++D V  ESDC  G  A   +Y
Sbjct  512  A------------EMSSIFEMETPNSHN-QGIGNVSVDNEDVVSPESDCTTG-GARASIY  557

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q YE K+ AL+RKNG+LEGQLAAALA REAA+K+LSS LKS+Q+ EKKL D+++E++LLK
Sbjct  558  QLYETKIAALIRKNGILEGQLAAALAGREAAEKNLSSILKSRQEMEKKLVDSVREMELLK  617

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERARAF
Sbjct  618  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAF  677

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVFHLKQRLQS+ENR  TPRKPF V
Sbjct  678  QLQVEVFHLKQRLQSMENRTSTPRKPFRV  706



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 171/272 (63%), Positives = 213/272 (78%), Gaps = 14/272 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEE--ETSLKMPKSS-DDESSSQVMERGTRQL  739
            SGRKS+SE+ L DPN + GN+SLRKQF+N+E  + + K+ K++ DD S+SQV E    Q 
Sbjct  416  SGRKSISETSLVDPNPIPGNISLRKQFHNDESFDKTTKIAKTAEDDSSTSQVTENKLTQ-  474

Query  738  DSGLEHIDSKTIPEEICTIPESGNMATHKKQGSG-NFPLDSDDFVFQESDCKFGISAPIG  562
             SG E    +T+P       ES N     K+G G + P+D+ D +F ES  K   S+   
Sbjct  475  -SGGE-FHGETLPS--VYEYESSNPF---KEGVGYHHPIDNTD-LFSESSGKIVTSSTFS  526

Query  561  -LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ YEAK+ AL+RKNG+LEGQLAAA ASREA +K+LSSALK +Q+ EK++AD +KE++
Sbjct  527  SIYQFYEAKMAALIRKNGVLEGQLAAATASREAVEKNLSSALKIRQEMEKRIADMIKEME  586

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            +L++KLAGVE+A+EEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER+
Sbjct  587  MLRDKLAGVEIAKEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERS  646

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  647  RAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  678



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score =   258 bits (660),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 213/284 (75%), Gaps = 22/284 (8%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDES------------S  772
            SGRKSLS+S + DP+SV GNV LRKQF++EE+   +LKM KS  D+             S
Sbjct  450  SGRKSLSDSSI-DPHSV-GNVLLRKQFHHEEDYNLALKMQKSPRDDKYKERCDYLLSNPS  507

Query  771  SQVMERGTRQLDSGLEHIDSKTI---PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQ  601
            SQ ME+ +++ ++ ++ +D   I    EE     ES N+  ++KQG+ N   DS+     
Sbjct  508  SQAMEQRSKKQETAIQ-MDIAGILASTEENLFDSESSNL--YQKQGNNNLMSDSNHIAPP  564

Query  600  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  421
            E++ +  ++ P  +YQ YE K+  L RKN LLE QL  A+AS+EA +K+LSSA+KS+QD 
Sbjct  565  ETENRSMLTNPSNIYQLYETKIVTLTRKNVLLEEQLNVAMASQEATEKNLSSAIKSRQDM  624

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            EKK+ADAMKE++LLKEKLA VELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKEL
Sbjct  625  EKKIADAMKEVELLKEKLASVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKEL  684

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            HSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFH+
Sbjct  685  HSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHM  728



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 173/271 (64%), Positives = 213/271 (79%), Gaps = 7/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDES-SSQVMERGTRQLD  736
            SGRKSLSE+L+ +PNSV+GNVSLRKQF+ EE ++ +KM K+ +D S SS  ++    Q D
Sbjct  446  SGRKSLSETLV-EPNSVSGNVSLRKQFHEEEHSAAVKMAKNIEDGSFSSLAVDHRINQSD  504

Query  735  SGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
            +  +   S  K I EE   + +S N +  + QG  N  ++++D +  E D   G  A   
Sbjct  505  TSNQTNISIGKIIAEETSCVFDSEN-SHSQNQGVENHLVENEDALVSEPDGMTG-GAHSS  562

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +YQ YE K+ +L+RKNG+LEGQLAAALASREAA+K+LSS LKS+Q+ E+KL D ++E++L
Sbjct  563  IYQLYETKIASLIRKNGVLEGQLAAALASREAAEKNLSSVLKSRQEIERKLTDTLREMEL  622

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  623  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLTGERAR  682

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQVEVFHLKQRLQS+ENR PTPRKPF+V
Sbjct  683  AFQLQVEVFHLKQRLQSMENRVPTPRKPFNV  713



>ref|XP_012069388.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Jatropha 
curcas]
 gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 173/271 (64%), Positives = 209/271 (77%), Gaps = 9/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE-TSLKMPKSSDD-ESSSQVMERGTRQLD  736
            S RKSLSE+L+ DPN   GNVSLRKQF++EE  T++KM K+ ++  SSS   E    Q  
Sbjct  444  SARKSLSETLV-DPN--PGNVSLRKQFHDEEHGTAVKMVKNLEEGTSSSPAREHRMNQTH  500

Query  735  SGLEHIDS--KTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
              ++   S  K I EE     ES N+ + +    GN P+D+DD +  E+D   G  A   
Sbjct  501  MPIQTNISIGKIIAEEASCGFESENLNS-QNPAIGNHPVDNDDVLVPETDGMAG-GAHSS  558

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +YQ YE K+ AL+RKNG+LEGQLAAAL+SR++A+K+LSS LKSKQ+ EKKL DA++E++L
Sbjct  559  IYQLYETKIAALIRKNGVLEGQLAAALSSRDSAEKNLSSVLKSKQELEKKLTDALREMEL  618

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKE+LA VELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  619  LKERLASVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  678

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQVEVFHLKQRLQS+ENR PTPRKPF+V
Sbjct  679  AFQLQVEVFHLKQRLQSMENRVPTPRKPFNV  709



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 166/274 (61%), Positives = 208/274 (76%), Gaps = 15/274 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQL  739
            SGR+SLSE    D  N  +GNVSLRKQF  EEE    ++  K S++E S   + R     
Sbjct  442  SGRRSLSEIAFGDHRNPSSGNVSLRKQFSTEEEYRAVIEPTKCSEEEVS---VPRTVDDN  498

Query  738  DSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISA  571
            + G     +K   E+  ++  + +++  +KQGS  FPL++ D   +FQE D   F G  +
Sbjct  499  NGG-----AKITAEKTLSMVSNHDISNLQKQGSETFPLETVDGALIFQEMDNISFAGSMS  553

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
               +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++
Sbjct  554  SSSVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRD  613

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            ++LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  614  VELLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  673

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RARAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  674  RARAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 168/274 (61%), Positives = 211/274 (77%), Gaps = 15/274 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQL  739
            SGR+SLSE    D  N  +GNVSLRKQF  EEE    ++  KSS++E S   + R T + 
Sbjct  442  SGRRSLSEIAFGDHRNPSSGNVSLRKQFSTEEEYRAVIEPTKSSEEEVS---VPRTTEEN  498

Query  738  DSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKFGIS-A  571
            + G +  + KT+     ++  + +++   KQ S  FPL++ D   +FQE D  KFG S +
Sbjct  499  NGGAKITEEKTL-----SMVSNHDISNLHKQCSETFPLENVDGALIFQEMDNIKFGGSMS  553

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
               +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++
Sbjct  554  SSSVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRD  613

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            ++LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  614  VELLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  673

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RARAFQLQVEVFHLKQRLQSLENRA T RKPFHV
Sbjct  674  RARAFQLQVEVFHLKQRLQSLENRAATHRKPFHV  707



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 210/272 (77%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKS+S+S  +D +S++  +SLRKQF++EE+ +L  +M KS +D+   + ME+ +++L+
Sbjct  449  SGRKSVSDSS-TDLHSISSTMSLRKQFHHEEDYNLAIRMLKSPEDDKH-KAMEQRSKKLE  506

Query  735  SGLEHIDSKTI---PEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPI  565
            + +E +D   I    EE     ES N+   +K G+ +   DS+     E+D   G+ A  
Sbjct  507  TAVE-MDIAGILASTEENLFDSESSNLC--QKLGNNDLMADSNHIAPPETDGISGLLANP  563

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ YE K+  L RKN LLE QL AALA++EAA+K+LSSALKS+QD EKKLADAMKE++
Sbjct  564  YIYQLYETKIVTLTRKNVLLEEQLTAALANQEAAEKNLSSALKSRQDMEKKLADAMKEVE  623

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKLAG+ELAQEEAN+LSN+ HSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  624  LLKEKLAGMELAQEEANNLSNMSHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  683

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVE FHLKQRLQS+ENRAPTPRKPFH+
Sbjct  684  RAFQLQVEAFHLKQRLQSMENRAPTPRKPFHI  715



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 164/274 (60%), Positives = 208/274 (76%), Gaps = 15/274 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDP-NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQL  739
            SGR+SLSE    D  N  +GNVSLRKQF  EEE    ++  K S++E S       +R +
Sbjct  442  SGRRSLSEIAFGDHHNPSSGNVSLRKQFSTEEEYRAVIEPTKCSEEEVSV------SRTV  495

Query  738  DSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISA  571
            D    +  +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +
Sbjct  496  DD--NNGGAKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMS  553

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
               +YQ +EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++
Sbjct  554  SSSVYQFHEAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRD  613

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            ++LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GE
Sbjct  614  VELLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGE  673

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RARAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  674  RARAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  707



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 173/269 (64%), Positives = 213/269 (79%), Gaps = 3/269 (1%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESS-SQVMERGTRQLDS  733
            S R+SLSES+ +D ++V+G+VSLRKQF++EEE + K+ + SDDE+S SQ +E       +
Sbjct  441  SSRRSLSESVHADSSNVSGSVSLRKQFHSEEELTCKLTRHSDDENSFSQFLEERRPPEAA  500

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGI-SAPIGLY  556
             L     + I E+I ++ ESGN +      S  FPLD++  +F ES+ K G+ SAP  +Y
Sbjct  501  CLAETSGRFIMEDIPSLSESGNFSV-PSCVSEKFPLDNEAIIFPESEDKCGVFSAPSSIY  559

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            Q YE ++ AL+RKNG+LEGQLAAALASREAA+K++SS LKS+Q+TEKKL D  KE++LLK
Sbjct  560  QLYETRMAALIRKNGMLEGQLAAALASREAAEKNVSSVLKSRQETEKKLVDTGKELELLK  619

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKL G+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ERARAF
Sbjct  620  EKLGGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGMLANERARAF  679

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQVEVFHLKQRLQSLENR  TPRKPF V
Sbjct  680  QLQVEVFHLKQRLQSLENRTATPRKPFQV  708



>gb|EPS74438.1| hypothetical protein M569_00314, partial [Genlisea aurea]
Length=449

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 161/278 (58%), Positives = 194/278 (70%), Gaps = 41/278 (15%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DPNS +GNVSLR+QFYNEE  S  + KSS+D++S +        LD  
Sbjct  201  SGRKSLSESLLIDPNSSSGNVSLRRQFYNEENGSNSLSKSSEDKTSFRAT------LDGN  254

Query  729  LEHIDSKT----IPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
            L+   S +    + E +   P++             FP +SDD + Q             
Sbjct  255  LKPSGSFSSDIHVEEVVGEHPDA-------------FPSESDDVLLQTRRS---------  292

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
             +  YE K+ AL++K G+LEGQLAAA A+REAA+K+ +SA +S+Q+ EKKL D +KEIDL
Sbjct  293  -HHVYEEKIAALMKKTGILEGQLAAATAAREAAEKNSASATRSRQEMEKKLVDTLKEIDL  351

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK--------ELHSTRG  226
            LKEKL+ VE++QEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK        ELHSTRG
Sbjct  352  LKEKLSSVEISQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKASWKQKRLELHSTRG  411

Query  225  LLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            +L GERARAFQLQVEVFHLKQRLQSLE RAPTPRK FH
Sbjct  412  VLAGERARAFQLQVEVFHLKQRLQSLETRAPTPRKQFH  449



