BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12314

Length=905
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...    111   2e-23   Sesamum indicum [beniseed]
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...    110   3e-23   Solanum lycopersicum
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...    109   8e-23   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...    108   1e-22   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...    108   1e-22   Solanum tuberosum [potatoes]
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501    109   2e-22   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    108   2e-22   Nicotiana tomentosiformis
gb|AAF09256.1|AF202179_1  disease resistance protein BS2                107   4e-22   Capsicum chacoense
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...    107   4e-22   Nicotiana tomentosiformis
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...    107   4e-22   Sesamum indicum [beniseed]
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...    107   4e-22   Nicotiana sylvestris
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...    107   9e-22   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg                104   3e-21   Erythranthe guttata [common monkey flower]
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg                103   8e-21   Erythranthe guttata [common monkey flower]
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...    103   9e-21   Nicotiana tomentosiformis
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...    100   1e-20   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...    102   1e-20   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...    102   2e-20   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...    102   2e-20   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...    102   2e-20   Nicotiana sylvestris
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...    102   2e-20   
gb|AAV31175.1|  Putative disease resistance protein, identical          102   2e-20   Solanum tuberosum [potatoes]
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...    102   3e-20   Nicotiana sylvestris
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...    100   4e-20   
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...    101   5e-20   
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...    101   5e-20   Nicotiana tomentosiformis
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...    100   6e-20   Solanum lycopersicum
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...    100   6e-20   Sesamum indicum [beniseed]
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...    100   6e-20   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...    100   7e-20   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...    100   7e-20   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...    100   7e-20   Nicotiana tomentosiformis
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...    100   7e-20   
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...  98.2    8e-20   Nicotiana sylvestris
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...    100   8e-20   Nicotiana sylvestris
emb|CDP21316.1|  unnamed protein product                              94.7    8e-20   Coffea canephora [robusta coffee]
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...  98.2    9e-20   Nicotiana sylvestris
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...  99.8    1e-19   Solanum tuberosum [potatoes]
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...    100   1e-19   Nicotiana tomentosiformis
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg              99.8    1e-19   Erythranthe guttata [common monkey flower]
gb|EYU21831.1|  hypothetical protein MIMGU_mgv1a0261622mg             99.0    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  99.0    2e-19   
ref|XP_009779606.1|  PREDICTED: putative late blight resistance p...  99.0    3e-19   Nicotiana sylvestris
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  99.0    3e-19   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  99.0    3e-19   Nicotiana tomentosiformis
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...  97.8    5e-19   
emb|CDP04753.1|  unnamed protein product                              98.2    6e-19   Coffea canephora [robusta coffee]
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg              97.8    6e-19   Erythranthe guttata [common monkey flower]
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...  97.4    8e-19   Nicotiana tomentosiformis
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  97.4    8e-19   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              97.4    8e-19   Erythranthe guttata [common monkey flower]
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              97.1    1e-18   Erythranthe guttata [common monkey flower]
gb|EYU31596.1|  hypothetical protein MIMGU_mgv1a025161mg              96.3    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...  96.3    2e-18   Sesamum indicum [beniseed]
gb|EYU21837.1|  hypothetical protein MIMGU_mgv1a021514mg              95.9    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  96.3    2e-18   Solanum lycopersicum
gb|EYU21833.1|  hypothetical protein MIMGU_mgv1a009417mg              93.2    2e-18   Erythranthe guttata [common monkey flower]
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  95.9    2e-18   Nicotiana tomentosiformis
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...  95.9    2e-18   Solanum lycopersicum
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  95.5    3e-18   Nicotiana tomentosiformis
ref|XP_009762295.1|  PREDICTED: putative late blight resistance p...  90.1    3e-18   Nicotiana sylvestris
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...  95.5    3e-18   Sesamum indicum [beniseed]
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  95.5    3e-18   Solanum tuberosum [potatoes]
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  95.5    3e-18   Nicotiana sylvestris
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              95.1    3e-18   Erythranthe guttata [common monkey flower]
gb|EYU31599.1|  hypothetical protein MIMGU_mgv1a025745mg              95.1    4e-18   Erythranthe guttata [common monkey flower]
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              95.1    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  95.1    5e-18   Solanum lycopersicum
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg              94.7    5e-18   Erythranthe guttata [common monkey flower]
ref|XP_009761713.1|  PREDICTED: putative late blight resistance p...  91.7    5e-18   Nicotiana sylvestris
ref|XP_009609967.1|  PREDICTED: late blight resistance protein R1...  93.6    6e-18   Nicotiana tomentosiformis
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...  94.7    6e-18   
gb|EYU21829.1|  hypothetical protein MIMGU_mgv1a001470mg              94.4    7e-18   Erythranthe guttata [common monkey flower]
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  94.4    7e-18   Sesamum indicum [beniseed]
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...  94.4    7e-18   Nicotiana sylvestris
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...  94.4    8e-18   Solanum tuberosum [potatoes]
gb|EYU21838.1|  hypothetical protein MIMGU_mgv1a001107mg              94.4    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...  94.4    8e-18   Solanum lycopersicum
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  94.4    9e-18   Nicotiana sylvestris
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  94.0    1e-17   Sesamum indicum [beniseed]
emb|CDP00737.1|  unnamed protein product                              94.0    1e-17   Coffea canephora [robusta coffee]
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  93.6    1e-17   Nicotiana sylvestris
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...  93.6    1e-17   Nicotiana tomentosiformis
ref|XP_010319214.1|  PREDICTED: putative late blight resistance p...  93.6    1e-17   Solanum lycopersicum
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  93.6    1e-17   Nicotiana sylvestris
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...  93.6    1e-17   Nicotiana tomentosiformis
ref|XP_009796331.1|  PREDICTED: late blight resistance protein R1...  92.8    1e-17   Nicotiana sylvestris
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...  93.6    1e-17   Solanum lycopersicum
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...  89.4    2e-17   
ref|XP_009796673.1|  PREDICTED: uncharacterized protein LOC104243211  89.7    2e-17   Nicotiana sylvestris
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  93.2    2e-17   
ref|XP_009796668.1|  PREDICTED: putative late blight resistance p...  93.2    2e-17   Nicotiana sylvestris
ref|XP_009796670.1|  PREDICTED: putative late blight resistance p...  93.2    2e-17   Nicotiana sylvestris
ref|XP_009796664.1|  PREDICTED: putative late blight resistance p...  93.2    2e-17   Nicotiana sylvestris
emb|CDP04880.1|  unnamed protein product                              93.2    2e-17   Coffea canephora [robusta coffee]
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...  92.8    2e-17   
ref|XP_009796665.1|  PREDICTED: putative late blight resistance p...  92.8    2e-17   Nicotiana sylvestris
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  92.8    3e-17   
ref|XP_009620237.1|  PREDICTED: putative late blight resistance p...  92.8    3e-17   Nicotiana tomentosiformis
ref|XP_009796671.1|  PREDICTED: putative late blight resistance p...  92.4    3e-17   Nicotiana sylvestris
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...  92.4    3e-17   Solanum lycopersicum
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...  92.4    3e-17   Nicotiana sylvestris
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              92.4    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_009618247.1|  PREDICTED: probable disease resistance prote...  88.6    3e-17   
emb|CDP10671.1|  unnamed protein product                              92.0    4e-17   Coffea canephora [robusta coffee]
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  92.0    4e-17   Sesamum indicum [beniseed]
emb|CDP19634.1|  unnamed protein product                              92.0    5e-17   Coffea canephora [robusta coffee]
emb|CDP20153.1|  unnamed protein product                              92.0    5e-17   Coffea canephora [robusta coffee]
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  91.7    5e-17   Nicotiana sylvestris
ref|XP_011072139.1|  PREDICTED: putative late blight resistance p...  91.7    6e-17   
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...  91.7    6e-17   
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...  91.7    6e-17   Sesamum indicum [beniseed]
ref|XP_011071886.1|  PREDICTED: uncharacterized protein LOC105157233  89.0    6e-17   Sesamum indicum [beniseed]
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...  91.7    6e-17   
ref|XP_009589795.1|  PREDICTED: putative late blight resistance p...  91.7    6e-17   Nicotiana tomentosiformis
ref|XP_009785700.1|  PREDICTED: putative late blight resistance p...  90.1    6e-17   Nicotiana sylvestris
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...  91.3    7e-17   Sesamum indicum [beniseed]
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2              91.3    7e-17   Sesamum indicum [beniseed]
ref|XP_009782925.1|  PREDICTED: putative late blight resistance p...  91.3    7e-17   Nicotiana sylvestris
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...  91.3    8e-17   Nicotiana sylvestris
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...  91.3    8e-17   Sesamum indicum [beniseed]
ref|XP_009784309.1|  PREDICTED: putative late blight resistance p...  88.6    9e-17   Nicotiana sylvestris
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...  90.9    9e-17   Nicotiana sylvestris
emb|CDP04756.1|  unnamed protein product                              90.9    1e-16   Coffea canephora [robusta coffee]
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  87.0    1e-16   Nicotiana sylvestris
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg              90.5    1e-16   Erythranthe guttata [common monkey flower]
emb|CDP00696.1|  unnamed protein product                              84.0    1e-16   Coffea canephora [robusta coffee]
emb|CDP16510.1|  unnamed protein product                              90.9    1e-16   Coffea canephora [robusta coffee]
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  90.1    2e-16   Sesamum indicum [beniseed]
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...  90.1    2e-16   Nicotiana sylvestris
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...  90.1    2e-16   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  90.1    2e-16   Nicotiana tomentosiformis
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...  90.1    2e-16   Solanum lycopersicum
emb|CDP00736.1|  unnamed protein product                              89.7    2e-16   Coffea canephora [robusta coffee]
emb|CDP18676.1|  unnamed protein product                              90.1    2e-16   Coffea canephora [robusta coffee]
ref|XP_006365681.1|  PREDICTED: putative late blight resistance p...  89.4    2e-16   
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...  88.6    3e-16   Nicotiana sylvestris
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...  89.4    3e-16   Sesamum indicum [beniseed]
emb|CDP00692.1|  unnamed protein product                              89.4    3e-16   Coffea canephora [robusta coffee]
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...  89.4    3e-16   Solanum tuberosum [potatoes]
emb|CDP17919.1|  unnamed protein product                              89.4    3e-16   Coffea canephora [robusta coffee]
ref|XP_011072138.1|  PREDICTED: putative late blight resistance p...  87.8    3e-16   Sesamum indicum [beniseed]
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  89.4    3e-16   
emb|CDO99208.1|  unnamed protein product                              88.2    4e-16   Coffea canephora [robusta coffee]
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...  89.0    4e-16   Nicotiana tomentosiformis
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...  89.0    4e-16   Nicotiana tomentosiformis
ref|XP_006365678.1|  PREDICTED: putative late blight resistance p...  88.6    4e-16   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...  89.0    5e-16   Nicotiana sylvestris
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              88.6    5e-16   Sesamum indicum [beniseed]