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 161/272 (59%), Positives = 200/272 (74%), Gaps = 27/272 (10%)
 Frame = -1

Query  909  SGRKSLSESLLSDP-NSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDS  733
            SGR+SLSE    D  N  +GNVSLRKQF  EEE                   R T   ++
Sbjct  442  SGRRSLSEIAFGDHHNPSSGNVSLRKQFSTEEEY------------------RATVDDNN  483

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPI  565
            G     +K   E+  ++  + +++  +KQ S +FPL++ D   +FQE D   F G  +  
Sbjct  484  G----GAKITAEKTLSMVSNHDISNLQKQCSESFPLENVDGALIFQEMDNINFAGSMSSS  539

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ +EAK+TAL+R+NG+LEGQL  ALA REAA++++S AL+SKQ+T+KKL+DAM++++
Sbjct  540  SVYQFHEAKMTALIRRNGILEGQLETALAGREAAERNVSVALRSKQETDKKLSDAMRDVE  599

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  600  LLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  659

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  660  RAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  691



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 200/272 (74%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDS  733
            SGR+SLSE    D  N  +GNVSLRKQF  EEE    +  +   E    V    T     
Sbjct  442  SGRRSLSEIAFGDHRNPPSGNVSLRKQFSTEEEYRAVIEPAKCSEEDISVPPPTTDDNTG  501

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPI  565
            G     +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++  
Sbjct  502  G-----AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSS  556

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++
Sbjct  557  SVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVE  616

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  617  LLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  676

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  677  RAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  708



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 200/272 (74%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDS  733
            SGR+SLSE    D  N  +GNVSLRKQF  EEE    +  +   E    V    T     
Sbjct  442  SGRRSLSEIAFGDHRNPPSGNVSLRKQFSTEEEYRAVIEPAKCSEEDISVPPPTTDDNTG  501

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPI  565
            G     +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++  
Sbjct  502  G-----AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSS  556

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++
Sbjct  557  SVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVE  616

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  617  LLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  676

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  677  RAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 162/272 (60%), Positives = 200/272 (74%), Gaps = 10/272 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDS  733
            SGR+SLSE    D  N  +GNVSLRKQF  EEE    +  +   E    V    T     
Sbjct  442  SGRRSLSEIAFGDHRNPPSGNVSLRKQFSTEEEYRAVIEPAKCSEEDISVPPPTTDDNTG  501

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAPI  565
            G     +K   E+  ++     + + +KQ S  +PL++ D   +FQE D   F G ++  
Sbjct  502  G-----AKITAEKTLSMVSDREILSLQKQCSETYPLENVDGALIFQEMDNINFAGSASSS  556

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM++++
Sbjct  557  SVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDVE  616

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERA
Sbjct  617  LLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERA  676

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  677  RAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  708



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 200/273 (73%), Gaps = 11/273 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEET-SLKMPKSSDDESSSQVMERGTRQLD  736
            SGR+SLSE    D  N  +GNVSLRKQF  EEE  ++  P    +E  S  +        
Sbjct  442  SGRRSLSEIAFGDHRNPSSGNVSLRKQFSTEEEYRAVIEPAKCSEEELSVPLPTADDNNG  501

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDD--FVFQESD-CKF-GISAP  568
             G     +K   E+  ++     +   +KQ S  FPL++ D   + QE D   F G ++ 
Sbjct  502  GG-----AKITGEKTLSMVSDREVLNLQKQCSETFPLENVDGTLIIQEMDNINFAGSASS  556

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DAM+++
Sbjct  557  SSVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLSDAMRDV  616

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  617  ELLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  676

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  677  ARAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  709



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 162/278 (58%), Positives = 198/278 (71%), Gaps = 29/278 (10%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEETSL-----KMPKSSDDESSSQVMERGT  748
            SGR+SLSE   +D  N  +GNVSLRKQF  EEE        K P++SDD+++        
Sbjct  442  SGRRSLSEIAFADHRNPSSGNVSLRKQFSTEEEYRAVVEPAKCPEASDDKNNG-------  494

Query  747  RQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGIS  574
                       +K   E+  +      M+  +KQ S  FP     D  +F   D K  ++
Sbjct  495  ----------GAKITAEKTLSTVSDREMSNLQKQCSETFPFAHIDDALIFPGMD-KTNLA  543

Query  573  APIG---LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLAD  403
            A      +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL D
Sbjct  544  ANASSSSVYQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQETDKKLCD  603

Query  402  AMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGL  223
            AM++++LLKEKL G+ELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+
Sbjct  604  AMRDVELLKEKLTGLELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGV  663

Query  222  LGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            L GERARAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  664  LAGERARAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  701



>gb|KEH32273.1| acyl-CoA-binding domain protein [Medicago truncatula]
Length=718

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 168/271 (62%), Positives = 205/271 (76%), Gaps = 9/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLSES+  DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D
Sbjct  452  SGRKSLSESV--DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNEND  509

Query  735  S-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGL  559
               L +I    +  E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +
Sbjct  510  RRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNI  566

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
            YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL
Sbjct  567  YQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELL  626

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            +EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARA
Sbjct  627  REKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARA  686

Query  198  FQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            FQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  687  FQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  717



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 168/271 (62%), Positives = 205/271 (76%), Gaps = 9/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLSES+  DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D
Sbjct  453  SGRKSLSESV--DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNEND  510

Query  735  S-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGL  559
               L +I    +  E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +
Sbjct  511  RRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNI  567

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
            YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL
Sbjct  568  YQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELL  627

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            +EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARA
Sbjct  628  REKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARA  687

Query  198  FQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            FQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  688  FQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  718



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 168/271 (62%), Positives = 205/271 (76%), Gaps = 9/271 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLSES+  DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D
Sbjct  477  SGRKSLSESV--DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNEND  534

Query  735  S-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGL  559
               L +I    +  E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +
Sbjct  535  RRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNI  591

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
            YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL
Sbjct  592  YQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELL  651

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            +EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARA
Sbjct  652  REKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARA  711

Query  198  FQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            FQLQ EVFHLKQRLQS+ENR + TPRKPFHV
Sbjct  712  FQLQYEVFHLKQRLQSMENRTSTTPRKPFHV  742



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score =   238 bits (607),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 204/276 (74%), Gaps = 16/276 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGR+SLSESL+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  + ++  T + D
Sbjct  439  SGRRSLSESLVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDENSFPRAVDHRTNEND  498

Query  735  SG--LEHIDSKTIPEE----ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  574
             G  +    +K I EE    +  IP   N+         N  L+SD+  F E + K G  
Sbjct  499  HGKQMNSSGAKNITEEQQALLSGIPIQQNLVFE------NDMLESDNVSFTE-NIKSGSL  551

Query  573  APIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMK  394
                +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLA++ K
Sbjct  552  TTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLASVLKSRQEMERKLAESHK  611

Query  393  EIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGG  214
            E++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ G
Sbjct  612  EMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAG  671

Query  213  ERARAFQLQVEVFHLKQRLQSLENRA-PTPRKPFHV  109
            ERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  672  ERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  707



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 204/276 (74%), Gaps = 16/276 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGR+SLSESL+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  + ++  T + D
Sbjct  467  SGRRSLSESLVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDENSFPRAVDHRTNEND  526

Query  735  SG--LEHIDSKTIPEE----ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  574
             G  +    +K I EE    +  IP   N+         N  L+SD+  F E + K G  
Sbjct  527  HGKQMNSSGAKNITEEQQALLSGIPIQQNLVFE------NDMLESDNVSFTE-NIKSGSL  579

Query  573  APIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMK  394
                +Y  YE+KL +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLA++ K
Sbjct  580  TTSNVYHCYESKLASLIRKNGILEGQLAASLASKEAAEKSLASVLKSRQEMERKLAESHK  639

Query  393  EIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGG  214
            E++L++EKL  +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ G
Sbjct  640  EMELMREKLTSLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAG  699

Query  213  ERARAFQLQVEVFHLKQRLQSLENRA-PTPRKPFHV  109
            ERARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  700  ERARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  735



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 187/242 (77%), Gaps = 8/242 (3%)
 Frame = -1

Query  825  NEEETSLKMPKSSDDESSS-QVMERGTRQLDSGLEHIDSKT-IPEEICTIPESGNMATHK  652
            +E  T++++ K+SDD SS  Q  E  T Q ++G+      T I  E  T  E  N     
Sbjct  443  SEHNTTVRITKNSDDSSSILQATEEKTNQSETGVRISAPGTKISSEFGT--ECLNPLV--  498

Query  651  KQGSGNFPLDSDDFVFQESDCKFG-ISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  475
             +G  N P+ +D+FVF E+D + G +SAP  +YQ Y+ ++ +L RKNG+LE QLA A AS
Sbjct  499  -EGIANDPIGNDNFVFPEADDRSGALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFAS  557

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            R+ A+++L+SALKSK++ EKK ADAMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRL
Sbjct  558  RDTAERTLASALKSKEEMEKKFADAMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRL  617

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  618  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  677

Query  114  HV  109
            +V
Sbjct  678  NV  679



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 203/273 (74%), Gaps = 11/273 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQ--  742
            S RKSL++S + D +SV+G++SLRKQF  EE+ SL  +M KS +++    + ++  +Q  
Sbjct  450  SCRKSLADSSI-DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKAIEQKSKKQET  508

Query  741  -LDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA-P  568
             +   +  I + +I E +C   ES N+  ++K G+ N   DS+     E+    G+   P
Sbjct  509  VVQMDIAGIVA-SIEENLCD-SESSNL--YQKPGNNNLMADSNHIAPPETASSSGLLVQP  564

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS QD +K+LA+AMKE+
Sbjct  565  SNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQDMDKELANAMKEV  624

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GER
Sbjct  625  ELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGER  684

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  685  ARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  717



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score =   235 bits (600),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 163/275 (59%), Positives = 205/275 (75%), Gaps = 15/275 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGR+SLSESL+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  +  +  T +  
Sbjct  441  SGRRSLSESLVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDESSFPRSGDHRTNENH  500

Query  735  SG--LEHIDSKTIPEE---ICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA  571
             G  +    +KT  EE   +  IP   N+    +      P +SD+  F E++    +S+
Sbjct  501  HGKQMNTCGTKTNIEEQAMLSGIPNQQNLVFENE-----MP-ESDNLSFSENNKSASLSS  554

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
               +Y  YE+K+ +L+RKNG+LEGQLAA+LAS+EAA+KSL+S LKS+Q+ E+KLADA KE
Sbjct  555  S-NVYHYYESKVASLIRKNGILEGQLAASLASKEAAEKSLTSVLKSRQEMERKLADAHKE  613

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            ++L++EKLA +ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GE
Sbjct  614  MELMREKLASLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGE  673

Query  210  RARAFQLQVEVFHLKQRLQSLENRA-PTPRKPFHV  109
            RARAFQLQ EVFHLKQRLQS+ENRA  TPRKPFHV
Sbjct  674  RARAFQLQYEVFHLKQRLQSMENRASTTPRKPFHV  708



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 209/286 (73%), Gaps = 24/286 (8%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE------------SS  772
            S RKSL++S + D +SV+G++SLRKQF  EE+ SL  +M KS +++             S
Sbjct  450  SCRKSLADSSI-DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPS  508

Query  771  SQVMERGTRQLDSGLEHID----SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVF  604
            SQ +E+ +++ ++ ++ +D      +I E +C   ES N+  ++K G+ N   DS+    
Sbjct  509  SQAIEQKSKKQETVVQ-MDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHIAP  564

Query  603  QESDCKFGISA-PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQ  427
             E+    G+   P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS Q
Sbjct  565  PETASSSGLLVQPSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKSGQ  624

Query  426  DTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
            D +K+LA+AMKE++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  625  DMDKELANAMKEVELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDTQK  684

Query  246  ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ELHSTRG+L GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  685  ELHSTRGVLAGERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  730



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 203/273 (74%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLL-SDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQ  742
            S RKSLSE+LL    NS+   +SLR+QF + EE  T++++ K S+DESS  Q  +  T Q
Sbjct  441  SERKSLSETLLEQGSNSLPTKISLRRQFDHHEEYNTNVRIDKHSEDESSFPQAGDHRTSQ  500

Query  741  LDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
             D G  +    +KT  EE  ++  SGN +  +  G GN  L+SDD  F E+     +SA 
Sbjct  501  NDPGNQMRSSGAKTNMEEQVSV--SGN-SNQQNLGFGNPFLESDDVSFPENSKSGSLSAA  557

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+  KKLAD +KE+
Sbjct  558  SSIHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMGKKLADTLKEM  617

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LL EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER
Sbjct  618  ELLSEKLVSAELAQEEANNLSNLVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAER  677

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
             RAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  678  TRAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  710



>ref|XP_010931596.1| PREDICTED: tip elongation aberrant protein 3 isoform X5 [Elaeis 
guineensis]
Length=629

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 203/287 (71%), Gaps = 25/287 (9%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE----SSSQVMERGT  748
            S RKSL++S + D +SV+G++SLRKQF  EE+ SL  +M KS +++        +    +
Sbjct  346  SCRKSLADSSI-DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPS  404

Query  747  RQLDSGLEHIDSK--------------TIPEEICTIPESGNMATHKKQGSGNFPLDSDDF  610
             Q+++ +E    K              +I E +C   ES N+  ++K G+ N   DS+  
Sbjct  405  SQVNNAIEQKSKKQETVVQMDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHI  461

Query  609  VFQESDCKFGISA-PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalks  433
               E+    G+   P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS
Sbjct  462  APPETASSSGLLVQPSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKS  521

Query  432  KQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDT  253
             QD +K+LA+AMKE++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDT
Sbjct  522  GQDMDKELANAMKEVELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDT  581

Query  252  QKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFH  112
            QKELHSTRG+L GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH
Sbjct  582  QKELHSTRGVLAGERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFH  628



>ref|XP_004486044.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=610

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 201/273 (74%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLL-SDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESS-SQVMERGTRQ  742
            S RKSLSESLL  D  S+  N+SL  QF +EE  ++  ++ K S+DESS  Q  +  T Q
Sbjct  341  SERKSLSESLLVEDSGSLPTNISLHSQFDHEEAFNVHDRIGKHSEDESSFPQAADGRTNQ  400

Query  741  LDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
             D G  +    +KT  E+   +  SG+ +  K  G GN  L+SD   F E+     +S  
Sbjct  401  NDPGHQMNTRGAKTNIEQPVLV--SGD-SLQKNLGFGNSLLESDHESFPENSKSGSLSTA  457

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +Y  YE K+++L+RK G+LE QL AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI
Sbjct  458  SNIYDYYETKVSSLIRKFGILEAQLLAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEI  517

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LL+EKLAG ELAQE+A++LSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GER
Sbjct  518  ELLREKLAGAELAQEDASNLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGER  577

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  578  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  610



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 197/272 (72%), Gaps = 18/272 (7%)
 Frame = -1

Query  909  SGRKSLSESLLSDP-NSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQL  739
            SGR+SLSE   +DP N  +GNVSLRKQF  EEE    ++ P  S +E      E+ T + 
Sbjct  442  SGRRSLSEIAFADPRNPSSGNVSLRKQFSTEEEYRAVIEPPAKSPEE------EKITDED  495

Query  738  DSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPI  565
              G   I ++       T+    +   HK Q S  FP     D  +F E D      +  
Sbjct  496  SGGGAKITAEK------TLSTVSDRELHK-QSSEPFPFAHIDDALIFPEMDNATLAPSSS  548

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DA+++++
Sbjct  549  SVYQFHEAKMTALIRRNGVLEGQLEAALAGREAAERNVSVALRSKQETDKKLSDALRDVE  608

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+EL+Q+EANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERA
Sbjct  609  LLKEKLTGLELSQDEANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERA  668

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  669  RAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  700



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 201/273 (74%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLL-SDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESS-SQVMERGTRQ  742
            S RKSLSESLL  D NS+  N+SLR+QF ++EE +  +++ K S+DESS  +  +  T Q
Sbjct  442  SERKSLSESLLVQDSNSLPTNISLRRQFDHDEECNADVRIDKHSEDESSFPRAADHKTNQ  501

Query  741  LD--SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
             D  + +    +KT  EE  ++  S N    K  G GN  L+SDD  F E+     +SA 
Sbjct  502  NDPRNHMSRSGAKTNMEEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGSLSAA  558

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              ++  YE K+ +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD +KE+
Sbjct  559  SDIHHYYETKVASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADTLKEM  618

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LL+EKL   EL QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER
Sbjct  619  ELLREKLVSAELVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAER  678

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
             RAFQLQVEVFHLKQRLQS+E RAPTPRKPF V
Sbjct  679  TRAFQLQVEVFHLKQRLQSMEKRAPTPRKPFQV  711



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 161/277 (58%), Positives = 201/277 (73%), Gaps = 13/277 (5%)
 Frame = -1

Query  909  SGRKSLSESLL-SDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSS-----QVMER  754
            S RKSLSESLL  D NS+  N+SLR+QF ++EE +  +++ K S+DESS      Q  + 
Sbjct  442  SERKSLSESLLVQDSNSLPTNISLRRQFDHDEECNADVRIDKHSEDESSFPRNSLQAADH  501

Query  753  GTRQLD--SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG  580
             T Q D  + +    +KT  EE  ++  S N    K  G GN  L+SDD  F E+     
Sbjct  502  KTNQNDPRNHMSRSGAKTNMEEQVSVSRSSN---QKNLGFGNPVLESDDVSFPENSKSGS  558

Query  579  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  400
            +SA   ++  YE K+ +L+RK G+LEGQLA ALASREA++KSL+SA KS+Q+ E+KLAD 
Sbjct  559  LSAASDIHHYYETKVASLMRKFGILEGQLAVALASREASEKSLASAFKSRQEMERKLADT  618

Query  399  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  220
            +KE++LL+EKL   EL QEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L
Sbjct  619  LKEMELLREKLVSAELVQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVL  678

Query  219  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
              ER RAFQLQVEVFHLKQRLQS+E RAPTPRKPF V
Sbjct  679  AAERTRAFQLQVEVFHLKQRLQSMEKRAPTPRKPFQV  715



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 178/267 (67%), Gaps = 55/267 (21%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSLSESLL DPNS +GNVS RK F+++EE +                 +  + LD  
Sbjct  451  SGRKSLSESLLVDPNSASGNVSRRKDFHHKEENT--------------TAAKTAKNLD--  494

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  550
                                          GNF           SDC  G  A   +Y+ 
Sbjct  495  ------------------------------GNFA--------SLSDCTTG-GARASIYRL  515

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            YE K+ AL RKN +LEGQLAAA   REAA+K++SSALKS+Q+ EKKL D ++E++LLKEK
Sbjct  516  YETKIAALTRKNRVLEGQLAAAFIGREAAEKNVSSALKSRQEMEKKLVDTVREMELLKEK  575

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            LA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERARAFQL
Sbjct  576  LACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERARAFQL  635

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            Q+EVFHLKQRLQS+ENR PTPRKPFHV
Sbjct  636  QIEVFHLKQRLQSMENRTPTPRKPFHV  662



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 203/288 (70%), Gaps = 25/288 (9%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE----SSSQVMERGT  748
            S RKSL++S + D +SV+G++SLRKQF  EE+ SL  +M KS +++        +    +
Sbjct  444  SCRKSLADSSI-DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPS  502

Query  747  RQLDSGLEHIDSK--------------TIPEEICTIPESGNMATHKKQGSGNFPLDSDDF  610
             Q+++ +E    K              +I E +C   ES N+  ++K G+ N   DS+  
Sbjct  503  SQVNNAIEQKSKKQETVVQMDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHI  559

Query  609  VFQESDCKFGISA-PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalks  433
               E+    G+   P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS
Sbjct  560  APPETASSSGLLVQPSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKS  619

Query  432  KQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDT  253
             QD +K+LA+AMKE++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDT
Sbjct  620  GQDMDKELANAMKEVELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDT  679

Query  252  QKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QKELHSTRG+L GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  680  QKELHSTRGVLAGERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  727



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   231 bits (590),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 161/288 (56%), Positives = 203/288 (70%), Gaps = 25/288 (9%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDE----SSSQVMERGT  748
            S RKSL++S + D +SV+G++SLRKQF  EE+ SL  +M KS +++        +    +
Sbjct  450  SCRKSLADSSI-DLHSVSGSISLRKQFRAEEDYSLALRMQKSPEEDRYKVGDDCLSSNPS  508

Query  747  RQLDSGLEHIDSK--------------TIPEEICTIPESGNMATHKKQGSGNFPLDSDDF  610
             Q+++ +E    K              +I E +C   ES N+  ++K G+ N   DS+  
Sbjct  509  SQVNNAIEQKSKKQETVVQMDIAGIVASIEENLCD-SESSNL--YQKPGNNNLMADSNHI  565

Query  609  VFQESDCKFGISA-PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalks  433
               E+    G+   P  + Q YE K+  L RKN LLE QL+AALAS+EAA+K LSSA+KS
Sbjct  566  APPETASSSGLLVQPSNICQLYETKIYTLTRKNVLLEEQLSAALASQEAAEKKLSSAIKS  625

Query  432  KQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDT  253
             QD +K+LA+AMKE++LLKEKLAG+ELAQEEAN LSN+VHSDNVRLEHDVAFLKAVLDDT
Sbjct  626  GQDMDKELANAMKEVELLKEKLAGMELAQEEANGLSNMVHSDNVRLEHDVAFLKAVLDDT  685

Query  252  QKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QKELHSTRG+L GERARAFQLQVE FHLKQRLQS+ENRAPTPRKPFH 
Sbjct  686  QKELHSTRGVLAGERARAFQLQVEAFHLKQRLQSMENRAPTPRKPFHT  733



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 201/273 (74%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLL-SDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESS-SQVMERGTRQ  742
            S RKSLSESLL  D  S+  N+SL  QF +EE  ++  ++ K S+DESS  Q  +  T Q
Sbjct  440  SERKSLSESLLVEDSGSLPTNISLHSQFDHEEAFNVHDRIGKHSEDESSFPQAADGRTNQ  499

Query  741  LDSG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
             D G  +    +KT  E+   +  SG+ +  K  G GN  L+SD   F E+     +S  
Sbjct  500  NDPGHQMNTRGAKTNIEQPVLV--SGD-SLQKNLGFGNSLLESDHESFPENSKSGSLSTA  556

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +Y  YE K+++L+RK G+LE QL AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI
Sbjct  557  SNIYDYYETKVSSLIRKFGILEAQLLAAIASKEASEKNLASAFKSRQEMDNKLTDTLKEI  616

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LL+EKLAG ELAQE+A++LSNIVHSDNVRLEHDVAFLKA+LDDTQKELHSTRG+L GER
Sbjct  617  ELLREKLAGAELAQEDASNLSNIVHSDNVRLEHDVAFLKAILDDTQKELHSTRGVLAGER  676

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ARAFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  677  ARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  709



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score =   228 bits (580),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 196/272 (72%), Gaps = 18/272 (7%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQL  739
            SGR+SLSE   +D  N  +GNVSLRKQF  EEE    ++ P  S +E      E+ T + 
Sbjct  442  SGRRSLSEIAFADHRNPSSGNVSLRKQFSTEEEYRAVIEPPAKSLEE------EKITDED  495

Query  738  DSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPI  565
              G   I ++       T+    +   HK   S +FP     D  +F E D      +  
Sbjct  496  SGGGAKITAEK------TLSTVSDRELHKPP-SESFPFAHIDDALIFPEMDNATLAPSSS  548

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+T+KKL+DA++++D
Sbjct  549  SVYQFHEAKMTALIRRNGVLEGQLEAALAGREAAERNVSVALRSKQETDKKLSDALRDVD  608

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
            LLKEKL G+EL+Q+EANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERA
Sbjct  609  LLKEKLTGLELSQDEANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERA  668