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...  85.1    5e-16   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...  88.6    5e-16   
emb|CDP05558.1|  unnamed protein product                              88.6    5e-16   Coffea canephora [robusta coffee]
ref|XP_011087138.1|  PREDICTED: putative late blight resistance p...  88.6    5e-16   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  84.0    6e-16   
emb|CDP17914.1|  unnamed protein product                              88.2    6e-16   Coffea canephora [robusta coffee]
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  88.2    6e-16   Sesamum indicum [beniseed]
ref|XP_009803158.1|  PREDICTED: putative late blight resistance p...  88.2    7e-16   Nicotiana sylvestris
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  88.6    7e-16   Solanum tuberosum [potatoes]
ref|XP_009625338.1|  PREDICTED: putative late blight resistance p...  85.9    7e-16   
emb|CDP12798.1|  unnamed protein product                              88.6    7e-16   Coffea canephora [robusta coffee]
emb|CDP20159.1|  unnamed protein product                              88.2    8e-16   Coffea canephora [robusta coffee]
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...  88.2    8e-16   Nicotiana sylvestris
emb|CDP17260.1|  unnamed protein product                              88.2    8e-16   Coffea canephora [robusta coffee]
emb|CDP15718.1|  unnamed protein product                              88.2    8e-16   Coffea canephora [robusta coffee]
ref|XP_011072180.1|  PREDICTED: putative late blight resistance p...  87.8    9e-16   
ref|XP_011072144.1|  PREDICTED: putative late blight resistance p...  87.8    9e-16   Sesamum indicum [beniseed]
ref|XP_011072171.1|  PREDICTED: putative late blight resistance p...  87.8    9e-16   Sesamum indicum [beniseed]
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...  87.8    1e-15   Nicotiana sylvestris
emb|CDP04755.1|  unnamed protein product                              87.4    1e-15   Coffea canephora [robusta coffee]
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  87.4    1e-15   Sesamum indicum [beniseed]
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              87.0    1e-15   Sesamum indicum [beniseed]
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...  87.4    1e-15   Nicotiana tomentosiformis
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  87.4    1e-15   Sesamum indicum [beniseed]
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              87.0    1e-15   Sesamum indicum [beniseed]
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              87.0    1e-15   Sesamum indicum [beniseed]
emb|CDP18040.1|  unnamed protein product                              87.4    1e-15   Coffea canephora [robusta coffee]
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              87.0    1e-15   Sesamum indicum [beniseed]
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  87.4    1e-15   Solanum lycopersicum
emb|CDP05594.1|  unnamed protein product                              87.4    2e-15   Coffea canephora [robusta coffee]
emb|CDP20519.1|  unnamed protein product                              87.4    2e-15   Coffea canephora [robusta coffee]
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  87.0    2e-15   Sesamum indicum [beniseed]
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              86.7    2e-15   Sesamum indicum [beniseed]
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  87.0    2e-15   Nicotiana sylvestris
emb|CDP12799.1|  unnamed protein product                              87.0    2e-15   Coffea canephora [robusta coffee]
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg              87.0    2e-15   Erythranthe guttata [common monkey flower]
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg              87.0    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...  86.7    2e-15   Nicotiana sylvestris
emb|CDP12547.1|  unnamed protein product                              86.7    2e-15   Coffea canephora [robusta coffee]
gb|ABJ99601.1|  NBS-LRR type resistance protein                       86.7    2e-15   Beta vulgaris [beet]
emb|CDP08021.1|  unnamed protein product                              86.3    3e-15   Coffea canephora [robusta coffee]
gb|ABJ99598.1|  NBS-LRR type resistance protein                       86.3    3e-15   Beta vulgaris [beet]
emb|CDP12770.1|  unnamed protein product                              86.3    3e-15   Coffea canephora [robusta coffee]
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...  86.3    3e-15   Sesamum indicum [beniseed]
ref|XP_011086979.1|  PREDICTED: putative late blight resistance p...  85.9    4e-15   Sesamum indicum [beniseed]
ref|XP_010677242.1|  PREDICTED: putative late blight resistance p...  86.3    4e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  85.9    4e-15   Sesamum indicum [beniseed]
emb|CDP12797.1|  unnamed protein product                              85.9    4e-15   Coffea canephora [robusta coffee]
emb|CDP20607.1|  unnamed protein product                              85.5    4e-15   Coffea canephora [robusta coffee]
gb|AET22504.1|  hypothetical protein                                  85.9    4e-15   Solanum lycopersicum
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  86.3    4e-15   Nicotiana sylvestris
ref|XP_011073039.1|  PREDICTED: putative late blight resistance p...  85.5    5e-15   Sesamum indicum [beniseed]
ref|XP_004236959.1|  PREDICTED: putative late blight resistance p...  85.5    5e-15   Solanum lycopersicum
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  85.5    5e-15   Nicotiana sylvestris
gb|AEW48205.1|  disease resistance protein RGH2                       85.5    5e-15   Solanum fernandezianum
gb|EYU17763.1|  hypothetical protein MIMGU_mgv1a002610mg              85.1    5e-15   Erythranthe guttata [common monkey flower]
ref|XP_009798711.1|  PREDICTED: putative late blight resistance p...  85.1    5e-15   Nicotiana sylvestris
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...  85.5    6e-15   Nicotiana sylvestris
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...  85.1    6e-15   Nicotiana sylvestris
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...  85.5    6e-15   Nicotiana tomentosiformis
emb|CDP20463.1|  unnamed protein product                              85.5    6e-15   Coffea canephora [robusta coffee]
ref|NP_001234202.1|  NRC1                                             85.1    6e-15   Solanum lycopersicum
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...  85.1    7e-15   Sesamum indicum [beniseed]
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...  85.1    7e-15   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  85.1    7e-15   Nicotiana sylvestris
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  85.1    7e-15   Sesamum indicum [beniseed]
ref|XP_010677240.1|  PREDICTED: putative late blight resistance p...  85.1    7e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006347943.1|  PREDICTED: putative late blight resistance p...  84.3    8e-15   
gb|EPS70910.1|  hypothetical protein M569_03853                       84.7    8e-15   Genlisea aurea
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...  84.7    9e-15   Nicotiana sylvestris
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...  84.7    9e-15   Nicotiana sylvestris
gb|EYU29923.1|  hypothetical protein MIMGU_mgv1a026346mg              82.4    9e-15   Erythranthe guttata [common monkey flower]
emb|CDP12821.1|  unnamed protein product                              85.1    9e-15   Coffea canephora [robusta coffee]
emb|CDP21314.1|  unnamed protein product                              81.6    9e-15   Coffea canephora [robusta coffee]
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  84.7    1e-14   Sesamum indicum [beniseed]
ref|XP_009783712.1|  PREDICTED: putative late blight resistance p...  80.1    1e-14   Nicotiana sylvestris
gb|EYU23523.1|  hypothetical protein MIMGU_mgv1a025044mg              84.3    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...  84.7    1e-14   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  84.3    1e-14   Nicotiana tomentosiformis
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              84.3    1e-14   Erythranthe guttata [common monkey flower]
gb|EYU20585.1|  hypothetical protein MIMGU_mgv1a019584mg              84.3    1e-14   Erythranthe guttata [common monkey flower]
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg              84.3    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  84.3    1e-14   Sesamum indicum [beniseed]
ref|XP_011072172.1|  PREDICTED: putative late blight resistance p...  84.3    1e-14   Sesamum indicum [beniseed]
gb|EYU21842.1|  hypothetical protein MIMGU_mgv1a020462mg              84.3    1e-14   Erythranthe guttata [common monkey flower]
gb|EYU33968.1|  hypothetical protein MIMGU_mgv1a026820mg              84.0    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_006345615.1|  PREDICTED: putative late blight resistance p...  80.1    2e-14   
emb|CDP21622.1|  unnamed protein product                              84.0    2e-14   Coffea canephora [robusta coffee]
ref|XP_011072146.1|  PREDICTED: putative late blight resistance p...  84.0    2e-14   Sesamum indicum [beniseed]
gb|EYU21846.1|  hypothetical protein MIMGU_mgv1a022576mg              82.0    2e-14   Erythranthe guttata [common monkey flower]
emb|CDP17943.1|  unnamed protein product                              84.0    2e-14   Coffea canephora [robusta coffee]
ref|XP_009604446.1|  PREDICTED: putative late blight resistance p...  83.2    2e-14   
emb|CDP19994.1|  unnamed protein product                              83.6    2e-14   Coffea canephora [robusta coffee]
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  83.6    2e-14   Solanum tuberosum [potatoes]
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  83.6    2e-14   
gb|EYU20573.1|  hypothetical protein MIMGU_mgv1a000577mg              83.6    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_006367930.1|  PREDICTED: putative late blight resistance p...  83.6    2e-14   Solanum tuberosum [potatoes]
emb|CDP15268.1|  unnamed protein product                              83.6    2e-14   Coffea canephora [robusta coffee]
gb|EYU31552.1|  hypothetical protein MIMGU_mgv1a025226mg              83.6    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...  83.2    3e-14   Solanum lycopersicum
emb|CDP16515.1|  unnamed protein product                              83.2    3e-14   Coffea canephora [robusta coffee]
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  83.2    3e-14   Nicotiana tomentosiformis
ref|XP_006367931.1|  PREDICTED: putative late blight resistance p...  83.2    3e-14   Solanum tuberosum [potatoes]
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...  83.2    3e-14   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...  83.2    3e-14   
emb|CDP16512.1|  unnamed protein product                              83.2    3e-14   Coffea canephora [robusta coffee]
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg              83.2    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...  83.2    3e-14   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg              83.2    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  83.6    3e-14   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...  83.2    3e-14   Nicotiana sylvestris
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  82.8    3e-14   Nicotiana sylvestris
ref|XP_009603761.1|  PREDICTED: putative late blight resistance p...  82.8    3e-14   Nicotiana tomentosiformis
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...  82.8    3e-14   Solanum tuberosum [potatoes]
ref|XP_009603760.1|  PREDICTED: putative late blight resistance p...  82.8    4e-14   
emb|CDP08032.1|  unnamed protein product                              82.0    4e-14   
ref|XP_009626721.1|  PREDICTED: putative late blight resistance p...  82.8    4e-14   
ref|XP_009596917.1|  PREDICTED: disease resistance protein RPP13-...  82.8    4e-14   
ref|XP_009783244.1|  PREDICTED: late blight resistance protein R1...  82.8    4e-14   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg              82.4    4e-14   
emb|CDP15705.1|  unnamed protein product                              82.8    5e-14   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  82.4    5e-14   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  82.4    5e-14   
ref|XP_011087335.1|  PREDICTED: putative late blight resistance p...  82.4    5e-14   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...  82.4    5e-14   
gb|EYU17761.1|  hypothetical protein MIMGU_mgv1a000811mg              82.4    5e-14   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg              82.4    5e-14   
emb|CDP08396.1|  unnamed protein product                              82.0    5e-14   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  82.4    5e-14   
ref|XP_009783246.1|  PREDICTED: late blight resistance protein R1...  82.4    5e-14   
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...  82.4    5e-14   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  82.4    6e-14   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  82.4    6e-14   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...  82.4    6e-14   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  82.0    6e-14   
emb|CDP19132.1|  unnamed protein product                              82.4    7e-14   
ref|XP_011075674.1|  PREDICTED: late blight resistance protein R1...  82.0    7e-14   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...  82.0    7e-14   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  82.0    7e-14   
emb|CDP11161.1|  unnamed protein product                              82.0    7e-14   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...  82.0    7e-14   
emb|CDP19489.1|  unnamed protein product                              82.0    7e-14   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...  82.0    7e-14   
ref|XP_011072142.1|  PREDICTED: putative late blight resistance p...  82.0    8e-14   
emb|CDP11157.1|  unnamed protein product                              81.6    8e-14   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  81.6    8e-14   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...  81.6    8e-14   
emb|CDP08019.1|  unnamed protein product                              82.0    8e-14   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...  81.6    8e-14   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  81.6    9e-14   