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RAFQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  669  RAFQLQVEVFHLKQRLQSLENRAATPRKPFHV  700



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 160/276 (58%), Positives = 205/276 (74%), Gaps = 11/276 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGR+SLSESL+ DPN    N SLRKQF ++EE  T LKM K+SD+ S  + ++  T + D
Sbjct  441  SGRRSLSESLVVDPNFPPTNTSLRKQFDHDEEYNTDLKMDKNSDERSFPRAVDHRTNKDD  500

Query  735  SG--LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQES---DCKFGISA  571
             G  +   + KT  EE  T+  SG +         + P +SD+ +F E+   +   G   
Sbjct  501  HGKQMNTSEVKTNMEEQQTLL-SGILNQQNLVFENDMP-ESDNLLFSENINININSGSLT  558

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
               +Y  YE+KL +L+RKNG+LEGQLAA++AS+EAA+KSL+S LKS+Q+ ++KL ++ KE
Sbjct  559  TSNVYYYYESKLASLIRKNGILEGQLAASIASKEAAEKSLTSVLKSRQEMDRKLTESEKE  618

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            ++L++EKLAG+ELAQEE N+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GE
Sbjct  619  MELMREKLAGLELAQEETNNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGE  678

Query  210  RARAFQLQVEVFHLKQRLQSLE-NRA-PTPRKPFHV  109
            RARAFQLQ EVFHLKQRLQS+E NRA  TPRKPFHV
Sbjct  679  RARAFQLQYEVFHLKQRLQSMEKNRASTTPRKPFHV  714



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 187/270 (69%), Gaps = 41/270 (15%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNS-VTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDS  733
            SGR+SLSE   +D ++  +GNVSLRKQF  EEE                           
Sbjct  443  SGRRSLSEITFADYHAPSSGNVSLRKQFSTEEEY--------------------------  476

Query  732  GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLD--SDDFVFQESDCKFGISAPIGL  559
                         + T+    +   H KQ S +FP     D  +F E D    +++   +
Sbjct  477  -----------RAVKTLSTVSDRELH-KQTSESFPFAHIDDALIFPEMDNAATLASSSSV  524

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
            YQ +EAK+TAL+R+NG+LEGQL AALA REAA++++S AL+SKQ+++KKL+DA+++++LL
Sbjct  525  YQFHEAKMTALIRRNGILEGQLEAALAGREAAERNVSVALRSKQESDKKLSDALRDVELL  584

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            KEKL G+ELAQ+EANSLSN+VHSDNVRLEHDVAFL+AVLDDTQKEL STRG+L GERARA
Sbjct  585  KEKLTGLELAQDEANSLSNMVHSDNVRLEHDVAFLRAVLDDTQKELQSTRGVLAGERARA  644

Query  198  FQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            FQLQVEVFHLKQRLQSLENRA TPRKPFHV
Sbjct  645  FQLQVEVFHLKQRLQSLENRAATPRKPFHV  674



>ref|XP_004486293.1| PREDICTED: uncharacterized protein LOC101494304 [Cicer arietinum]
Length=201

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -1

Query  669  NMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqla  490
            +++  K  G GN  L+SD   F E+     +S    +Y  YE K+++L+RK G+LE QL 
Sbjct  15   DISLQKNLGFGNSLLESDHESFPENSKSGSLSTASNIYDYYETKVSSLIRKFGILEAQLL  74

Query  489  aalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHS  310
            AA+AS+EA++K+L+SA KS+Q+ + KL D +KEI+LL+EKLAG ELAQE+A++LSNIVHS
Sbjct  75   AAIASKEASEKNLASAFKSRQEMDNKLTDTLKEIELLREKLAGAELAQEDASNLSNIVHS  134

Query  309  DNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPT  130
            DNVRLEHDVAFLKA+LDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPT
Sbjct  135  DNVRLEHDVAFLKAILDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPT  194

Query  129  PRKPFHV  109
            PRKPFHV
Sbjct  195  PRKPFHV  201



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score =   218 bits (554),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 199/273 (73%), Gaps = 9/273 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESS-SQVMERGTRQ  742
            S RKSLSESLL +  +S+  N+SLR+QF ++E     +++ K S+D+SS ++  +  T Q
Sbjct  441  SERKSLSESLLVEYSDSLPTNISLRRQFDHDEGYNADVRIGKHSEDKSSLTRAADHRTNQ  500

Query  741  LD--SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
             D  + +    +KT  EE   +  S N    +  G GN  L+SDD  F ++     +S  
Sbjct  501  NDPRNHMSRNGAKTNMEEQVLVSGSSN---QQNLGFGNPLLESDDVSFPDNSKLGSLSTD  557

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE+
Sbjct  558  SNIHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEM  617

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER
Sbjct  618  ELLREKLVNAELAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAER  677

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
             RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  678  TRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  710



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score =   217 bits (552),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 198/271 (73%), Gaps = 17/271 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLSES+  DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D
Sbjct  453  SGRKSLSESV--DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNEND  510

Query  735  S-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGL  559
               L +I    +  E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +
Sbjct  511  RRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNI  567

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
            YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL
Sbjct  568  YQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELL  627

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            +EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARA
Sbjct  628  REKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARA  687

Query  198  FQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            FQL        QRLQS+ENR + TPRKPFHV
Sbjct  688  FQL--------QRLQSMENRTSTTPRKPFHV  710



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score =   217 bits (552),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 198/271 (73%), Gaps = 17/271 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS--LKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLSES+  DPN    NVSLRKQF  +EE +  +KM K+SD  S  QV +  T + D
Sbjct  477  SGRKSLSESV--DPNYPPSNVSLRKQFDRDEEYNADVKMDKNSDGSSLPQVADHRTNEND  534

Query  735  S-GLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGL  559
               L +I    +  E   +  SG M+  + Q   +  L+S+   F E+D K G  +   +
Sbjct  535  RRKLMNISGAKVNIE-GQVLLSG-MSNQQNQVFESDALESEVVSFPEND-KSGSLSSTNI  591

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
            YQ YE+K+ AL+RKNG+LEGQLAA++ASREAA+K LSS  KS+Q+ EKKLADA+KE++LL
Sbjct  592  YQYYESKVAALIRKNGMLEGQLAASMASREAAEKGLSSVHKSRQEMEKKLADALKEMELL  651

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            +EKLAG+ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++ GERARA
Sbjct  652  REKLAGLELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVIAGERARA  711

Query  198  FQLQVEVFHLKQRLQSLENR-APTPRKPFHV  109
            FQL        QRLQS+ENR + TPRKPFHV
Sbjct  712  FQL--------QRLQSMENRTSTTPRKPFHV  734



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  582  GISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLAD  403
             +SAP  +YQ Y+ ++ +L RKNG+LE QLA A ASR+ A+++L+SALKSK++ EKK AD
Sbjct  449  ALSAPTSIYQFYDTRMASLSRKNGILEVQLATAFASRDTAERTLASALKSKEEMEKKFAD  508

Query  402  AMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGL  223
            AMKE++LLKEKLAG+ELA EEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+
Sbjct  509  AMKEMELLKEKLAGIELAHEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGV  568

Query  222  LGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct  569  LAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFNV  606



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 180/246 (73%), Gaps = 6/246 (2%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLS+SLL DPNS +GNVS  K F+++EE  T+ K+ K+ D   +S   E      D
Sbjct  451  SGRKSLSQSLLVDPNSASGNVSRHKDFHHKEENTTAGKIAKNLDGNFASLATELQRNHSD  510

Query  735  SGLEHID--SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
              ++  +   K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   
Sbjct  511  VSVQPSNPVGKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHAS  568

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  201  AFQLQV  184
            AFQLQ+
Sbjct  689  AFQLQL  694



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 179/246 (73%), Gaps = 6/246 (2%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLS+SLL DPNS +GNVS  K F+++EE  T+ K  K+ D   +S   E      D
Sbjct  451  SGRKSLSQSLLVDPNSASGNVSRHKDFHHKEENTTAAKTAKNLDGNFASLATELQRNHSD  510

Query  735  SGLEHID--SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
              ++  +   K   EE+  + E     +HK QG+GN  +D++D +  ESDC  G  A   
Sbjct  511  VSVQPSNPVGKIHAEEMSCVFEMETSNSHK-QGTGNLSIDNEDVLLPESDCTTG-GAHAS  568

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +Y+ YE K+ AL RKN +LEGQLAAA   REAA+K++SSA+KS+Q+ EKKL D ++E++L
Sbjct  569  IYRLYETKIAALTRKNAVLEGQLAAAFIGREAAEKNVSSAMKSRQEMEKKLVDTVREMEL  628

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            LKEKLA VELAQEEANSLSNIVHSDN+RLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  629  LKEKLACVELAQEEANSLSNIVHSDNLRLEHDVAFLKAVLDDTQKELHSTRGVLSGERAR  688

Query  201  AFQLQV  184
            AFQLQ+
Sbjct  689  AFQLQL  694



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 152/273 (56%), Positives = 196/273 (72%), Gaps = 20/273 (7%)
 Frame = -1

Query  909  SGRKSLSESLLSD-PNSVTGNVSLRKQFYNEE--ETSLKMPKSSDDESS-SQVMERGTRQ  742
            S RKSLSESLL +  +S+  N+SLR+QF ++E     +++ K S+D+SS ++  +  T Q
Sbjct  441  SERKSLSESLLVEYSDSLPTNISLRRQFDHDEGYNADVRIGKHSEDKSSLTRAADHRTNQ  500

Query  741  LD--SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
             D  + +    +KT            NM   +  G GN  L+SDD  F ++     +S  
Sbjct  501  NDPRNHMSRNGAKT------------NM--EQNLGFGNPLLESDDVSFPDNSKLGSLSTD  546

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              ++  YE K+ +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE+
Sbjct  547  SNIHHYYETKVASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEM  606

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGER  208
            +LL+EKL   ELAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER
Sbjct  607  ELLREKLVNAELAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAER  666

Query  207  ARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
             RA QLQVEVFHLKQRLQS+ENR PTPRKPF V
Sbjct  667  TRALQLQVEVFHLKQRLQSMENRVPTPRKPFQV  699



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score =   208 bits (530),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 191/271 (70%), Gaps = 17/271 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESS-SQVMERGTRQL  739
            S RKSLSESL            +  QF ++EE +   ++ +  +DESS  Q  ++ T Q 
Sbjct  441  SERKSLSESLF-----------VHSQFDHDEEFNEDDRIDRHLEDESSFPQAADQRTNQN  489

Query  738  DSGLE-HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG  562
            D G + H     I  E   +  SG+ +  K  G GN  ++SD     E+     +S    
Sbjct  490  DPGHQMHTRGAKINMEE-QVLASGD-SFRKNLGFGNPVVESDHGSLPENINSGSLSTASN  547

Query  561  LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDL  382
            +Y  YE K+++L+ K G+LE QLAA+LAS+EAA+K+L+SA KSKQ+ +K +AD ++EI+L
Sbjct  548  IYNYYETKVSSLITKFGILEAQLAASLASKEAAEKNLASAFKSKQEMDKTMADTLQEIEL  607

Query  381  LKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERAR  202
            L+EKL G ELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L GERAR
Sbjct  608  LREKLVGAELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERAR  667

Query  201  AFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            AFQLQVEVFHLKQRLQS+ENRAPTPRKPFHV
Sbjct  668  AFQLQVEVFHLKQRLQSMENRAPTPRKPFHV  698



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -1

Query  600  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  421
            E+D +  ++ P  +YQ YE K+ +L RKN LLE QL AAL  REAA+K+LSSA+KSKQ+ 
Sbjct  542  ETDGRSVLTNPSNIYQLYETKIASLTRKNVLLEEQLKAALTCREAAEKNLSSAVKSKQEV  601

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            E KLAD +KE++LLKEKLAGVELAQEEANSLSNIVHS NVRLEHDVAFLKA+LDDTQKEL
Sbjct  602  ETKLADTVKEVELLKEKLAGVELAQEEANSLSNIVHSHNVRLEHDVAFLKAILDDTQKEL  661