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  82.0    9e-14   
gb|EYU19036.1|  hypothetical protein MIMGU_mgv1a021264mg              81.3    1e-13   
emb|CDP18682.1|  unnamed protein product                              81.6    1e-13   
ref|XP_009601897.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg              81.3    1e-13   
ref|XP_009788554.1|  PREDICTED: putative late blight resistance p...  81.6    1e-13   
emb|CDP10323.1|  unnamed protein product                              81.3    1e-13   
emb|CDP11974.1|  unnamed protein product                              81.6    1e-13   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg              81.3    1e-13   
emb|CDP05441.1|  unnamed protein product                              81.3    1e-13   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              81.3    1e-13   
ref|XP_009591232.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
ref|XP_009797674.1|  PREDICTED: putative late blight resistance p...  80.9    1e-13   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
emb|CDP17920.1|  unnamed protein product                              81.3    1e-13   
ref|XP_009793189.1|  PREDICTED: putative late blight resistance p...  81.3    1e-13   
ref|XP_009761103.1|  PREDICTED: putative late blight resistance p...  80.9    1e-13   
emb|CDP18680.1|  unnamed protein product                              81.3    1e-13   
emb|CDP00687.1|  unnamed protein product                              80.1    2e-13   
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...  81.3    2e-13   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg              80.9    2e-13   
ref|XP_006349899.1|  PREDICTED: putative late blight resistance p...  80.1    2e-13   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
emb|CDP11160.1|  unnamed protein product                              80.9    2e-13   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
ref|XP_011072147.1|  PREDICTED: putative late blight resistance p...  80.5    2e-13   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  80.5    2e-13   
gb|AAF76163.1|AF266747_1  RGC1                                        80.5    2e-13   
ref|XP_009764213.1|  PREDICTED: putative late blight resistance p...  76.6    2e-13   
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...  80.9    2e-13   
gb|EYU24353.1|  hypothetical protein MIMGU_mgv1a022376mg              80.5    2e-13   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...  80.5    2e-13   
emb|CDP00758.1|  unnamed protein product                              80.5    2e-13   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg              80.5    2e-13   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg              80.5    2e-13   
gb|EYU23519.1|  hypothetical protein MIMGU_mgv1a022028mg              80.5    2e-13   
ref|XP_009776932.1|  PREDICTED: putative late blight resistance p...  75.9    2e-13   
gb|AEW48216.1|  disease resistance protein RX3                        80.5    2e-13   
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...  80.5    2e-13   
ref|XP_011072559.1|  PREDICTED: putative late blight resistance p...  78.6    2e-13   
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...  80.5    2e-13   
emb|CDP19728.1|  unnamed protein product                              80.5    3e-13   
emb|CDP08033.1|  unnamed protein product                              80.1    3e-13   
ref|XP_011084836.1|  PREDICTED: putative late blight resistance p...  79.7    3e-13   
emb|CDP17703.1|  unnamed protein product                              80.1    3e-13   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg              80.1    3e-13   
ref|XP_009777063.1|  PREDICTED: putative late blight resistance p...  80.1    3e-13   
ref|XP_009777062.1|  PREDICTED: putative late blight resistance p...  80.1    3e-13   
emb|CDP00690.1|  unnamed protein product                              79.7    3e-13   
gb|EYU23506.1|  hypothetical protein MIMGU_mgv1a001122mg              80.1    3e-13   
ref|XP_009758684.1|  PREDICTED: late blight resistance protein R1...  80.1    3e-13   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg              79.7    3e-13   
gb|EYU23536.1|  hypothetical protein MIMGU_mgv1a001875mg              79.7    4e-13   
emb|CDP05538.1|  unnamed protein product                              80.1    4e-13   
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...  79.7    4e-13   
ref|XP_009777064.1|  PREDICTED: putative late blight resistance p...  80.1    4e-13   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...  79.7    4e-13   
gb|AEW48214.1|  disease resistance protein RGH4                       79.7    4e-13   
gb|AAV88066.1|  NBS-LRR protein                                       79.7    4e-13   
ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...  79.7    4e-13   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg              79.3    4e-13   
gb|EYU31247.1|  hypothetical protein MIMGU_mgv1a017756mg              79.3    5e-13   
gb|AEW48190.1|  disease resistance protein RX4                        79.3    5e-13   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              79.3    5e-13   
emb|CAB56299.1|  NBS-LRR protein                                      79.3    5e-13   
gb|AEW48201.1|  disease resistance protein RGH9                       79.3    5e-13   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...  79.3    5e-13   
ref|XP_006346788.1|  PREDICTED: putative late blight resistance p...  79.3    5e-13   
gb|AEW48197.1|  disease resistance protein RGH3                       79.3    5e-13   
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg              79.0    6e-13   
ref|XP_011072177.1|  PREDICTED: disease resistance RPP8-like prot...  79.3    6e-13   
gb|EYU28611.1|  hypothetical protein MIMGU_mgv1a025283mg              79.0    6e-13   
ref|XP_009608248.1|  PREDICTED: putative late blight resistance p...  78.2    6e-13   
ref|XP_006367912.1|  PREDICTED: putative late blight resistance p...  76.6    6e-13   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...  79.3    7e-13   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...  79.3    7e-13   
gb|AEW48218.1|  disease resistance protein RX6                        79.0    7e-13   
ref|XP_006367913.1|  PREDICTED: putative late blight resistance p...  75.9    7e-13   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg              78.6    7e-13   
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...  79.0    8e-13   
emb|CDP11548.1|  unnamed protein product                              79.0    8e-13   
emb|CDP11186.1|  unnamed protein product                              79.0    8e-13   
gb|AEW48217.1|  disease resistance protein RX5                        78.6    9e-13   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg              78.6    9e-13   
emb|CAB50786.1|  Rx protein                                           78.6    9e-13   
ref|XP_011072129.1|  PREDICTED: putative late blight resistance p...  78.2    1e-12   
ref|XP_009599401.1|  PREDICTED: putative late blight resistance p...  75.5    1e-12   
ref|XP_004236957.1|  PREDICTED: putative late blight resistance p...  78.2    1e-12   
gb|EYU17689.1|  hypothetical protein MIMGU_mgv1a024130mg              78.2    1e-12   
gb|EYU17742.1|  hypothetical protein MIMGU_mgv1a023281mg              78.2    1e-12   
gb|EYU29512.1|  hypothetical protein MIMGU_mgv1a022452mg              78.2    1e-12   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...  78.2    1e-12   
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...  77.8    1e-12   
ref|XP_011071879.1|  PREDICTED: uncharacterized protein LOC105157...  77.0    2e-12   
ref|XP_009596888.1|  PREDICTED: uncharacterized protein LOC104092904  75.5    2e-12   
emb|CDP11611.1|  unnamed protein product                              77.8    2e-12   
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...  77.4    2e-12   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  77.4    2e-12   
emb|CDP08428.1|  unnamed protein product                              77.8    2e-12   
emb|CDP20176.1|  unnamed protein product                              77.4    2e-12   
emb|CDP21300.1|  unnamed protein product                              77.8    2e-12   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  77.4    2e-12   
ref|XP_009630452.1|  PREDICTED: putative late blight resistance p...  77.4    2e-12   
emb|CDP04724.1|  unnamed protein product                              77.0    2e-12   
ref|XP_009618258.1|  PREDICTED: late blight resistance protein R1...  77.4    2e-12   
emb|CDP05499.1|  unnamed protein product                              77.4    2e-12   
gb|AAT39951.2|  Disease resistance protein, putative                  77.4    2e-12   
ref|XP_006363255.1|  PREDICTED: putative late blight resistance p...  77.4    2e-12   
gb|AEW48200.1|  disease resistance protein RGH7                       77.4    2e-12   
emb|CDP04754.1|  unnamed protein product                              77.0    3e-12   
ref|XP_009791056.1|  PREDICTED: putative late blight resistance p...  77.0    3e-12   
ref|XP_009791054.1|  PREDICTED: putative late blight resistance p...  77.0    3e-12   
ref|XP_006365690.1|  PREDICTED: putative late blight resistance p...  76.6    3e-12   
gb|AAL17826.1|  GPA2-like NBS-LRR protein                             76.6    3e-12   
gb|EYU24152.1|  hypothetical protein MIMGU_mgv1a018081mg              77.0    3e-12   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...  77.0    3e-12   
ref|XP_009787864.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  77.0    3e-12   
ref|XP_009777218.1|  PREDICTED: putative late blight resistance p...  76.6    3e-12   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  76.6    3e-12   
ref|XP_009618209.1|  PREDICTED: late blight resistance protein R1...  77.0    4e-12   
emb|CDP18675.1|  unnamed protein product                              77.0    4e-12   
gb|ABY61745.1|  resistance protein PSH-RGH6                           76.6    4e-12   
ref|XP_011072134.1|  PREDICTED: putative late blight resistance p...  76.6    4e-12   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...  76.6    4e-12   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...  76.6    4e-12   
gb|AEW48209.1|  disease resistance protein RGH5                       76.6    4e-12   
emb|CDP07957.1|  unnamed protein product                              76.6    4e-12   
gb|ABY61746.1|  resistance protein PSH-RGH7                           76.6    4e-12   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  76.6    4e-12   
ref|XP_009596161.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  76.6    5e-12   
emb|CDP00592.1|  unnamed protein product                              76.3    5e-12   
ref|XP_009766585.1|  PREDICTED: late blight resistance protein R1...  76.3    5e-12   
ref|XP_006367977.1|  PREDICTED: putative late blight resistance p...  73.6    5e-12   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg              76.3    5e-12   
emb|CDP11825.1|  unnamed protein product                              76.3    5e-12   
emb|CDP15581.1|  unnamed protein product                              76.3    6e-12   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  76.3    6e-12   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  76.3    6e-12   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  76.3    6e-12   
ref|XP_009608040.1|  PREDICTED: putative late blight resistance p...  76.3    6e-12   
ref|XP_009773003.1|  PREDICTED: protein CHUP1, chloroplastic-like     75.1    6e-12   
gb|AEW48212.1|  disease resistance protein RGH1                       75.9    6e-12   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  75.9    7e-12   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  75.9    7e-12   
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg              75.9    7e-12   
gb|AEW48196.1|  disease resistance protein RGH7                       75.9    7e-12   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  75.9    7e-12   
ref|XP_009614998.1|  PREDICTED: putative late blight resistance p...  75.9    8e-12   
ref|XP_009797581.1|  PREDICTED: putative late blight resistance p...  75.5    8e-12   
ref|XP_009614999.1|  PREDICTED: putative late blight resistance p...  75.9    8e-12   
gb|AAT40487.1|  putative disease resistance protein                   75.9    8e-12   
emb|CDP11163.1|  unnamed protein product                              75.9    8e-12   
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  75.9    8e-12   
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...  75.5    9e-12   
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  75.5    9e-12   
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  75.5    9e-12   
emb|CDP15122.1|  unnamed protein product                              75.5    9e-12   
ref|XP_009763714.1|  PREDICTED: putative late blight resistance p...  75.5    1e-11   
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  75.5    1e-11   
emb|CDP12774.1|  unnamed protein product                              75.5    1e-11   
ref|XP_009778215.1|  PREDICTED: putative late blight resistance p...  75.1    1e-11   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  75.5    1e-11   
ref|XP_009588709.1|  PREDICTED: putative late blight resistance p...  75.1    1e-11   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...  75.1    1e-11   
emb|CDP12800.1|  unnamed protein product                              75.1    1e-11   
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg              74.7    1e-11   
ref|XP_006355211.1|  PREDICTED: putative late blight resistance p...  74.3    1e-11   
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...  75.1    2e-11   
gb|EYU23566.1|  hypothetical protein MIMGU_mgv1a020047mg              74.7    2e-11   
ref|XP_009594770.1|  PREDICTED: late blight resistance protein R1...  74.7    2e-11   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  74.7    2e-11   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  74.7    2e-11   
ref|XP_011072132.1|  PREDICTED: putative late blight resistance p...  74.3    2e-11   
emb|CDP17701.1|  unnamed protein product                              74.7    2e-11   
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  74.7    2e-11   
ref|XP_006365952.1|  PREDICTED: putative late blight resistance p...  72.0    2e-11   
gb|EYU23504.1|  hypothetical protein MIMGU_mgv1a021434mg              74.3    2e-11   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  74.3    2e-11   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...  74.3    2e-11   



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 96/162 (59%), Gaps = 6/162 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            +E LVNL QLE L +  +Y    S+  + I     +   + LK L L      W+ + ++
Sbjct  783  LEALVNLHQLETLKLLFKY----SSHASEIVNPPKLAFPEKLKRLILAGCGIPWSSMTIV  838

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              LP LEVLKLR  AC G +WE P +++FCQL  L+++  DL  W A   HFP+L+ L +
Sbjct  839  GALPNLEVLKLRKNACQGIEWE-PVEEQFCQLKHLLLEEVDLVQWVANETHFPRLQRLVI  897

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
             SC KLKEIPSG  EI  L+ I+L  C  S V SA++I+EEQ
Sbjct  898  RSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQ  939



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score =   110 bits (276),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 100/170 (59%), Gaps = 14/170 (8%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NLV LQQLE L +  +++ W           S + +  +LK L+L +    W+ ++++ +
Sbjct  739  NLVILQQLETLTVR-KFYNW-----------SAVTIPTTLKKLKLYKTFLRWSYLDIIAE  786

Query  701  LPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LP LEVLKL   AC GE+W  P+   F QL VL+I    LE WKAT  +FP LE L L S
Sbjct  787  LPNLEVLKLVLNACHGEEWN-PNVRVFTQLKVLLIQANYLESWKATNDNFPVLERLVLGS  845

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            C  LKEIP  FA+I+  + I+L SC P +  SA  I++EQ D  N+ +DV
Sbjct  846  CSYLKEIPIEFADINTSQLIELDSCPPILAESAARIQQEQEDLGNDPIDV  895



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score =   109 bits (272),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 95/162 (59%), Gaps = 6/162 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            +E LVNL QLE L +  +Y    S+  + I     +   + LK L L      W+ + ++
Sbjct  554  LEALVNLHQLETLKLLFKY----SSHASEIVNPPKLAFPEKLKRLILAGCGIPWSSMTIV  609

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              LP LEVLKLR  AC G +WE P +++FCQL  L+++  DL  W A   HFP L+ L +
Sbjct  610  GALPNLEVLKLRKNACQGVEWE-PVEEQFCQLKHLLLEEVDLVQWVANETHFPCLQRLVI  668

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
             SC KLKEIPSG  EI  L+ I+L  C  S V SA++I+EEQ
Sbjct  669  RSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEEQ  710



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 102/174 (59%), Gaps = 7/174 (4%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNM---IQINSHIFLLKSLKGLELRRNCFEWNG  720
            C++NLV+L QLE+L +      W    P +   + I        +LK L L     EW  
Sbjct  570  CLDNLVHLTQLEKLKVEVR-ESWLIFRPTIKGWVDIPHCDNFPPNLKKLTLCTTHLEWED  628

Query  719  INVLCKLPRLEVLKLRA-ACVGEQWELPDDDK--FCQLIVLIIDRTDLEDWKATRYHFPK  549
            +N+L KLP LEVLKL+  A  G  W+L D+D   F +L  L+++   LE W+AT YHFP 
Sbjct  629  MNILSKLPNLEVLKLKDHAFRGHIWKLSDEDADGFLKLKFLLLEHMHLEQWEATSYHFPS  688

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNN  387
            LEHL L  C  L++IP  FAEI  L+ I+L +C  SV+ SA++I+EEQ  + N+
Sbjct  689  LEHLVLTHCHSLEQIPFDFAEIQTLQLIELHNCMRSVLVSAEQIQEEQQSFGND  742



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 101/178 (57%), Gaps = 7/178 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHS-TSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            I+NL +LQ LE L I  +Y  W +        + S     + LK L+L R C  W  +++
Sbjct  696  IDNLKHLQDLESLSIEIQY--WSTINGTRFFSLTSSDSFPQKLKKLKLSRTCLPWEYMSI  753

Query  710  LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRY---HFPKLE  543
            + KLP LEVLKL+  A VG++W+  D     +L  L++   +LE W+ T     HFP LE
Sbjct  754  ISKLPELEVLKLKYDALVGDEWKATDQIGLPKLRFLLLANLNLEKWRTTAGSHDHFPGLE  813

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
             + + +C+ LKEIP GFA+  +L+ I+L  C PS+VA A++I+E+  D   N + V  
Sbjct  814  CVIITNCKFLKEIPQGFADSKKLELIELHKCDPSLVAFAEKIQEKHEDLGRNKLKVTA  871



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 102/172 (59%), Gaps = 3/172 (2%)
 Frame = -1

Query  887   IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
             + +LV+L QLE L +  + ++    S    +     F +K LK L+L   C  W  +N++
Sbjct  1696  LRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFPIK-LKKLKLVGTCLSWEELNII  1754

Query  707   CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              + P LEVLKL+  AC G +W  P + +F QL  L+I+ T+L+ WKAT  HFP LEHL +
Sbjct  1755  GQWPNLEVLKLKPNACHGLEWR-PIEGRFPQLKFLLIEGTNLKCWKATNDHFPALEHLVI  1813

Query  530   FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
               C  L+EIP  FA+I  L+ I+L++C   +VASA  I+EEQ    +  VDV
Sbjct  1814  RHCFHLEEIPIEFADIYSLQLIELQNCSAKLVASAGRIQEEQESLGSKAVDV  1865


 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 101/172 (59%), Gaps = 3/172 (2%)
 Frame = -1

Query  887   IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
             + +LV+L QLE L +  + ++    S    +     F +K LK L+L   C  W  +N++
Sbjct  2503  LRHLVDLHQLETLSVKVDRYQVSHGSSRFHKSPVLHFPIK-LKKLKLVGTCLSWEELNII  2561

Query  707   CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              + P LEVLKL+  AC G +W  P + +F QL  L+I+ T+L+ WKAT  HFP LEHL +
Sbjct  2562  GQWPNLEVLKLKPNACHGLEWR-PIEGRFPQLKFLLIEGTNLKCWKATNDHFPALEHLVI  2620

Query  530   FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
               C  L+EIP  FA+I  L+ I+L++C   +VAS   I+EEQ    +  VDV
Sbjct  2621  RHCFHLEEIPIEFADIYSLQLIELQNCTAKLVASTVLIQEEQESLGSKAVDV  2672


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 91/172 (53%), Gaps = 22/172 (13%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NLV+LQ LE L +   Y +   + P  + I S      +LK L+L      W+ +N++ +
Sbjct  797  NLVHLQHLETLSVTI-YADLEDSVP--VTIPSAKAFPATLKKLKLYGTGLRWDDLNIVGE  853

Query  701  LPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSC  522
            LP LEVLKL    VGE+         C L          + W  T  +FP LE L +  C
Sbjct  854  LPNLEVLKLIFDAVGEE---------CHL----------KYWNITNDNFPVLERLMIIDC  894

Query  521  EKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
             +L+EIP  F+E S LK I+L+ C+P + ASA  I++EQ D  NN VDV ++
Sbjct  895  TELEEIPIEFSETSSLKLIELKDCKPHLEASATRIQQEQEDIGNNPVDVRIS  946



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 96/172 (56%), Gaps = 14/172 (8%)
 Frame = -1

Query  905  TECNDCIENLVNLQQLERLYIHAEYHEWHST----SPNMIQINSHIFLLKSLKGLELRRN  738
            +E  DC  +L +L +LE L  H + +  H       P     N        LK L     
Sbjct  677  SEMPDCFNDLASLGKLESLGFHIQTNINHLNLCLPPPGNFPQN--------LKKLTFIFT  728

Query  737  CFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRY  561
               W  ++++  LP LEVLKLR+ AC+GE+WE P ++ F QL  L++  +D   WKAT  
Sbjct  729  YMPWKNMDIVGMLPNLEVLKLRSSACIGEEWE-PSENGFHQLKFLLLHCSDPNYWKATSD  787

Query  560  HFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            HFP LEHL L  C  L+EIP  FA+   L+SI++ +C  SVV SA++I+EEQ
Sbjct  788  HFPLLEHLVLRDCYHLQEIPLDFADSLTLQSIEIENCERSVVTSAEQIQEEQ  839



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 104/174 (60%), Gaps = 9/174 (5%)
 Frame = -1

Query  881  NLVNLQQLERL-YIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLC  705
            NLV LQQLE L  I  +Y    S  P  + I+S      +LK L+L R    W+ ++++ 
Sbjct  726  NLVYLQQLEILSLISVDY----SLLP--VIISSAKAFPATLKKLKLERTYLSWSYLDIIA  779

Query  704  KLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLF  528
            +LP LEVLKL   AC GE+W  P    F +L +L+I  + L+ WKAT  +FP LE L + 
Sbjct  780  ELPNLEVLKLMDDACCGEEWH-PIVMGFNRLKLLLIKYSFLKFWKATNDNFPVLERLMIR  838

Query  527  SCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            SC+ LKEIP  FA+I  L+ I+LR C P +  SA  I++EQ D  NN VDV ++
Sbjct  839  SCKNLKEIPIEFADIHTLQLIELRECPPKLGESAARIQKEQEDLGNNPVDVRIS  892



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 98/173 (57%), Gaps = 3/173 (2%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLC  705
            +NLV+L QLE L     Y  W S   +   I S      +LK L+L      W  +N++ 
Sbjct  704  DNLVHLHQLETLKFQFRY-VWMSEQISPATIPSAKAFPATLKNLKLVGTGLRWEDLNIIG  762

Query  704  KLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLF  528
            +LP LEVLKL   AC G++W  P +  F +L +L+I   +++ W AT   FP LE L + 
Sbjct  763  ELPNLEVLKLILDACCGQEWH-PIEGGFTRLKLLLIQMCNIKCWNATCDSFPVLERLVII  821

Query  527  SCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            SC  L+EIP  FA+I  L+ I+L SC P ++ASA  I++EQ +  N  VDV +
Sbjct  822  SCSDLEEIPFEFADIQSLQLIELDSCTPELMASAVRIQQEQEEIGNKPVDVSI  874



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 99/174 (57%), Gaps = 5/174 (3%)
 Frame = -1

Query  887   IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
             +E+LVNL QLE L I  +   + ++          +   + LK L L      W  + ++
Sbjct  910   LESLVNLHQLETLKIVIKNDPYRTSK---FVNPPQLAFPQKLKRLTLSGCGLPWETMTIV  966

Query  707   CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
               LP LEVLKL+  AC G++WE P +++FC+L  L+++  DL  W+    HFP L+ L +
Sbjct  967   GSLPNLEVLKLKKDACRGQEWE-PVEEQFCRLKYLLLEELDLVQWRTNEAHFPCLQSLII  1025

Query  530   FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
              SC +L+EIPS   +I+ L+ I+L  C PS V SA++I+EEQ    N  + V +
Sbjct  1026  RSCFRLREIPSAIGDITTLQMIELVDCHPSAVTSAKQIQEEQESMANEDLKVCI  1079



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 103/192 (54%), Gaps = 12/192 (6%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNM--IQINSHI-FLLKSLKGLELRRNCFEW  726
            +DC  NL  L QLE L I           P +  +++  H+  L ++LK L L      W
Sbjct  747  SDCFRNLALLPQLEALKIFG-------LKPPVQELKLARHLDALPENLKKLTLSFTYLPW  799

Query  725  NGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
              +  LC+LP LEVLKL+  A  G +WE  ++  FC L +L+I+ +DLE W A+  HFP 
Sbjct  800  ESMTSLCRLPNLEVLKLKNYAFTGPKWEQVEEG-FCSLKLLLIEMSDLEHWSASNDHFPC  858

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            LEHL L  C  L  IP    +I  L+ I+L +   S + SA+EI+EEQ  Y N+ ++V +
Sbjct  859  LEHLVLKGCLHLDSIPHELGDIPTLQIIELENSSQSALLSAKEIQEEQQSYGNDALEVRI  918

Query  368  AEQHGYSWVSLP  333
                G   VS P
Sbjct  919  ERNFGRIVVSTP  930



>ref|XP_006344326.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1302

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 98/186 (53%), Gaps = 8/186 (4%)
 Frame = -1

Query  905  TECNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEW  726
             E +D ++ L+NLQ+LE+L I A       T  N  +I S  F   +LK L L      W
Sbjct  276  NEWSDFVDCLINLQRLEKLSITA-------TEDNSPRILSSAFCAPNLKHLRLAETSLPW  328

Query  725  NGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTD-LEDWKATRYHFPK  549
              + VL  LP LEVLK   A  G  W+L +D  F +L  L I R D LE W+A    FP 
Sbjct  329  EDMAVLANLPNLEVLKADHAFTGTDWDLNEDVVFQKLKYLRIKRADDLEMWEAASDSFPM  388