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV*SSIL  94
            +STRG+L GERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  + + +L
Sbjct  662  YSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPIQICNDVL  710



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 185/275 (67%), Gaps = 15/275 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE----TSLKMPKSSDDESSSQVMERGT--  748
            S RKSLSESL+ DPN +  N+    QF ++EE    T  KM K+S + S  Q        
Sbjct  422  SRRKSLSESLVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKESSLPQAAVETNAI  481

Query  747  --RQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  574
               Q++ G   ID   + E+   + E   +   + Q S +  L+SD  +F E + K G  
Sbjct  482  HGNQMNIGEAKID---MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSF  534

Query  573  APIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMK  394
                +Y  YE+++TAL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +K
Sbjct  535  FNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLK  594

Query  393  EIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGG  214
            E+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  
Sbjct  595  EMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVAR  654

Query  213  ERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  655  ERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  689



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score =   207 bits (526),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 185/275 (67%), Gaps = 15/275 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE----TSLKMPKSSDDESSSQVMERGT--  748
            S RKSLSESL+ DPN +  N+    QF ++EE    T  KM K+S + S  Q        
Sbjct  448  SRRKSLSESLVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKESSLPQAAVETNAI  507

Query  747  --RQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  574
               Q++ G   ID   + E+   + E   +   + Q S +  L+SD  +F E + K G  
Sbjct  508  HGNQMNIGEAKID---MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSF  560

Query  573  APIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMK  394
                +Y  YE+++TAL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +K
Sbjct  561  FNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLK  620

Query  393  EIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGG  214
            E+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  
Sbjct  621  EMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVAR  680

Query  213  ERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  681  ERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  715



>gb|KHN47303.1| hypothetical protein glysoja_020171 [Glycine soja]
Length=261

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 156/202 (77%), Gaps = 3/202 (1%)
 Frame = -1

Query  714  SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKL  535
            +KT  EE   +  S N    +  G GN  L+SDD  F ++     +S    ++  YE K+
Sbjct  63   AKTNMEEQVLVSGSSN---QQNLGFGNPLLESDDVSFPDNSKLGSLSTDSNIHHYYETKV  119

Query  534  TALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVE  355
             +L+RK G+LEGQL+AALASREAA+KSL+SA KS+Q+ E+KLAD +KE++LL+EKL   E
Sbjct  120  ASLMRKFGILEGQLSAALASREAAEKSLASAFKSRQEMERKLADTLKEMELLREKLVNAE  179

Query  354  LAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVF  175
            LAQEEAN+LSN+VH+DNVRLEHDVAFLKAVLDDTQKELHSTRG+L  ER RA QLQVEVF
Sbjct  180  LAQEEANNLSNMVHADNVRLEHDVAFLKAVLDDTQKELHSTRGVLAAERTRALQLQVEVF  239

Query  174  HLKQRLQSLENRAPTPRKPFHV  109
            HLKQRLQS+ENR PTPRKPF V
Sbjct  240  HLKQRLQSMENRVPTPRKPFQV  261



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score =   206 bits (523),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 168/226 (74%), Gaps = 6/226 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSSQVMERGTRQLD  736
            SGR SLSES L DPNSVT N+SLRKQF+NEEE  T++KM K+ D+ S SQ  E    Q D
Sbjct  444  SGRLSLSESSLIDPNSVTSNISLRKQFHNEEEYNTAIKMAKAEDESSFSQAAEHKISQSD  503

Query  735  SGLEH--IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFG-ISAPI  565
            SG     +  K   E++  + E  N+  H  QGS N P+DS D VF  +D K G + AP 
Sbjct  504  SGTRTSTVGGKLCTEDMVAVYEPENLNPHN-QGSANLPVDSSDSVFPVNDIKLGSVPAPS  562

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             + Q YE K+T L+RKN +LEGQLAAA ASREA +K+LSSALKSKQ+ EKKLA+ MK ++
Sbjct  563  SVSQFYETKITQLIRKNAILEGQLAAAFASREAVEKNLSSALKSKQEMEKKLAEMMKGME  622

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
            LLKEKLAGVELAQEEAN+LSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  623  LLKEKLAGVELAQEEANNLSNIVHSDNVRLEHDVAFLKAVLDDTQK  668



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score =   207 bits (526),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 185/275 (67%), Gaps = 15/275 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE----TSLKMPKSSDDESSSQVMERGT--  748
            S RKSLSESL+ DPN +  N+    QF ++EE    T  KM K+S + S  Q        
Sbjct  514  SRRKSLSESLVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKESSLPQAAVETNAI  573

Query  747  --RQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGIS  574
               Q++ G   ID   + E+   + E   +   + Q S +  L+SD  +F E + K G  
Sbjct  574  HGNQMNIGEAKID---MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSF  626

Query  573  APIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMK  394
                +Y  YE+++TAL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +K
Sbjct  627  FNTNIYHYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLK  686

Query  393  EIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGG  214
            E+++++EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  
Sbjct  687  EMEVMREKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVAR  746

Query  213  ERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            ER RAFQLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  747  ERGRAFQLQCEAFHLNQRLQSMENQASTPRKPFHV  781



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score =   206 bits (525),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 181/269 (67%), Gaps = 9/269 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTR--QLD  736
            S RKSLSESL+ DPN +  N+    QF ++EE +       D  S + V        Q++
Sbjct  514  SRRKSLSESLVVDPNCLRSNIFFCNQFDHDEEYNYNTYTKMDKNSKAAVETNAIHGNQMN  573

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
             G   ID   + E+   + E   +   + Q S +  L+SD  +F E + K G      +Y
Sbjct  574  IGEAKID---MEEQQMLVSE---ILNQQNQISESNTLESDSELFPE-NSKAGSFFNTNIY  626

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
              YE+++TAL +KN +LE QL A+LAS + A K+L S L+S+Q+ E+KL+D +KE+++++
Sbjct  627  HYYESEVTALTKKNTILEAQLVASLASEDTATKNLESILRSRQEIEEKLSDTLKEMEVMR  686

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EKLA +EL QEE N+LSN+VHSDNVRLEHDVAFLKAVLDDTQKELHSTRG++  ER RAF
Sbjct  687  EKLASLELTQEEVNNLSNVVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVVARERGRAF  746

Query  195  QLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            QLQ E FHL QRLQS+EN+A TPRKPFHV
Sbjct  747  QLQCEAFHLNQRLQSMENQASTPRKPFHV  775



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score =   206 bits (524),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 184/289 (64%), Gaps = 27/289 (9%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKSLS+    DP  V+ ++S RK F+ +++  L  K+ +  +DE  +   +       
Sbjct  450  SGRKSLSD----DP-CVSTDISCRKLFHQDQDFGLATKVQRPLEDEKYTNDGQLMLNNPS  504

Query  735  SGLEHIDSKT---------IPEEICTIP--------ESGNMATHKKQGSGNFPLDSDD--  613
            S   H+ S           I  ++  I         ESG    H K G G   L +D   
Sbjct  505  SKKMHVFSNCQRSKRQQPEIKMDVAGIQDSMEKMHVESGGTTVHHKHGIGISSLTADAEH  564

Query  612  -FVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalk  436
             F          ++ P  +YQ YE K  +L RKN LLE QL AA  SRE A+++LS  ++
Sbjct  565  LFPLGVDGGGLVLTNPTDVYQVYETKTASLTRKNVLLEEQLKAATTSREIAERNLSCTVE  624

Query  435  sKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDD  256
             KQD E+KLADA++E++LLK+K+AG+E+AQEEAN LSNI HSDNVRLEHDVAFLKA+L+D
Sbjct  625  RKQDRERKLADALREVELLKDKVAGMEVAQEEANGLSNIGHSDNVRLEHDVAFLKAILED  684

Query  255  TQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            TQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS ++RAPTPRKPF +
Sbjct  685  TQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSGDHRAPTPRKPFQM  733



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score =   203 bits (517),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  654  KKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalas  475
            K  G GN  ++SD     E+     +S    +Y  YE K+++L+ K G+LE QLAA+LAS
Sbjct  582  KNLGFGNPVVESDHGSLPENINSGSLSTASNIYNYYETKVSSLITKFGILEAQLAASLAS  641

Query  474  reaadkslssalksKQDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRL  295
            +EAA+K+L+SA KSKQ+ +K +AD ++EI+LL+EKL G ELAQEEAN+LSNIVHSDNVRL
Sbjct  642  KEAAEKNLASAFKSKQEMDKTMADTLQEIELLREKLVGAELAQEEANNLSNIVHSDNVRL  701

Query  294  EHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPF  115
            EHDVAFLKAVLDDTQKELHSTRG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF
Sbjct  702  EHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPF  761

Query  114  HV  109
            HV
Sbjct  762  HV  763



>gb|KDO75103.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=342

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 168/227 (74%), Gaps = 9/227 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSE  L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q  E    Q 
Sbjct  96   SGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQS  155

Query  738  DSGLEH---IDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAP  568
            D G +    +    I E      E+ N      QG GNF +D+D+ +F ++D    +S P
Sbjct  156  DLGAQTSICVGKTNIDEAPLFDYENSNPLV---QGIGNFHVDNDNVIFPDNDKSGALSGP  212

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE+K+ AL+RKNG+LEGQLAAAL +REAA+K+ SS LKS+Q+ EKKLAD++KE+
Sbjct  213  SSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEM  272

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
            +LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK
Sbjct  273  ELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  319



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score =   197 bits (502),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 175/236 (74%), Gaps = 8/236 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGR+SLSE    D N ++GN SLRKQF+NEEE  T+ K+ K  +DESS  Q  E    Q 
Sbjct  446  SGRRSLSELSFVDQNPLSGNFSLRKQFHNEEEYNTTFKITKCLEDESSIVQATEPKPNQS  505

Query  738  DSGLE--HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAP  568
            D+ ++     +K   +E       G++   + +G  N P+D+D+FVF E+D K   +SAP
Sbjct  506  DTSIQINAPGTKISSDESFLFEPEGSIP--QIEGIANVPVDNDNFVFPEADGKSAALSAP  563

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE ++ AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE+
Sbjct  564  SSIYQFYETRMAALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKEM  623

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  220
            +LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRG+L
Sbjct  624  ELLKEKLAGIELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVL  679



>gb|ERN16928.1| hypothetical protein AMTR_s00057p00182130 [Amborella trichopoda]
Length=692

 Score =   197 bits (502),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 197/281 (70%), Gaps = 18/281 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDE---------SSSQVM  760
            SGR+S SES  ++ ++V+GNVSLRKQ + E+  S L++ ++  D          + +  +
Sbjct  416  SGRRSQSESNSTNIDTVSGNVSLRKQHHEEDHNSVLQIQRNHTDTVYGEPDDLITRTATL  475

Query  759  ERGTRQLDSGLEHID----SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESD  592
             +  + LD G++ +D    +     E+  I E  N    K   +GN   D+ D      D
Sbjct  476  SQKNKSLDQGVQ-VDIARAASNSEAEMLGILEPENPRNLKI--TGNLQSDNGDSS-NILD  531

Query  591  CKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKK  412
                + AP   +Q YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKK
Sbjct  532  IDGKVIAPANSHQEYEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKK  591

Query  411  LADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHST  232
            L++++KE+++L EKLA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL ST
Sbjct  592  LSESLKEMEVLSEKLAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQST  651

Query  231  RGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  652  RGVLAGERARAFQLQVEVFHLKQRLQSVENRAPTPRKPYHI  692



>ref|XP_006855461.2| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X1 [Amborella trichopoda]
Length=728

 Score =   197 bits (501),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 197/281 (70%), Gaps = 18/281 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDE---------SSSQVM  760
            SGR+S SES  ++ ++V+GNVSLRKQ + E+  S L++ ++  D          + +  +
Sbjct  452  SGRRSQSESNSTNIDTVSGNVSLRKQHHEEDHNSVLQIQRNHTDTVYGEPDDLITRTATL  511