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            LE L L   E+L++IP  F EI  LK +Q++ C P+V  SA+ I E+Q  + N  + +++
Sbjct  389  LEQLVLQHLEELEDIPQSFGEIMTLKLVQVKYCSPTVDDSARNILEDQQSWGNYELQIII  448

Query  368  AEQHGY  351
                 Y
Sbjct  449  VPSLQY  454


 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 94/173 (54%), Gaps = 8/173 (5%)
 Frame = -1

Query  905   TECNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEW  726
              E +D ++ L+NLQ+LE+L I A       T  N  +I S  F   +LK L L      W
Sbjct  1122  NEWSDFVDCLINLQRLEKLSITA-------TEDNSPRILSSAFCAPNLKHLRLAYTSLPW  1174

Query  725   NGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLII-DRTDLEDWKATRYHFPK  549
               ++VL  LP LEVLK  +A  G  W L +D  F +L  L I    DLE W+AT  +FP 
Sbjct  1175  EEMDVLANLPNLEVLKADSAFNGTDWTLNEDVVFQKLKYLRIWSADDLERWEATSDNFPM  1234

Query  548   LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
             LE L L   E+L+EIP    EI  LK +Q+ +C P+V  SA+ I +EQ  + N
Sbjct  1235  LEKLVLQHLEELEEIPQSVGEIMTLKLVQVENCNPAVDTSARNILQEQQGWGN  1287



>gb|EYU24187.1| hypothetical protein MIMGU_mgv1a001243mg [Erythranthe guttata]
Length=855

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 97/182 (53%), Gaps = 21/182 (12%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            + NLV+L +LE+L ++ +                      +LK L       +WN + ++
Sbjct  694  LSNLVHLHKLEKLNLYGKS-------------------FVALKKLTFSGCGLKWNEMTIV  734

Query  707  CKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              LP LEVLKL R AC G +W+   +  FCQL +L+ID TDL  W   R HFPKLE L L
Sbjct  735  GSLPNLEVLKLKRHACDGFEWK-TTEGGFCQLKLLVIDSTDLRVWITERCHFPKLERLVL  793

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQHGY  351
            + C KL++IP    EI  L++I++     SVV SA+ I EEQL+   N + + V +   +
Sbjct  794  YDCYKLEKIPFDIGEIPTLQAIEVDLRNSSVVNSAKCIAEEQLESYGNELQIRVLKSRTW  853

Query  350  SW  345
             W
Sbjct  854  RW  855



>gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Erythranthe guttata]
Length=849

 Score =   103 bits (257),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 95/178 (53%), Gaps = 7/178 (4%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C+ NLV+L +LE L  HA  H++H +      ++ ++    ++K L L      W  + +
Sbjct  664  CLNNLVHLHKLEELKFHAMPHDYHRSD-----LSRNLVFPLTMKKLTLSGCNLPWESMTI  718

Query  710  LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            +  LP LEVLKL+  A  G +WE  + + FC+L VL++DRTD   W     HFP LE L 
Sbjct  719  VGSLPNLEVLKLKKGAFRGLKWETTEGE-FCRLKVLVMDRTDPRIWITESSHFPTLEVLV  777

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQ  360
            L  C  L EIP    EI  L+ I++  C  S+  SA+ I+EE   + N +  + +  Q
Sbjct  778  LRKCYTLSEIPYSICEIQTLEQIKVDCCNSSIGESAKRIQEEVQSFGNELEVLTITSQ  835



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score =   103 bits (256),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 97/180 (54%), Gaps = 7/180 (4%)
 Frame = -1

Query  902  ECNDC--IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFE  729
            +C D    +NLV+L QLE+L        W      +    S   +LK L   EL   C  
Sbjct  745  DCEDSRLFDNLVHLHQLEKLRF-GLLTPWKFGDATIPSAKSFPAMLKKL---ELNGTCLR  800

Query  728  WNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
            W  +N++ +LP LEVLK+ +     +W  P    F QL +L+ID T L  WKAT  +FP 
Sbjct  801  WEDMNIISELPNLEVLKVLSVIHDNEW-YPVAGGFTQLKLLLIDSTSLNYWKATDDNFPA  859

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            LE L L SC  L E+P  FA I+ L+ I+L +C P + ASA +I++EQ D  N  +D+ +
Sbjct  860  LECLVLRSCYFLAEMPIEFAYINSLQLIELYNCMPKLEASAAQIQQEQEDIGNKPLDIRI  919



>ref|XP_006367921.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X6 [Solanum tuberosum]
Length=403

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 102/175 (58%), Gaps = 6/175 (3%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNM---IQINSHIFLLKSLKGLELRRNCFEWN  723
            +C++NLV+L QLE+L +          +P +   + I        +LK L L R   +W 
Sbjct  218  NCLDNLVHLTQLEKLKVVVREPFLLIFTPIIEGWMDIPHCDNFPPNLKKLTLCRTNLQWE  277

Query  722  GINVLCKLPRLEVLKLR-AACVGEQWELPD--DDKFCQLIVLIIDRTDLEDWKATRYHFP  552
             +N+L KLP LEVLKL+  A  G  W+L D  +D F +L  L+++   L  W+AT YHFP
Sbjct  278  DMNILRKLPNLEVLKLKDYAFRGLTWKLSDVDEDGFLKLKFLLLESLHLMQWEATSYHFP  337

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNN  387
             LEH  L +C  L++IP  FAEI  L+ I+L  C  SV+ SA++I+EEQ  + N+
Sbjct  338  SLEHFVLTNCRYLEKIPFDFAEIQTLQLIELHECMRSVLVSAEQIQEEQQSFGND  392



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 105/184 (57%), Gaps = 13/184 (7%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHE-WHSTSPNMI-QINSHIFLLKSLK--GLELRRNCFEWNGI  717
            +N V+L QLE L +  E+       SP  I  I S   +LK LK  G +LR     W  +
Sbjct  734  DNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTDLR-----WEDL  788

Query  716  NVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEH  540
            N++ +LP LE+LKL R AC GE+W  P +  F QL +L+I+  DL+ W +   +FP LE 
Sbjct  789  NIIGELPNLEILKLKRYACRGEEWH-PTEKGFTQLKLLLIEYNDLKYWNSPNDNFPVLER  847

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN-NIVDVVVAE  363
            L +  C +L++IP  FA I  L+ I+L  C P + ASA  I+ EQ + L    VDV+++ 
Sbjct  848  LVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLGKKPVDVLISS  907

Query  362  -QHG  354
             Q+G
Sbjct  908  GQNG  911



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHE-WHSTSPNMI-QINSHIFLLKSLK--GLELRRNCFEWNGI  717
            +N V+L QLE L +  E+       SP  I  I S   +LK LK  G +LR     W  +
Sbjct  734  DNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTDLR-----WEDL  788

Query  716  NVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEH  540
            N++ +LP LE+LKL R AC GE+W  P +  F QL +L+I+  DL+ W +   +FP LE 
Sbjct  789  NIIGELPNLEILKLKRYACRGEEWH-PTEKGFTQLKLLLIEYNDLKYWNSPNDNFPVLER  847

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN-NIVDVVVA  366
            L +  C +L++IP  FA I  L+ I+L  C P + ASA  I+ EQ + L    VDV+++
Sbjct  848  LVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLGKKPVDVLIS  906



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHE-WHSTSPNMI-QINSHIFLLKSLK--GLELRRNCFEWNGI  717
            +N V+L QLE L +  E+       SP  I  I S   +LK LK  G +LR     W  +
Sbjct  734  DNFVHLHQLETLSLELEFRGVLDEISPATIPSIKSFPPMLKKLKLYGTDLR-----WEDL  788

Query  716  NVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEH  540
            N++ +LP LE+LKL R AC GE+W  P +  F QL +L+I+  DL+ W +   +FP LE 
Sbjct  789  NIIGELPNLEILKLKRYACRGEEWH-PTEKGFTQLKLLLIEYNDLKYWNSPNDNFPVLER  847

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN-NIVDVVVA  366
            L +  C +L++IP  FA I  L+ I+L  C P + ASA  I+ EQ + L    VDV+++
Sbjct  848  LVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQEENLGKKPVDVLIS  906



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 102/190 (54%), Gaps = 3/190 (2%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
             +NL NL QLE L +          +   + I S      +LK L+L   C  W  ++++
Sbjct  669  FDNLANLHQLETLSLKISVPLQTKINKVPLTIPSAKAFPATLKKLKLDNTCLRWEDMDII  728

Query  707  CKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT-DLEDWKATRYHFPKLEHLS  534
             +LP LEVLKL   AC G++W  P    F +L +L+I     L+ WKAT  +FP LE L 
Sbjct  729  GELPDLEVLKLMLNACCGQEWH-PIAGGFTRLKLLLIKHNYHLKYWKATNDNFPVLERLV  787

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQHG  354
            +  C +L+E+P  FA++  L+ I+L  C   + ASA  I++EQ D  N  VDV +++ + 
Sbjct  788  ITYCTELEEMPIEFADMDSLQLIELSYCTAQLEASAARIQQEQEDLGNKPVDVRISDTYN  847

Query  353  YSWVSLPLSF  324
               + LP +F
Sbjct  848  PLLLQLPATF  857



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            ++NLV L +LE L +   +       PN+          +SLK L L  +   W  ++++
Sbjct  713  LKNLVRLSKLENLKLVFNWPLNEVLLPNLS-------FPQSLKELTLNASKLSWEDMSII  765

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              LP LEVLKL+  A  G  WE P + +F +L  L++DR +L  W A   HFP LEHL +
Sbjct  766  GSLPHLEVLKLKEHAFTGGVWE-PVEGEFSRLKFLLMDRMELVWWIAENTHFPCLEHLII  824

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
             SC  L+ IPSG  +I+ LK I +  C  S V S ++I EEQ D  NN++ V V
Sbjct  825  RSCHNLQAIPSGIGDIATLKMIDIDDCSSSAVTSVEQILEEQRDMENNVLQVRV  878



>gb|AAV31175.1| Putative disease resistance protein, identical [Solanum tuberosum]
Length=842

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 97/178 (54%), Gaps = 7/178 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHS-TSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            I+NL  LQ LE L I  +Y  W+   S     + S     + LK L+L R C  W  +++
Sbjct  614  IDNLKYLQDLESLSIAIQY--WYIINSTRFFSLTSPDSFPQKLKKLKLSRTCLPWEYMSI  671

Query  710  LCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRY---HFPKLE  543
            + KLP LEVL+L R A  G +W+  D   F +L  L+++   L+ W  T     HFP LE
Sbjct  672  ISKLPVLEVLQLKRYAFRGHKWKATDQIGFQKLRFLLLENLMLDKWTITTVSHDHFPSLE  731

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
             + +  C  LKEIP GFA+  +L+ I+L  C PS+VA A++I+E+  D   N + V  
Sbjct  732  RVLITDCIYLKEIPQGFADSKKLELIELHRCDPSLVAFAEKIQEKHEDLGRNKLKVTA  789



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 104/180 (58%), Gaps = 11/180 (6%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHST-----SPNMIQINSHIFLLKSLKGLELRRNCFEWN  723
             +NLV+L QLE L    E+  W S+     SP  I  ++  F + +L+ L+L+     W 
Sbjct  723  FDNLVHLHQLETLSF--EFRRWGSSENWRISPATIP-SAKAFPV-TLRKLKLKSTYVRWE  778

Query  722  GINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKL  546
             +N++ +LP LEVLKL   AC+GE+W  P +  F +L +L+I+  DL+ WKAT  +FP L
Sbjct  779  DLNIVGELPNLEVLKLMWKACIGEEW-YPIEGGFTRLKLLLIEHCDLKYWKATDDNFPVL  837

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            E L    C  L+EIP  FA I  L+ I+L +C   + ASA  I+EEQ +     VDV ++
Sbjct  838  ERLLFRHCRSLEEIPIVFAYIDSLQLIELTNCTTELEASAVRIQEEQEELGIKPVDVRIS  897



>ref|XP_006364072.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=584

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 115/187 (61%), Gaps = 17/187 (9%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHS-----TSPNMIQINS-HI----FLLKSLKGLELRR  741
            C++NLV+L QLE+L +  ++ E +       S + + ++S HI        +LK L L R
Sbjct  395  CLDNLVHLSQLEKLKV--QFRESYMLIFRWMSEDWMDLSSLHIPHCDNFPPNLKKLTLCR  452

Query  740  NCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDK--FCQLIVLIIDRTDLEDWKA  570
               +W  +N+L KLP LEVLKL+  A +G  W+L D+D+  F +L  L+++  +L  W+A
Sbjct  453  THIQWEDMNILRKLPNLEVLKLKHHAFLGLIWKLSDEDEDGFLKLKFLLLENMNLMQWEA  512

Query  569  TRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            T YHFP LEHL L  C  L+++P  FAEI  L+ I+L  C+ SV+ SA++I+EEQ    N
Sbjct  513  TSYHFPNLEHLVLTDCYLLEQMPFDFAEIQTLQLIELHKCKCSVLVSAEQIQEEQQSLGN  572

Query  389  NIVDVVV  369
            +  D+V+
Sbjct  573  D--DLVI  577



>ref|XP_009602412.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602413.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602414.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=895

 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 98/173 (57%), Gaps = 7/173 (4%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NL +L QLE L +     +W S +     I S      +LK L+L      W  +N++ +
Sbjct  727  NLAHLHQLETLSVEL-VRKWDSPA----TIPSIAAFPATLKKLKLVSTGVNWEDLNIVGE  781

Query  701  LPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LP LEVLKL R AC+G++W  P +  F +L +L+I   DL+ WKAT  +FP LE L +  
Sbjct  782  LPNLEVLKLMRNACIGKEW-YPIEGGFTRLKLLLIVHCDLKYWKATDDNFPVLERLLIRD  840

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            C +L+EIP  FA+I  L+ I+L  C   + ASA  I++EQ D     VDV ++
Sbjct  841  CHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQEDLGIKPVDVRIS  893



>ref|XP_009602410.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=938

 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 98/173 (57%), Gaps = 7/173 (4%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NL +L QLE L +     +W S +     I S      +LK L+L      W  +N++ +
Sbjct  770  NLAHLHQLETLSVEL-VRKWDSPA----TIPSIAAFPATLKKLKLVSTGVNWEDLNIVGE  824

Query  701  LPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LP LEVLKL R AC+G++W  P +  F +L +L+I   DL+ WKAT  +FP LE L +  
Sbjct  825  LPNLEVLKLMRNACIGKEW-YPIEGGFTRLKLLLIVHCDLKYWKATDDNFPVLERLLIRD  883

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            C +L+EIP  FA+I  L+ I+L  C   + ASA  I++EQ D     VDV ++
Sbjct  884  CHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQEDLGIKPVDVRIS  936



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 4/134 (3%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L LR     W+ + +LCKLP+LEVLKL+  A  G +WE   D++F QL  L++D T
Sbjct  729  TLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWE-STDERFQQLKFLLLDGT  787

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            DL  WKA+   FPKLE+L L +C  L EIP   AEI  L  I+L  C  S   SA  I+E
Sbjct  788  DLIHWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIRE  847

Query  410  EQLDYLNNIVDVVV  369
            EQ+   N+  D+VV
Sbjct  848  EQISMGND--DLVV  859



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 94/174 (54%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            ++NLV L +LE L     +    +  PN+          +SLK L L  +   W G++++
Sbjct  713  LKNLVRLSKLENLKCVFNWPPNETLLPNLS-------FPQSLKKLTLDGSNLSWKGMSII  765

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              LP LEVLKL+  A  G  W+ P + +F +L  L+I++  L  W A   HFP LEHL +
Sbjct  766  GSLPHLEVLKLKQYAFTGAVWK-PVEREFSRLKFLLIEKMRLVRWIAENTHFPCLEHLII  824

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
             +C  L+ IPSG  +I  LK I +  C  S V S ++I EEQ D  NN++ V V
Sbjct  825  SACHDLQAIPSGIGDIPTLKMIDIDDCSSSAVTSVEQILEEQRDMENNVLQVRV  878



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 4/134 (3%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L LR     W+ + +LCKLP+LEVLKL+  A  G +WE   D++F QL  L++D T
Sbjct  729  TLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWE-STDERFQQLKFLLLDGT  787

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            DL  WKA+   FPKLE+L L +C  L EIP   AEI  L  I+L  C  S   SA  I+E
Sbjct  788  DLIHWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIRE  847

Query  410  EQLDYLNNIVDVVV  369
            EQ+   N+  D+VV
Sbjct  848  EQISMGND--DLVV  859



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLI  612
            S   L  SLK L LR     W  +  +  LP L+VLK++     G+ W L + + F QL 
Sbjct  722  SKYALPTSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLK  781

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
             L+IDRT+L+ W A   +FPKL+ L L  C  L+EIP    EI  L+SI+L +CR SV  
Sbjct  782  FLLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAK  841

Query  431  SAQEIKEEQLDYLNNIVDVVVAEQ  360
            S +EI+EEQ    N+I+ V + E+
Sbjct  842  SVKEIQEEQESMANDILSVRIHEK  865



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 84/142 (59%), Gaps = 4/142 (3%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L LR     W+ + +LCKLP+LEVLKL+  A  G +WE   D++F QL  L++D T
Sbjct  729  TLKKLTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWE-STDERFQQLKFLLLDGT  787

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            DL  WKA+   FPKLE+L L +C  L EIP   AEI  L  I+L  C  S   SA  I+E
Sbjct  788  DLIHWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDSANRIRE  847

Query  410  EQLDYLNNIVDVVVAEQHGYSW  345
            EQ+   N+  D+VV      +W
Sbjct  848  EQISMGND--DLVVRIHKFPNW  867



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLI  612
            S   L  SLK L LR     W  +  +  LP L+VLK++     G+ W L + + F QL 
Sbjct  738  SKYALPTSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLK  797

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
             L+IDRT+L+ W A   +FPKL+ L L  C  L+EIP    EI  L+SI+L +CR SV  
Sbjct  798  FLLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAK  857

Query  431  SAQEIKEEQLDYLNNIVDVVVAEQ  360
            S +EI+EEQ    N+I+ V + E+
Sbjct  858  SVKEIQEEQESMANDILSVRIHEK  881



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score =   100 bits (249),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLI  612
            S   L  SLK L LR     W  +  +  LP L+VLK++     G+ W L + + F QL 
Sbjct  738  SKYALPTSLKRLTLRCTYLPWEDMANIVTLPNLKVLKIKDNGFDGDVWRLNNQENFVQLK  797

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
             L+IDRT+L+ W A   +FPKL+ L L  C  L+EIP    EI  L+SI+L +CR SV  
Sbjct  798  FLLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAK  857

Query  431  SAQEIKEEQLDYLNNIVDVVVAEQ  360
            S +EI+EEQ    N+I+ V + E+
Sbjct  858  SVKEIQEEQESMANDILSVRIHEK  881



>ref|XP_009764014.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=411

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 76/133 (57%), Gaps = 0/133 (0%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTD  588
            SLK L L+   F    +  +  LP LEVLK++     ++W L DD+ F QL  L+I  T 
Sbjct  274  SLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKDVFYNDEWILNDDEIFSQLKFLLISVTS  333

Query  587  LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            L  WKA   +FPKL+ L L SC  L+EIP  F EI  L+SI+L  C  S   S +E++EE
Sbjct  334  LRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKSVEELREE  393

Query  407  QLDYLNNIVDVVV  369
            Q    N+ + VV+
Sbjct  394  QESMGNDCLSVVI  406



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 95/159 (60%), Gaps = 4/159 (3%)
 Frame = -1

Query  878  LVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKL  699
            L N+++LE L      ++   T   +    S+IF  K L+ L L     EWN +++L ++
Sbjct  709  LKNVKKLESLENLKLINDSSQTGKGLRLPPSYIFPTK-LRKLSLVDTWLEWNDMSILGQM  767

Query  698  PRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSC  522
              LEVLKL+    +GE WE      FC L+VL I+RTDL  WKA+  HFP+L+HL L  C
Sbjct  768  EHLEVLKLKENGFMGECWE--SVGGFCSLLVLWIERTDLVSWKASADHFPRLKHLVLICC  825

Query  521  EKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            +KLKEIP G A+I   + ++L++   +   SA+EI++++
Sbjct  826  DKLKEIPIGLADIRSFQVMELQNSTKTAAISAREIRDKK  864



>emb|CDP21316.1| unnamed protein product [Coffea canephora]
Length=178

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 93/165 (56%), Gaps = 7/165 (4%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++ L  LQ+LE L +   Y E    S  + +I     L  +L+ L +  +   W  +  
Sbjct  7    CLKELFYLQELELLKL-CFYRE----STKIRRILFWDALPSNLRKLTISWSNQPWQNMTS  61

Query  710  LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            +  LP+LEVLKL+  A  G +WE P +  F  L  L++++TDL  W+AT  HFP LEHL 
Sbjct  62   IASLPKLEVLKLKNYAFQGPKWE-PTEGGFRVLKHLLVEKTDLVSWEATSNHFPCLEHLV  120

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            L SC+ LKE+P G  EIS LK I+L +C  S   SA  I+ E LD
Sbjct  121  LKSCKYLKEVPYGITEISTLKRIELHNCSESAEISALSIEVESLD  165



>ref|XP_009764013.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 76/133 (57%), Gaps = 0/133 (0%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTD  588
            SLK L L+   F    +  +  LP LEVLK++     ++W L DD+ F QL  L+I  T 
Sbjct  274  SLKRLTLKNTFFLLEDLTNILTLPNLEVLKMKDVFYNDEWILNDDEIFSQLKFLLISVTS  333

Query  587  LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            L  WKA   +FPKL+ L L SC  L+EIP  F EI  L+SI+L  C  S   S +E++EE
Sbjct  334  LRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKSVEELREE  393

Query  407  QLDYLNNIVDVVV  369
            Q    N+ + VV+
Sbjct  394  QESMGNDCLSVVI  406



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 83/144 (58%), Gaps = 1/144 (1%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLI  612
            S   L  SL  L LR     W  +  +  LP L+VLK++     G+ W L D++ F QL 
Sbjct  741  SKYVLPNSLMRLTLRCTYLPWEDMANIVTLPNLQVLKIKDNGFDGDAWRLSDEEIFNQLK  800

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
             L+IDRT+L+ WKA   +FPKL+HL L  C  L+EIP    EI  L+SI+L +CR S   
Sbjct  801  FLLIDRTNLKRWKAGSVNFPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAK  860

Query  431  SAQEIKEEQLDYLNNIVDVVVAEQ  360
            S +EI+EEQ    N+ + V + ++
Sbjct  861  SVKEIQEEQESMGNDCLSVRIHDK  884



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S     + I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFS-----MTISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 9/174 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLY--IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV+L QLE L   I+  ++E  S +     I+S      +LK L L R    W  +N
Sbjct  778  FDNLVHLHQLETLSFEINVPWNEVFSMT-----ISSAKVFPATLKKLTLLRTNLRWEDLN  832

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            ++ +LP LE LKL   AC GE W  P    F +L +L I    ++ WKAT   FP LE L
Sbjct  833  IIGELPNLEGLKLHEDACKGEIW-CPSPGGFTRLKLLQIHHHKIKYWKATNDSFPVLERL  891

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             +  C  L+EIP  FAEI  L+ + L+ C+P + ASA  I++EQ D  N  VDV
Sbjct  892  QIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKASAARIQQEQEDLGNKPVDV  945



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 99/173 (57%), Gaps = 8/173 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C+ENLV L QLE+L    E     S  P+ ++++  +F +K L+ L L      W  + +
Sbjct  744  CLENLVYLHQLEKLKFVVE-----SDFPSPVKLHFPVFPMK-LRKLTLSGWRLPWKDMTI  797