Query  759  ERGTRQLDSGLEHID----SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESD  592
             +  + LD G++ +D    +     E+  I E  N    K   +GN   D+ D      D
Sbjct  512  SQKNKSLDQGVQ-VDIARAASNSEAEMLGILEPENPRNLKI--TGNLQSDNGDSS-NILD  567

Query  591  CKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKK  412
                + AP   +Q YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKK
Sbjct  568  IDGKVIAPANSHQEYEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKK  627

Query  411  LADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHST  232
            L++++KE+++L EKLA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL ST
Sbjct  628  LSESLKEMEVLSEKLAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQST  687

Query  231  RGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RG+L GERARAFQLQVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  688  RGVLAGERARAFQLQVEVFHLKQRLQSVENRAPTPRKPYHI  728



>ref|XP_011627422.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Amborella trichopoda]
Length=721

 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 195/274 (71%), Gaps = 11/274 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS-LKMPKSSDDESSSQVMERGTRQ--L  739
            SGR+S SES  ++ ++V+GNVSLRKQ + E+  S L++ ++  D    +  +  TR   L
Sbjct  452  SGRRSQSESNSTNIDTVSGNVSLRKQHHEEDHNSVLQIQRNHTDTVYGEPDDLITRTATL  511

Query  738  DSGLEHID----SKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISA  571
              G++ +D    +     E+  I E  N    K   +GN   D+ D      D    + A
Sbjct  512  SQGVQ-VDIARAASNSEAEMLGILEPENPRNLKI--TGNLQSDNGDSS-NILDIDGKVIA  567

Query  570  PIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
            P   +Q YE K+ AL +KNG+LEGQL+AALA REA  K+LS+ LKS+QD EKKL++++KE
Sbjct  568  PANSHQEYEIKVAALQKKNGVLEGQLSAALAGREAIAKNLSAVLKSRQDIEKKLSESLKE  627

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            +++L EKLA  ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL STRG+L GE
Sbjct  628  MEVLSEKLAAAELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELQSTRGVLAGE  687

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKPFHV  109
            RARAFQLQVEVFHLKQRLQS+ENRAPTPRKP+H+
Sbjct  688  RARAFQLQVEVFHLKQRLQSVENRAPTPRKPYHI  721



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 167/229 (73%), Gaps = 8/229 (3%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGR+SLSE    D N ++GN SLRKQF+NEEE  T+ K+ K  +DESS  Q  E    Q 
Sbjct  451  SGRRSLSELSFVDQNPLSGNFSLRKQFHNEEEYNTTFKITKCLEDESSIVQATEPKPNQS  510

Query  738  DSGLE--HIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK-FGISAP  568
            D+ ++     +K   +E       G++   + +G  N P+D+D+FVF E+D K   +SAP
Sbjct  511  DTSIQINAPGTKISSDESFLFEPEGSIP--QIEGIANVPVDNDNFVFPEADGKSAALSAP  568

Query  567  IGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEI  388
              +YQ YE ++ AL RKNG+LE QLAAALASR+ ++++L+SALKSK++ EK+ AD MKE+
Sbjct  569  SSIYQFYETRMAALSRKNGILEVQLAAALASRDTSERNLASALKSKEEMEKRFADTMKEM  628

Query  387  DLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            +LLKEKLAG+ELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  629  ELLKEKLAGIELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKVL  677



>ref|NP_001068393.1| Os11g0657000 [Oryza sativa Japonica Group]
 dbj|BAF28756.1| Os11g0657000, partial [Oryza sativa Japonica Group]
Length=530

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 170/267 (64%), Gaps = 36/267 (13%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSL +SLL  PN   G+ SLR+QF  EEE SL        +           +L S 
Sbjct  294  SGRKSLPDSLLQQPN--LGSSSLRRQFRQEEECSLAHKLQKPIDDDRYKDVDDCSELPS-  350

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPIGL  559
                                   T++KQ        +D +   ++D K    G S+   +
Sbjct  351  ----------------------VTNQKQ-------RNDIYQSPDADAKAKRVGRSSS-DI  380

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
               Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ L
Sbjct  381  NHQYDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETL  440

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARA  199
            KEK+ G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RA
Sbjct  441  KEKVTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRA  500

Query  198  FQLQVEVFHLKQRLQSLENRAPTPRKP  118
            FQLQVEVFHLKQRLQ++E R+PTPRKP
Sbjct  501  FQLQVEVFHLKQRLQTMEGRSPTPRKP  527



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score =   178 bits (451),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 169/269 (63%), Gaps = 40/269 (15%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKSL +S+L   N   GN SLR+QF  EEE SL  K+ K  DD+    V         
Sbjct  446  SGRKSLPDSMLQHSN--LGNSSLRRQFRQEEECSLAQKLQKPIDDDKYKDV---------  494

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPI  565
                        +E   +P  GN             L  D +   ++D K    G S+  
Sbjct  495  ------------DECSELPSIGNQK-----------LRIDAYPSPDADAKAKRLGRSSS-  530

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +   Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++
Sbjct  531  DINHQYDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVE  590

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
             LKEK+ G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERA
Sbjct  591  ALKEKVTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERA  650

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            RAFQLQVEVFHLKQRL +++ R+PTPRKP
Sbjct  651  RAFQLQVEVFHLKQRLPTMDGRSPTPRKP  679



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score =   178 bits (451),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 169/269 (63%), Gaps = 40/269 (15%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKSL +S+L   N   GN SLR+QF  EEE SL  K+ K  DD+    V         
Sbjct  449  SGRKSLPDSMLQHSN--LGNSSLRRQFRQEEECSLAQKLQKPIDDDKYKDV---------  497

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPI  565
                        +E   +P  GN             L  D +   ++D K    G S+  
Sbjct  498  ------------DECSELPSIGNQK-----------LRIDAYPSPDADAKAKRLGRSSS-  533

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +   Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK+D EK+L +  +E++
Sbjct  534  DINHQYDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEDLEKRLVERDREVE  593

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERA  205
             LKEK+ G ELAQEE+N+ +N VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERA
Sbjct  594  ALKEKVTGFELAQEESNNATNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERA  653

Query  204  RAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            RAFQLQVEVFHLKQRL +++ R+PTPRKP
Sbjct  654  RAFQLQVEVFHLKQRLPTMDGRSPTPRKP  682



>gb|EEC68565.1| hypothetical protein OsI_36893 [Oryza sativa Indica Group]
Length=685

 Score =   177 bits (449),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 167/264 (63%), Gaps = 30/264 (11%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSL +SLL  PN   G+ SLR+QF  EEE SL        +           +L S 
Sbjct  449  SGRKSLPDSLLQQPN--LGSSSLRRQFRQEEECSLAHKLQKPIDDDRYKDVDDCSELPS-  505

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  550
               + ++    +I   P++   A    + S +                        +   
Sbjct  506  ---VTNQKQRNDIYQSPDADAKAKRVGRSSSD------------------------INHQ  538

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>gb|EEE52499.1| hypothetical protein OsJ_34700 [Oryza sativa Japonica Group]
Length=685

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 167/264 (63%), Gaps = 30/264 (11%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSL +SLL  PN   G+ SLR+QF  EEE SL        +           +L S 
Sbjct  449  SGRKSLPDSLLQQPN--LGSSSLRRQFRQEEECSLAHKLQKPIDDDRYKDVDDCSELPS-  505

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  550
               + ++    +I   P++   A    + S +                        +   
Sbjct  506  ---VTNQKQRNDIYQSPDADAKAKRVGRSSSD------------------------INHQ  538

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  539  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  598

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER+RAFQL
Sbjct  599  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERSRAFQL  658

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ++E R+PTPRKP
Sbjct  659  QVEVFHLKQRLQTMEGRSPTPRKP  682



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score =   173 bits (438),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 168/240 (70%), Gaps = 18/240 (8%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEET--SLKMPKSSDDE------------SS  772
            SGRKSLS+S + DP+S +GNVSLRKQF++EE+   +LKM KS  D+             S
Sbjct  450  SGRKSLSDSSI-DPHSTSGNVSLRKQFHHEEDYNLALKMQKSPRDDKYKEGGDCLLSNPS  508

Query  771  SQV---MERGTRQLDSGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQ  601
            SQV   ME+ +++ ++ ++   +  +      + +S N   ++KQG+ N   DS+     
Sbjct  509  SQVSNAMEQRSKKHETAIQMDIAGILASTEENLLDSENSNLYQKQGNNNLVSDSNHVAPP  568

Query  600  ESDCKFGISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDT  421
            E D +  ++ P  LYQ YE K+  L RKN LLE QL  AL S+EAA+K+LSSA KS+Q+T
Sbjct  569  EIDNRSVLTNPSNLYQLYETKILTLTRKNVLLEEQLNVALGSQEAAEKNLSSATKSRQET  628

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            EKKLADA+KE++LLKEKLAGVELAQEEANSLSN+VHSDNVRLEHDVAFLKAVLDDTQK L
Sbjct  629  EKKLADAIKEVELLKEKLAGVELAQEEANSLSNMVHSDNVRLEHDVAFLKAVLDDTQKSL  688



>ref|XP_006663087.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Oryza brachyantha]
Length=690

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  544  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  603

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  604  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  663

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  664  QLEVFHLKQRLQTMEGRSPTPRKPLNL  690



>ref|XP_006663088.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Oryza brachyantha]
Length=684

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  538  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  597

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            L G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GER RAFQ 
Sbjct  598  LTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERTRAFQF  657

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFHV  109
            Q+EVFHLKQRLQ++E R+PTPRKP ++
Sbjct  658  QLEVFHLKQRLQTMEGRSPTPRKPLNL  684



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            ++ ++T L+R+N  LE QL+AAL +++ A+K+LS  + SK + EK+LA+  +E++ LKEK
Sbjct  539  HDTRITTLVRRNMALEEQLSAALTTKDEAEKNLSLVIDSKDELEKRLAERDREVEALKEK  598

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            + G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAFQL
Sbjct  599  VTGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAFQL  658

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQR+Q++E R+PTPRKP
Sbjct  659  QVEVFHLKQRVQTMEGRSPTPRKP  682



>ref|XP_008677101.1| PREDICTED: uncharacterized protein LOC100279529 isoform X1 [Zea 
mays]
Length=695

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 163/267 (61%), Gaps = 29/267 (11%)
 Frame = -1

Query  906  GRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS---LKMPKSSDDESSSQVMERGTRQLD  736
            GRK L +SLL   N   G  SLR+QF  EEE S    K+ K  DD+       R     D
Sbjct  451  GRKPLPDSLLRTSN--LGGSSLRRQFRQEEECSSLAQKLQKPIDDD-------RYKDAAD  501

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
               EH           T P+  N A             S + V      +    +   + 
Sbjct  502  ECSEHQPPSA------TNPKPRNDARR----------SSPEVVVDAKARRLLGRSSSDMN  545

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
               +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+
Sbjct  546  NHQDARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALR  605

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EK  G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAF
Sbjct  606  EKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAF  665

Query  195  QLQVEVFHLKQRLQSLENRAP-TPRKP  118
            QLQVEVFHLKQRLQ++E R+P  PRKP
Sbjct  666  QLQVEVFHLKQRLQTMEGRSPAAPRKP  692



>dbj|BAK00043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 165/271 (61%), Gaps = 44/271 (16%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKSL +SLL   NS  G  SLR+QF  EEE SL  K+ K  D+     V         
Sbjct  43   SGRKSLPDSLLH--NSKVGGSSLRRQFRQEEECSLAQKLQKPIDNGKYKDV---------  91

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIG--  562
                        ++   +P      T++KQ        SD +   ++D K   +  +G  
Sbjct  92   ------------DDYSELPS----FTNQKQ-------QSDTYHSPDADAK---ANRVGRN  125

Query  561  ---LYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKE  391
               +   ++ ++  L+R+N  LE +L+AA+ S++ A+K+LS  + +K++ EKKLA+  +E
Sbjct  126  SSDINHQHDTRIANLVRRNMALEEKLSAAMVSKDEAEKNLSLVIDTKEELEKKLAERDRE  185

Query  390  IDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGE  211
            +  LKEK+ G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQKELH TRG+L GE
Sbjct  186  VVALKEKVGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQKELHLTRGVLAGE  245

Query  210  RARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            RARAFQLQVEVFHLKQRLQS++  +   RKP
Sbjct  246  RARAFQLQVEVFHLKQRLQSMDGLSSAQRKP  276



>ref|XP_003575710.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237192.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
 ref|XP_010237193.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Brachypodium distachyon]
Length=693

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y +K+T L+R+N  LE QLAAALAS++ A+K+LS  + S++  EK+LA+  KE +LLKEK
Sbjct  547  YNSKITDLIRRNAALEDQLAAALASKDQAEKNLSLVINSREQLEKRLANKGKEAELLKEK  606

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            ++G+ELAQEE+N++SN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  607  ISGLELAQEESNNISNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  666

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ +E RA TPRKP
Sbjct  667  QVEVFHLKQRLQLVEGRAGTPRKP  690



>ref|XP_006664610.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Oryza brachyantha]
Length=698

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y AK+T L++++  LE QLA ALAS++ A+K+LS  + S++  E++LA+  KE ++LKEK
Sbjct  554  YNAKITDLIKRSSALEDQLATALASKDQAEKNLSLVINSREQLERRLANKDKEAEVLKEK  613

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKELHSTR +L GE++RAFQL
Sbjct  614  IAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKELHSTRRVLAGEQSRAFQL  673

Query  189  QVEVFHLKQRLQSLENRAPTPRKPF  115
            QVEVFHLKQRLQ +E RA TP+ P 
Sbjct  674  QVEVFHLKQRLQMVEGRAGTPKNPL  698



>dbj|BAK00700.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLGAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>dbj|BAJ86800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=690

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            +  K+T L+R+N +LE QL AALAS+E A+KSLS  +  ++  EK+LA   +E +LLKEK
Sbjct  544  HNTKITDLIRRNAVLEDQLRAALASKEQAEKSLSLVMSGREQLEKRLASRGEEAELLKEK  603

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+T+KE+HSTR  L GE++RAFQL
Sbjct  604  IAGLELAQEESNSLSNAVHADNVRLEREVAFLKAVADETRKEMHSTRRALAGEQSRAFQL  663

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  664  QVEVFHLKQRLQTAEGRSLTPRKP  687



>gb|AFW60227.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_572222 [Zea 
mays]
Length=716

 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 163/288 (57%), Gaps = 50/288 (17%)
 Frame = -1

Query  906  GRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS---LKMPKSSDDESSSQVMERGTRQLD  736
            GRK L +SLL   N   G  SLR+QF  EEE S    K+ K  DD+       R     D
Sbjct  451  GRKPLPDSLLRTSN--LGGSSLRRQFRQEEECSSLAQKLQKPIDDD-------RYKDAAD  501

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
               EH           T P+  N A             S + V      +    +   + 
Sbjct  502  ECSEHQPPSA------TNPKPRNDARR----------SSPEVVVDAKARRLLGRSSSDMN  545

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
               +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+
Sbjct  546  NHQDARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALR  605

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EK  G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAF
Sbjct  606  EKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAF  665

Query  195  QL---------------------QVEVFHLKQRLQSLENRAP-TPRKP  118
            QL                     QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  666  QLQVRPYHARLSFFFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  713



>ref|NP_001145999.1| uncharacterized protein LOC100279529 [Zea mays]
 gb|ACL53010.1| unknown [Zea mays]
Length=717

 Score =   149 bits (377),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 163/289 (56%), Gaps = 51/289 (18%)
 Frame = -1

Query  906  GRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS---LKMPKSSDDESSSQVMERGTRQLD  736
            GRK L +SLL   N   G  SLR+QF  EEE S    K+ K  DD+       R     D
Sbjct  451  GRKPLPDSLLRTSN--LGGSSLRRQFRQEEECSSLAQKLQKPIDDD-------RYKDAAD  501

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
               EH           T P+  N A             S + V      +    +   + 
Sbjct  502  ECSEHQPPSA------TNPKPRNDARR----------SSPEVVVDAKARRLLGRSSSDMN  545

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
               +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+
Sbjct  546  NHQDARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALR  605

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EK  G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAF
Sbjct  606  EKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAF  665

Query  195  QL----------------------QVEVFHLKQRLQSLENRAP-TPRKP  118
            QL                      QVEVFHLKQRLQ++E R+P  PRKP
Sbjct  666  QLQVRPYHARLSFFLFFCSCLGLCQVEVFHLKQRLQTMEGRSPAAPRKP  714



>ref|XP_002442260.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
 gb|EES16098.1| hypothetical protein SORBIDRAFT_08g017180 [Sorghum bicolor]
Length=620

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+  L+R+N  LE QL+ ALAS++  +KSLSS + S++  EK LA+  KE ++LKEK
Sbjct  475  YNTKIADLIRRNTTLEDQLSTALASKDQLEKSLSSVIHSREQLEKMLANKDKEAEMLKEK  534

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++RAFQL
Sbjct  535  IACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLAGEQSRAFQL  594

Query  189  QVEVFHLKQRLQSLENRAPTPRK  121
            QVEVFHLKQRLQ LE R+ TP K
Sbjct  595  QVEVFHLKQRLQILEGRSGTPTK  617



>ref|NP_001066944.1| Os12g0538800 [Oryza sativa Japonica Group]
 gb|ABA99338.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29963.1| Os12g0538800 [Oryza sativa Japonica Group]
Length=698

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|EEC69433.1| hypothetical protein OsI_38606 [Oryza sativa Indica Group]
Length=698

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 1/101 (1%)
 Frame = -1

Query  420  EKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKEL  241
            E++LA+  KE ++LKEK+AG+ELAQEE+N+LSN VH+DNVRLE +VAFLKA+ D+TQKEL
Sbjct  597  ERRLANKEKEAEMLKEKIAGLELAQEESNNLSNTVHADNVRLEREVAFLKAITDETQKEL  656

Query  240  HSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            HSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  657  HSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  696



>gb|EMT26901.1| hypothetical protein F775_29769 [Aegilops tauschii]
Length=612

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 170/294 (58%), Gaps = 63/294 (21%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSL +SLL   NS  G  SLR+QF  EEE SL           +Q +++        
Sbjct  349  SGRKSLPDSLLH--NSKVGGSSLRRQFRQEEECSL-----------AQKLQKPIDD----  391

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPIGL  559
                  K    + C+  E  + A  K++        SD +   ++D K    G S+   +
Sbjct  392  -----DKYKDVDDCS--ELPSFANQKQR--------SDTYHSPDADAKTKRVGRSSS-DI  435

Query  558  YQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLL  379
               ++ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + +K++ E++LA+  +E+  L
Sbjct  436  NHQHDTKIANLVRRNMALEEQLSAAMASKDEAEKNLSLVIDTKEELERRLAERDREVVAL  495

Query  378  KEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK----------------  247
            KEK+ G+E A E++N+ SN VH+DNVRLE +VAFLKAV+D+TQK                
Sbjct  496  KEKVGGLEQAHEDSNNASNTVHADNVRLEREVAFLKAVMDETQKAKNNNIPVISNCTSVY  555

Query  246  -----------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
                       ELHSTRG+L GERARAFQLQVEVFHLKQRLQS++ R+PT RKP
Sbjct  556  AVVLTILPPKQELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRSPTQRKP  609



>ref|XP_004962837.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X5 [Setaria italica]
Length=688

 Score =   145 bits (365),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  541  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  600

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  601  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  660

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFH  112
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  661  QVEVFHLKQRLQILEGRSGTPTKQPH  686



>ref|NP_001146281.1| uncharacterized protein LOC100279856 [Zea mays]
 gb|ACL53624.1| unknown [Zea mays]
 gb|ACN34064.1| unknown [Zea mays]
 gb|AFW56517.1| hypothetical protein ZEAMMB73_667685 [Zea mays]
Length=690

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 0/153 (0%)
 Frame = -1

Query  579  ISAPIGLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADA  400
             S+ +G    Y  K+  L+R+N  LE QLA ALAS++  DKSL+S + S+   EK LA+ 
Sbjct  535  CSSDVGQSHLYNTKIADLIRRNTTLEDQLATALASKDQLDKSLASVIHSRGQLEKMLANK  594

Query  399  MKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLL  220
             KE ++LKEK+A +ELAQEE+NSLSN VH+DNVRLE +VAFLKAV  +TQKELHSTR +L
Sbjct  595  DKEAEMLKEKIACLELAQEESNSLSNTVHADNVRLEREVAFLKAVTGETQKELHSTRRVL  654

Query  219  GGERARAFQLQVEVFHLKQRLQSLENRAPTPRK  121
             GE++RAFQLQVEVFHLKQRLQ LE R+ TP K
Sbjct  655  AGEQSRAFQLQVEVFHLKQRLQILEGRSGTPNK  687



>ref|XP_004962833.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Setaria italica]
 ref|XP_004962834.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X2 [Setaria italica]
 ref|XP_004962835.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X3 [Setaria italica]
 ref|XP_004962836.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X4 [Setaria italica]
Length=695

 Score =   144 bits (364),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+  L+R+N +LE QL AALAS++  +KSLSS + S++  EK LA   KE ++LKEK
Sbjct  548  YNTKIADLIRRNAMLEDQLVAALASKDQLEKSLSSVIHSREQLEKMLASKDKEAEILKEK  607

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV D+TQKELHSTR +L GE++R+F L
Sbjct  608  IAGLELAQEESNSLSNTVHADNVRLEREVAFLKAVTDETQKELHSTRRVLVGEQSRSFHL  667

Query  189  QVEVFHLKQRLQSLENRAPTPRKPFH  112
            QVEVFHLKQRLQ LE R+ TP K  H
Sbjct  668  QVEVFHLKQRLQILEGRSGTPTKQPH  693



>gb|EMS52652.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=1002

 Score =   136 bits (343),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 162/290 (56%), Gaps = 67/290 (23%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSL--KMPKSSDDESSSQVMERGTRQLD  736
            SGRKSL +SLL   NS  G  SLR+QF  EEE SL  K+ K  DD+    V         
Sbjct  584  SGRKSLPDSLLH--NSKVGGSSLRRQFRQEEECSLAQKLQKPIDDDKYKDVG--------  633

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCK---FGISAPI  565
                  D   +P          + A  K++        SD +   ++D K    G S+  
Sbjct  634  ------DCSELP----------SFANQKQR--------SDTYHSPDADAKTKRVGRSSS-  668

Query  564  GLYQSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEID  385
             +   ++ K+  L+R+N  LE +L+AA+AS++ A+K+LS  + +K++ EK+LA+  +E+ 
Sbjct  669  DINHQHDTKIANLVRRNMALEEKLSAAMASKDEAEKNLSLVIDTKEELEKRLAERDREVV  728

Query  384  LLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK--------------  247
             LKEK+ G+E A E+ N+ SN VH+DNVRLE +VAFLKAV+D+TQK              
Sbjct  729  ALKEKVGGLEQAHEDLNNASNTVHADNVRLEREVAFLKAVMDETQKAKKIKIPVISHCTS  788

Query  246  -------------ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRA  136
                         E +STRG+L GERARAFQLQVEVFHLKQRLQS++ R 
Sbjct  789  VYAVALTILPPKQEFYSTRGVLAGERARAFQLQVEVFHLKQRLQSMDGRG  838



>gb|AFW60226.1| hypothetical protein ZEAMMB73_572222 [Zea mays]
Length=695

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/250 (45%), Positives = 146/250 (58%), Gaps = 28/250 (11%)
 Frame = -1

Query  906  GRKSLSESLLSDPNSVTGNVSLRKQFYNEEETS---LKMPKSSDDESSSQVMERGTRQLD  736
            GRK L +SLL   N   G  SLR+QF  EEE S    K+ K  DD+       R     D
Sbjct  451  GRKPLPDSLLRTSN--LGGSSLRRQFRQEEECSSLAQKLQKPIDDD-------RYKDAAD  501