Query  710  LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            +  LP L+VLKLR +ACVG+ WE  + + F +L  L+I+ +DL +W     HFP L+ L 
Sbjct  798  VGSLPNLQVLKLRESACVGDTWETIEGE-FLELNFLMIEESDLRNWITESSHFPNLKWLV  856

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            +  C  L+EIP G  EI+ L+ I++      +V SA+ I+EEQ    N+ + V
Sbjct  857  IRRCRYLREIPDGIGEIATLELIEVEMRNKYLVESAKRIQEEQESLGNDALQV  909



>gb|EYU21831.1| hypothetical protein MIMGU_mgv1a0261622mg, partial [Erythranthe 
guttata]
Length=817

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 97/170 (57%), Gaps = 8/170 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL  L +LE L   + Y     +  +M+Q   +  L  SLK L L     +W  +  
Sbjct  653  CLDNLGQLHKLESLRF-SLYPGNKRSRNDMVQ---NFILPNSLKKLTLMGTKLKWEDMKT  708

Query  710  -LCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEH  540
             +C LP L+VLKL + + VG +WE  +  +FC L  L+I    DLE W     HFP+LEH
Sbjct  709  KICLLPNLQVLKLLKYSFVGTEWETVEG-QFCNLRYLLIRSCRDLEWWTTDSNHFPRLEH  767

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            L L   +KLKEIPS   EIS L+SIQL  C  S V+SA++I +EQ D+ N
Sbjct  768  LHLEDLDKLKEIPSCIGEISTLQSIQLIWCSKSAVSSAKKILKEQEDFGN  817



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 94/183 (51%), Gaps = 8/183 (4%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHI-FLLKSLKGLELRRNCFEWNG  720
            +DC  NL  L QLE L I               ++  H+  L ++LK L L      W  
Sbjct  783  SDCFRNLALLPQLEALKIFGLKPPVQEP-----KLARHLDALPENLKKLTLSFTYLPWES  837

Query  719  INVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
            +  LC+LP LEVLKL+  A  G +WE  ++  FC L +L+I+ +DLE W A+  HFP LE
Sbjct  838  MTSLCRLPNLEVLKLKNYAFTGPKWEQVEEG-FCSLKLLLIEMSDLEQWSASNDHFPCLE  896

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAE  363
            HL L  C  L  IP     I  L+ I+L +   S V SA+EI+EEQ    N+ + V +  
Sbjct  897  HLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVRIER  956

Query  362  QHG  354
              G
Sbjct  957  NFG  959



>ref|XP_009779606.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=906

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 104/178 (58%), Gaps = 10/178 (6%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHST-----SPNMIQINSHIFLLKSLKGLELRRNCFEWNGI  717
            NLV+L QLE L + A   +W S+     SP  I  ++  F + +L+ L+L      W  +
Sbjct  725  NLVHLHQLETLSL-ALVRKWDSSENWRISPATIP-SAKAFPV-TLRKLKLEETSVRWEDL  781

Query  716  NVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEH  540
            N++ +LP LEVLKL   AC+GE+W  P +  F +L +L+I+  DL+ WKAT  +FP LE 
Sbjct  782  NIVGELPSLEVLKLMWNACIGEEW-YPIEGGFTRLKLLLIEHCDLKYWKATDDNFPVLER  840

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            L +  C  L+EIP  FA+I  L+ I+L  C   + ASA  I++EQ +     VD+ ++
Sbjct  841  LLIRECHMLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQEQENLGIKPVDIRIS  898



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 97/186 (52%), Gaps = 14/186 (8%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIF----LLKSLKGLELRRNCFE  729
            +DC+ NL  L QLE L I          +P  +Q+    F    L ++LK L L      
Sbjct  750  SDCLRNLALLPQLEALKIVG------LRAP--VQVPKLAFHLDALPENLKKLTLSFTYLP  801

Query  728  WNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
            W  +  LC+LP LEVLKL+  A  G +WE  ++  FC L +L I+  DLE W A+  HFP
Sbjct  802  WESMTSLCRLPNLEVLKLKPYAFTGTKWEQVEEG-FCSLKLLQIEMFDLEHWSASNDHFP  860

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVV  372
             LEHL L  C  L  IP    +I  L+ I+L +   S V SA+EI+EEQ +  N  ++V 
Sbjct  861  VLEHLVLKCCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQNIGNETLEVQ  920

Query  371  VAEQHG  354
            +    G
Sbjct  921  LERNFG  926



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 94/183 (51%), Gaps = 8/183 (4%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHI-FLLKSLKGLELRRNCFEWNG  720
            +DC  NL  L QLE L I               ++  H+  L ++LK L L      W  
Sbjct  798  SDCFRNLALLPQLEALKIFGLKPPVQEP-----KLARHLDALPENLKKLTLSFTYLPWES  852

Query  719  INVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
            +  LC+LP LEVLKL+  A  G +WE  ++  FC L +L+I+ +DLE W A+  HFP LE
Sbjct  853  MTSLCRLPNLEVLKLKNYAFTGPKWEQVEEG-FCSLKLLLIEMSDLEQWSASNDHFPCLE  911

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAE  363
            HL L  C  L  IP     I  L+ I+L +   S V SA+EI+EEQ    N+ + V +  
Sbjct  912  HLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLSAKEIQEEQQSCGNDALQVRIER  971

Query  362  QHG  354
              G
Sbjct  972  NFG  974



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 95/180 (53%), Gaps = 16/180 (9%)
 Frame = -1

Query  875  VNLQQLERLYI-HAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKL  699
            V+L  L RL I      +W  TS       S +    S++ L L +    W  +  +  L
Sbjct  557  VDLSHLHRLEILKCSARKWSRTSI------SKLDFPPSIRKLTLSKLTIHWGFMTTIGLL  610

Query  698  PRLEVLKLRAACVGEQWELPDDDK--------FCQLIVLIIDR-TDLEDWKATRYHFPKL  546
            P LEVLK+R      Q   P DD+        FC L  L++++  +L  W+A   H P+L
Sbjct  611  PNLEVLKIRKCTFKGQEMQPRDDEEWVLTEGEFCSLQFLLLEKLKNLVHWQADETHLPRL  670

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
             HL +  C  L+EIPSG  EI  L+ I+L  C PSVVASA++I+E+Q +Y N+ ++V ++
Sbjct  671  RHLLIRGCSALEEIPSGIGEIPTLEIIELDECSPSVVASAKQIQEDQREYGNDGLEVRIS  730



>emb|CDP04753.1| unnamed protein product [Coffea canephora]
Length=1258

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 90/145 (62%), Gaps = 3/145 (2%)
 Frame = -1

Query  770   KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDR  594
             ++LK L L  N   W+ I+ + KLP L+VLKL+  A  GE+W + ++ +F  L VL + R
Sbjct  1116  RNLKKLTLSDNKQPWSEISTIGKLPNLQVLKLKHEAFAGEEW-VKEEGEFPSLRVLKLAR  1174

Query  593   TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
              D   W A   +FP+LE L L++C +L+E+PS   E   L++I++  C  SVV+S ++I+
Sbjct  1175  LDFRRWTAASDNFPRLEQLVLYNCRELEEVPSCLGECPTLEAIEVGRCGESVVSSVEKIQ  1234

Query  413   EEQLDYLNNIVDVVVAEQHGYSWVS  339
             EEQ+D  N  + + + E+ G +W+ 
Sbjct  1235  EEQMDMGNEDLKIAI-EKCGDAWIG  1258



>gb|EYU21836.1| hypothetical protein MIMGU_mgv1a023326mg [Erythranthe guttata]
Length=923

 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 102/179 (57%), Gaps = 10/179 (6%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV-  711
            ++NL +L +LE L  +    +  S + +M+Q   +  L  SLK L L   C +W  + + 
Sbjct  752  VDNLGHLHKLESLRFYIYSLKMRSVN-DMVQ---NFILPNSLKKLTLMGTCLKWEDMKLK  807

Query  710  LCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEHL  537
            +  LP L+VLKL + + VG +WE  +  +FC L VL+I    DL+ W     HFP+LEHL
Sbjct  808  IGLLPNLQVLKLEKESFVGHKWETIEG-QFCNLKVLLISLCRDLQWWTTDNNHFPRLEHL  866

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQ  360
             L    KLKEIPS   EIS L+SIQL  C    V SA++I +EQ D+ N  VD+ +  Q
Sbjct  867  HLQGLHKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKQILKEQEDFGN--VDLRLVHQ  923



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score = 97.4 bits (241),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 93/159 (58%), Gaps = 4/159 (3%)
 Frame = -1

Query  878  LVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKL  699
            L N+++LE L      ++   T   +    S+IF  K L+ L L     EWN +++L +L
Sbjct  710  LKNVKKLEYLENLKLINDSSQTGKGLRLPPSYIFPTK-LRKLSLVDTWLEWNDMSILGQL  768

Query  698  PRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSC  522
              LEVLKL     +GE WE      FC L+VL I+RTDL  WKA+  HFP+L+HL L  C
Sbjct  769  EHLEVLKLIENGFMGECWE--SVGGFCSLLVLWIERTDLVSWKASADHFPRLKHLVLICC  826

Query  521  EKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            +KLKEIP G A+I   + ++L++   +   SA++I+ ++
Sbjct  827  DKLKEIPIGLADIRSFQVMELQNSTKTAAISARDIRAKK  865



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score = 97.4 bits (241),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 99/176 (56%), Gaps = 6/176 (3%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHE---WHSTSPNM-IQINSHIFLLKSLKGLELRRNCFEWNG  720
            + +LV+L  LE L I  + ++   W S    + + + S I     LK L+L      W  
Sbjct  724  LRHLVDLHHLETLSIKVDRYQVSHWSSRFHKLPVYVPSAIHFPTKLKKLKLVGTRLSWEE  783

Query  719  INVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
            +N++ + P LEVLKL+  AC G +W  P +  F +L  L+I+ T+L  WKAT  HFP LE
Sbjct  784  LNIVGQWPNLEVLKLKPNACRGLKWH-PIEGGFPRLKFLLIEGTNLTRWKATNDHFPALE  842

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            HL +  C  L +IP  FA+I  L+ I+L++C+  ++AS   I+EEQ    +  VDV
Sbjct  843  HLVIKHCFHLVKIPIEFADIYSLQLIELQNCKAKLMASTVRIQEEQEYLGSKPVDV  898



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score = 97.4 bits (241),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 102/186 (55%), Gaps = 14/186 (8%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV-  711
            ++NL  L +LE L +       +S + +++Q   +  L  SLK L L   C +W  +   
Sbjct  681  LDNLGQLHKLESLRLSI-----YSENKHLLQ---NFILPNSLKKLTLMGTCLKWEDMKTK  732

Query  710  LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEHL  537
            +C LP L+VLKL+  + VG +WE  +  +FC L  L+I    DLE W     HFP+LEHL
Sbjct  733  ICLLPNLQVLKLKEYSFVGTEWETVEG-QFCNLRYLLIRSCRDLEWWTTDSSHFPRLEHL  791

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQH  357
             L    KLKEIPS   EIS L+SI+L SC    V SA++I +EQ D+ N    V V +  
Sbjct  792  HLRYLHKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFGNEDFRVQVFDTM  851

Query  356  --GYSW  345
              G +W
Sbjct  852  SLGETW  857



>gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Erythranthe guttata]
Length=905

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 95/171 (56%), Gaps = 8/171 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NLV L +LE       +  W+   PN   +  +  L  SLK L L R    W  +  
Sbjct  716  CLDNLVRLHKLESFGCF--FFTWNR--PNRDDVLRNFILPNSLKKLTLHRTNLYWEDMKT  771

Query  710  -LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVL-IIDRTDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL+A + VG +WE  +  +FC L  L I D +DLE W     HFP+LE 
Sbjct  772  KIGLLPNLQVLKLKANSFVGTEWETVEG-QFCNLKFLQICDCSDLERWTTESAHFPRLEQ  830