Query  735  SGLEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLY  556
               EH           T P+  N A             S + V      +    +   + 
Sbjct  502  ECSEHQPPSA------TNPKPRNDARR----------SSPEVVVDAKARRLLGRSSSDMN  545

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
               +A++ AL+R+N  LE QL+AALAS++ A+K+LS  + SK   EK+LA+  +E++ L+
Sbjct  546  NHQDARVAALVRRNVALEEQLSAALASKDEAEKNLSLVIDSKDGLEKRLAEKDREVEALR  605

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            EK  G+ELAQEEANSLSN VH+DNVRLE +VAFLKAV+D+TQKELHSTRG+L GERARAF
Sbjct  606  EKATGLELAQEEANSLSNTVHADNVRLEREVAFLKAVMDETQKELHSTRGVLAGERARAF  665

Query  195  QLQVEVFHLK  166
            QLQV  +H +
Sbjct  666  QLQVRPYHAR  675



>ref|XP_002977452.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
 gb|EFJ21456.1| hypothetical protein SELMODRAFT_417505 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  429  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  250
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  249  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  151
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>ref|XP_002975032.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
 gb|EFJ23817.1| hypothetical protein SELMODRAFT_415315 [Selaginella moellendorffii]
Length=652

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  429  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  250
            Q  E KL    +E++ L+ KL   EL QEE+NSLSNIVHS+N+RLEHD++FLKAVL++TQ
Sbjct  560  QSAEAKLGLVTREVEGLRRKLEASELVQEESNSLSNIVHSENLRLEHDLSFLKAVLEETQ  619

Query  249  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQS  151
            KELHSTRG+L  ER RAFQLQVE+F LKQ LQS
Sbjct  620  KELHSTRGVLASERTRAFQLQVELFELKQTLQS  652



>gb|EMT25879.1| hypothetical protein F775_10881 [Aegilops tauschii]
Length=758

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+T L+R+N  LE QLAAAL S+E A+K+LS  + S++  EK+LA   KE +LLKEK
Sbjct  631  YNTKITDLIRRNAALEDQLAAALESKEQAEKNLSLVMSSREQLEKRLASRGKEAELLKEK  690

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  691  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  731

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  732  QVEVFHLKQRLQTAEGRSGTPRKP  755



>gb|EMS62709.1| Acyl-CoA-binding domain-containing protein 4 [Triticum urartu]
Length=641

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 19/144 (13%)
 Frame = -1

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y  K+T L+R+N  LE QLAAALAS+E A+K+LS  + S++  EK+LA   K+ +LLKEK
Sbjct  514  YNNKITDLIRRNAALEDQLAAALASKEQAEKNLSLVMSSREQLEKRLASRGKDAELLKEK  573

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAFQL  190
            +AG+ELAQEE+NSLSN VH+DN                   E+HSTR +L GE++R FQL
Sbjct  574  IAGLELAQEESNSLSNAVHADN-------------------EMHSTRRVLAGEQSRTFQL  614

Query  189  QVEVFHLKQRLQSLENRAPTPRKP  118
            QVEVFHLKQRLQ+ E R+ TPRKP
Sbjct  615  QVEVFHLKQRLQTAEGRSVTPRKP  638



>ref|XP_001759823.1| predicted protein [Physcomitrella patens]
 gb|EDQ75327.1| predicted protein [Physcomitrella patens]
Length=1020

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = -1

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            QS+E KL A +R+    EGQL   L  +E A+  L+SAL+++Q TE KLA A+ +   +K
Sbjct  863  QSFEIKLAAAVRRGEQAEGQLTTVLRGKEEAENRLASALQTRQQTESKLAVALTKQAEIK  922

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            E +AG E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ERA++ 
Sbjct  923  EAVAGAERAQEDSNNLCNLVHSENLRLEHDLAFLKAVLEDTQKELDSTREALATERAKSS  982

Query  195  QLQVEVFHLKQRL  157
            QLQ+EVF+L +RL
Sbjct  983  QLQMEVFNLNKRL  995



>ref|XP_001760924.1| predicted protein [Physcomitrella patens]
 gb|EDQ74313.1| predicted protein, partial [Physcomitrella patens]
Length=617

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -1

Query  555  QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
            QS+E KL A +R+  L EGQL+ AL  +E A+KSL  ALK++Q  E KLA ++K    LK
Sbjct  481  QSFEMKLAAAVRRGELAEGQLSTALKGKEEAEKSLQLALKTRQHAEGKLAASLKGQMDLK  540

Query  375  EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
            E++A  E AQE++N+L N+VHS+N+RLEHD+AFLKAVL+DTQ EL STR LL  ER R+F
Sbjct  541  ERVAAAERAQEDSNNLCNVVHSENLRLEHDLAFLKAVLEDTQMELQSTRELLATERTRSF  600

Query  195  QLQVEVFHLKQRLQSL  148
             LQV V HL   L +L
Sbjct  601  NLQVTVDHLPPLLHAL  616



>gb|ABA95166.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
Length=647

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 126/221 (57%), Gaps = 30/221 (14%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSL +SLL  PN   G+ SLR+QF  EEE SL        +           +L S 
Sbjct  455  SGRKSLPDSLLQQPN--LGSSSLRRQFRQEEECSLAHKLQKPIDDDRYKDVDDCSELPS-  511

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  550
               + ++    +I   P++   A    + S +                        +   
Sbjct  512  ---VTNQKQRNDIYQSPDADAKAKRVGRSSSD------------------------INHQ  544

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
            Y+ K+  L+R+N  LE QL+AA+AS++ A+K+LS  + SK++ EK+L++  +E++ LKEK
Sbjct  545  YDTKIANLIRRNMALEEQLSAAMASKDEAEKNLSLVIDSKEELEKRLSEKDREVETLKEK  604

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
            + G+ELAQEE+NSLSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  605  VTGLELAQEESNSLSNTVHADNVRLEREVAFLKAVMDETQK  645



>ref|XP_001751751.1| predicted protein [Physcomitrella patens]
 gb|EDQ83186.1| predicted protein [Physcomitrella patens]
Length=1071

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -1

Query  555   QSYEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLK  376
             QS+E KL A +R+    EGQ+  AL ++E     L+SALK +Q  E +LA A+     LK
Sbjct  915   QSFEMKLAAAVRRAEQAEGQVTTALRAKEEIANRLASALKMRQHAEGQLAAALTAQAELK  974

Query  375   EKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGLLGGERARAF  196
             E +A  E AQE++N+L ++VHS+N+RLEHD+AFLKAVL+DTQKEL STR  L  ER+++F
Sbjct  975   ETVAAAERAQEDSNNLCSVVHSENLRLEHDLAFLKAVLEDTQKELDSTREGLVTERSKSF  1034

Query  195   QLQVEVFHLKQR-LQSLENRAPTP  127
             +LQ+E+F LK++ L SL     TP
Sbjct  1035  KLQMEIFDLKKKTLLSLSEEDATP  1058



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915, partial [Sorghum bicolor]
Length=649

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 126/221 (57%), Gaps = 28/221 (13%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEETSLKMPKSSDDESSSQVMERGTRQLDSG  730
            SGRKSL +SLL   NS  G+ SLR+QF  EE           D S +Q +++        
Sbjct  455  SGRKSLPDSLLQ--NSNLGSSSLRRQFRQEE-----------DCSLAQKLQKPIDDDKYK  501

Query  729  LEHIDSKTIPEEICTIPESGNMATHKKQGSGNFPLDSDDFVFQESDCKFGISAPIGLYQS  550
                 S+              + T   Q   N    S D V  ++  + G S+       
Sbjct  502  DADDCSE--------------LPTIANQKPRNDTRQSPDAVDAKAR-RLGRSSSDINNNH  546

Query  549  YEAKLTALLRKNgllegqlaaalasreaadkslssalksKQDTEKKLADAMKEIDLLKEK  370
             + ++T L+R+N  LE QL+AALAS++ A+K+LS  + SK + EK+LA+  +E++ LKEK
Sbjct  547  QDTRITTLIRRNMALEEQLSAALASKDEAEKNLSLVIDSKDELEKRLAEKDREVEALKEK  606

Query  369  LAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQK  247
              G+ELAQEE+N+LSN VH+DNVRLE +VAFLKAV+D+TQK
Sbjct  607  ATGLELAQEESNNLSNTVHADNVRLEREVAFLKAVMDETQK  647



>ref|XP_001761501.1| predicted protein [Physcomitrella patens]
 gb|EDQ73569.1| predicted protein [Physcomitrella patens]
Length=230

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = -1

Query  414  KLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHS  235
            KLA ++K    L+E+ A  + AQE++N+L N++H +N+RLEHD+AF KAVL+DTQK+L S
Sbjct  141  KLAASLKGRMDLEERSAAAKRAQEDSNNLRNVIHLENLRLEHDLAFFKAVLEDTQKDLQS  200

Query  234  TRGLLGGERARAFQLQVEVFHLKQRLQSL  148
             R L+  +R R+F LQ+ V HL   L +L
Sbjct  201  NRELIATKRTRSFNLQLTVDHLPFLLPAL  229



>emb|CDY02611.1| BnaC02g08240D [Brassica napus]
 emb|CDY02612.1| BnaC02g08230D [Brassica napus]
Length=63

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  321  IVHSDNVRLEHDVAFLKAVLDDTQKE--LHSTRGLLGGERARAFQLQV  184
            +VH DNVRLEHDVA +K VLDD Q++  LHSTRG+L GERAR FQLQV
Sbjct  1    MVHFDNVRLEHDVALVKYVLDDKQRKMFLHSTRGVLAGERARMFQLQV  48



>gb|ABR25493.1| rangap1 interacting protein [Oryza sativa Indica Group]
Length=40

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  228  GLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            G+L GER+RAFQLQVEVFHLKQRLQ++E R+PTPRKP
Sbjct  1    GVLAGERSRAFQLQVEVFHLKQRLQTMEGRSPTPRKP  37



>ref|XP_001765510.1| predicted protein [Physcomitrella patens]
 gb|EDQ69771.1| predicted protein [Physcomitrella patens]
Length=385

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 57/101 (56%), Gaps = 24/101 (24%)
 Frame = -1

Query  429  QDTEKKLADAMKEIDLLKEKLAGVELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQ  250
            Q  E K A ++K   + KE++A  E AQE++N+L N+VHS N+RLEHD AFLKAVL+DTQ
Sbjct  290  QHAEGKFAASLKA-QIEKERVAVAERAQEDSNNLCNVVHSGNLRLEHDFAFLKAVLEDTQ  348

Query  249  KELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTP  127
                                 +EVF LK++L       PTP
Sbjct  349  --------------------NMEVFDLKKKLLP---TIPTP  366



>gb|EEE53353.1| hypothetical protein OsJ_36377 [Oryza sativa Japonica Group]
Length=549

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = -1

Query  246  ELHSTRGLLGGERARAFQLQVEVFHLKQRLQSLENRAPTPRKP  118
            ELHSTR +L GE++RAFQLQVEVFHLKQRLQ +E RA TP+ P
Sbjct  506  ELHSTRRVLAGEQSRAFQLQVEVFHLKQRLQ-MEGRAGTPKNP  547



>gb|KDO75105.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=166

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 3/60 (5%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVMERGTRQL  739
            SGRKSLSE  L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  QV  RG   L
Sbjct  96   SGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQVSFRGYNLL  155



>gb|KDO75104.1| hypothetical protein CISIN_1g0050432mg, partial [Citrus sinensis]
Length=170

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 3/53 (6%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESS-SQVM  760
            SGRKSLSE  L DPN ++GNVSL KQF NEEE  T++KM K+S+DE+S  Q+M
Sbjct  96   SGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQIM  148



>ref|XP_010241732.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Nelumbo nucifera]
Length=576

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -1

Query  909  SGRKSLSESLLSDPNSVTGNVSLRKQFYNEEE--TSLKMPKSSDDESSS  769
            SGRKS+S  L  DPN  TGN+SL KQF+NEEE   S KM K+ +DESSS
Sbjct  444  SGRKSISNCLHVDPNPTTGNISLYKQFHNEEEFNMSFKMLKNLEDESSS  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2104600723148