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNN  387
            L L   ++L+EIPS   EI  L+SI+++ C  + V SA+ I +EQ ++ NN
Sbjct  831  LDLRHLDRLEEIPSDIGEIPTLQSIRVQYCSKTAVISARRILDEQEEFDNN  881



>gb|EYU31596.1| hypothetical protein MIMGU_mgv1a025161mg [Erythranthe guttata]
Length=754

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 93/168 (55%), Gaps = 6/168 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV-  711
            ++N+ +L +LE L     +  +    P++  +  +I L  SL  L L R C +W  +   
Sbjct  581  VDNIGHLHKLESL----RFSLYSLKKPSVNDLVQNIILPNSLMKLTLHRTCLKWEDMKTK  636

Query  710  LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            +  LP L+VLKL+  + VG +WE  +        +LI   +DLE W     HFP+LEHL 
Sbjct  637  IGLLPNLQVLKLKEYSFVGTEWETVEGQFRNLKFLLIYMCSDLEWWTTGSNHFPRLEHLH  696

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            L   +KLKEIPS   EIS L+SIQL  C  S V SA+EI +EQ D+ N
Sbjct  697  LQLLDKLKEIPSCIGEISTLQSIQLIWCSKSAVISAKEILKEQQDFGN  744



>ref|XP_011072557.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=891

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 92/176 (52%), Gaps = 9/176 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL  L +LE L    +      + P    + +++    SL+ L L RN   W  I  
Sbjct  700  CLQNLDRLHKLESLACTFQ------SRPRRSLLLNNLSFPYSLRKLNLYRNGLHWEDIAT  753

Query  710  -LCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEHL  537
             +  LP LEVLKL  A +G +WE  +  +FC L VL++D   DL+ W     HFP LEHL
Sbjct  754  KIGSLPFLEVLKLFDAVMGPKWETVEG-QFCSLKVLLVDGCYDLKSWTTESSHFPCLEHL  812

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
             L     LKE P G  EI  L++IQL  C  S + + + I EEQ +  N+ V V+V
Sbjct  813  ILIEAGNLKEFPPGIGEIPTLQTIQLIFCSSSAIVTTKRIVEEQEELGNSGVHVLV  868



>gb|EYU21837.1| hypothetical protein MIMGU_mgv1a021514mg [Erythranthe guttata]
Length=745

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 97/171 (57%), Gaps = 12/171 (7%)
 Frame = -1

Query  887  IENLVNLQQLE--RLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
            ++NL +L +LE  R  +H+E        P++  +  +  L  SLK L L     +W  +N
Sbjct  552  LDNLGHLHKLESLRFSLHSE------NKPSLNDMVQNFILPNSLKKLTLIGTKLKWEDMN  605

Query  713  V-LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLE  543
              +  LP L+VLKL+  + VG +WE  +  +FC L  L+I   ++LE W     HFP+LE
Sbjct  606  TKIGLLPNLQVLKLKEYSFVGTEWETVEG-QFCNLKFLLIHMCSELEWWATDSSHFPRLE  664

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            HL L   +KLKEIPS   EIS L+SIQL  C    V SA+EI +EQ D+ N
Sbjct  665  HLQLQFLDKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKEILKEQEDFGN  715



>ref|XP_004243493.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=858

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 86/168 (51%), Gaps = 9/168 (5%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
            DC   L+ LQ L  L I A      + S N     S    L +L  L L    F W  + 
Sbjct  690  DC---LIVLQGLVTLNIQA------AASLNSPFFLSRDIFLPNLTKLSLNSTFFPWEDMA  740

Query  713  VLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            VL KLP LEVLK   A  G  W+L +D  F +L  L +   +LE W+AT  +FP LE L 
Sbjct  741  VLAKLPNLEVLKADNAFWGTDWKLDEDVVFPKLNCLAVRHGNLERWEATSDNFPMLEELY  800

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            L     L+EIP    EI  LKSI++R C  +V+ SA++I+E Q  Y N
Sbjct  801  LSWLHLLEEIPESIGEIMTLKSIEIRGCNSAVITSAKQIRENQEIYGN  848



>gb|EYU21833.1| hypothetical protein MIMGU_mgv1a009417mg [Erythranthe guttata]
Length=342

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 92/167 (55%), Gaps = 12/167 (7%)
 Frame = -1

Query  890  CIENLVNLQQLE--RLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGI  717
            C++NL +L +LE  R  I   + +     PN    N    L  SLK L L     +W  +
Sbjct  183  CLDNLGHLHKLESLRFTIGTLFKQ----PPNDWVQN--FILPNSLKKLTLMGTKLKWEDM  236

Query  716  NV-LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKL  546
               +  LP LEVLKLR  + VG +WE  +  +FC L  L+I   +DLE W     HFP+L
Sbjct  237  KTKIGWLPNLEVLKLRYKSFVGTEWETAEG-QFCNLRYLLISSCSDLEWWTTDSNHFPRL  295

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            EHL L   +KLKEIPS   EIS L+SIQL SC    V SA++I +EQ
Sbjct  296  EHLHLEDLDKLKEIPSCIGEISTLQSIQLLSCSDEAVISAEQILKEQ  342



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 3/172 (2%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NL  L++LE L +        +  P +I  +S  F   +LK L L R C  WN +N+  K
Sbjct  698  NLKYLKELEALMVTVPPGFISNRLPCLINPSSGSFP-PNLKKLTLSRTCLPWNCMNIFSK  756

Query  701  LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LP LEVL+L+  AC G +WE+ +   F +L  L+++   L  W AT  +F  LE + +  
Sbjct  757  LPNLEVLELKNLACSGNEWEITEMG-FPKLKCLLLEDLYLRYWTATDDYFQCLERVCIRE  815

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            C+ LKEIP GFA+   L+ I+L  CR  +V  A++I+E+  +  NN++ V V
Sbjct  816  CKLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQEKHEELGNNMLKVYV  867



>ref|XP_010320708.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=866

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/169 (41%), Positives = 95/169 (56%), Gaps = 8/169 (5%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
            D ++ LV+LQ+LE+L I A        SP  +   S  F  ++LK L L      W  ++
Sbjct  690  DFVDCLVDLQRLEKLSITAS----DDNSPCFL---SSAFYARNLKHLRLGYTSLPWEEMD  742

Query  713  VLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLII-DRTDLEDWKATRYHFPKLEHL  537
            VL  LP LEVLK  +A  G  W L +D  F +L  L I    DLE W+AT  +FP LEHL
Sbjct  743  VLANLPNLEVLKADSAFNGTNWTLNEDIVFQKLKYLRIWSADDLERWEATTDNFPMLEHL  802

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
             L   ++L+EIP  F EI  LK +++ +C P+V +SA+ I EEQ  + N
Sbjct  803  VLLDLDELEEIPQSFGEIMTLKFVRVENCNPAVDSSARNILEEQQGWGN  851



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 91/172 (53%), Gaps = 7/172 (4%)
 Frame = -1

Query  905  TECNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEW  726
            ++C   ++ L  LQ+LE L I A+      + P ++   S      +LK L+L     +W
Sbjct  666  SDCPAILDPLSLLQELETLTIEADL----GSDPMIL---SRDIFPPNLKQLKLSYTTLQW  718

Query  725  NGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKL  546
              + VL  LP LEVLK  +A  G  W L +D  F +L  L +    LE W+AT  +FP L
Sbjct  719  EDMVVLANLPNLEVLKAYSAFEGTYWRLNEDVVFQKLKYLRLQYGSLERWEATNDNFPML  778

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            E L L+   KL+EIP    EI  LK IQ+  C  + V SA++I++EQ  + N
Sbjct  779  EQLLLYGFRKLEEIPQSIGEIMILKLIQIERCSAAAVTSAKKIQQEQESWGN  830



>ref|XP_009762295.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=169

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 3/124 (2%)
 Frame = -1

Query  734  FEWNGINVLCKLPRLEVLKLRAACV-GEQ-WELPDDDKFCQLIVLIIDRTDLEDWKATRY  561
            F W+ I++L  LP LE LKL+ A V G+Q W L D+DKF Q + L+     LE W+A+  
Sbjct  41   FHWDDISILVMLPNLEELKLKVAVVTGDQVWRLSDEDKF-QSLKLLFKGIHLERWEASSD  99

Query  560  HFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIV  381
             FP L  L L +C  LKEIP+ F E   L+SI+  +C      SA+ I++EQ D  NN +
Sbjct  100  SFPNLRRLVLKNCNYLKEIPTNFGEFCTLESIEFHNCSSLAEDSARNIEQEQEDMGNNSL  159

Query  380  DVVV  369
             V +
Sbjct  160  KVYI  163



>ref|XP_011087308.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=774

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 105/207 (51%), Gaps = 30/207 (14%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLK---------------  759
            + +E + NL++L  LY+H    EW +   N      H+  L++LK               
Sbjct  555  EVLEIMPNLKKLGILYVHDSSTEWSTYEFNNF---VHLHKLETLKCLFSAKDDLVRKPLP  611

Query  758  -----GLELRR----NC-FEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
                  L+L++     C   W  + V+  LP L+VLKLR  A  G  WE P++ +F +L 
Sbjct  612  LNLAFPLDLKKLTLSGCRLSWEKMTVIGSLPNLQVLKLRDYAFEGSVWE-PNEGEFTKLK  670

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
             L+IDR  LE W A   HFP+L+HL L  C +L+ IP+   +I  L+ ++L  CR SVVA
Sbjct  671  YLLIDRNKLERWCADYTHFPQLQHLCLCHCFELEAIPTEVGDIGTLEMLELFRCRSSVVA  730

Query  431  SAQEIKEEQLDYLNNIVDVVVAEQHGY  351
            SA  I+EEQ +  N  + V V     Y
Sbjct  731  SAMLIQEEQRNLGNEGLIVRVNSYRDY  757



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 99/184 (54%), Gaps = 10/184 (5%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNMI-QINSHI-FLLKSLKGLELRRNCFEWN  723
            +DC+ NL  L QL+ L I         T P  + ++  H+  L ++LK L L      W 
Sbjct  742  SDCLRNLALLPQLKALKIVG------LTPPVQVPKLALHLDALPENLKKLTLSFTYLPWE  795

Query  722  GINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKL  546
             +  LC+LP LEVLKL+  A  G +WE  ++  F  L +L+I+ +D++ W A+  HFP L
Sbjct  796  SMASLCRLPNLEVLKLKNYAFTGPKWEQVEEG-FGSLKLLLIEISDIKHWSASNDHFPVL  854

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            EHL L SC  L  IP    +I  L+ I+L +   S V SA+EI+EEQ    N  ++V + 
Sbjct  855  EHLVLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEEQQSMGNETLEVRME  914

Query  365  EQHG  354
               G
Sbjct  915  RNFG  918



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 101/179 (56%), Gaps = 12/179 (7%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHE-WHSTSPNMI-QINSHIFLLKSLK--GLELRRNCFEWNGI  717
            +N V+L QLE L +  ++    +  SP  I  + S   +LK LK  G  LR     W  +
Sbjct  693  DNFVHLHQLETLSLELDFRGVLYEISPATIPSVKSFPPMLKKLKLYGTGLR-----WEDL  747

Query  716  NVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEH  540
            N++ +L  LE+LKL R AC GE+W  P ++ F +L +L+I+  DL+ W +    FP LE 
Sbjct  748  NIIGELRNLEILKLKRYACRGEEWH-PSENGFTRLKLLLIEYNDLKYWSSPNDSFPVLER  806

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN-NIVDVVVA  366
            L +  C +L++IP  FA I  L+ I+L  C P + ASA  I+ EQ + L    VDV+++
Sbjct  807  LVIRHCSELEDIPIDFAYIDSLQQIELTDCTPELEASAARIQHEQKENLGKKPVDVLIS  865



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 97/181 (54%), Gaps = 9/181 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL +L +LE L             P++  +  +  L  SLK L L     +W  +N 
Sbjct  582  CLDNLGHLHKLESLRFSLN----PINKPSLNDLVENFILPNSLKKLTLEGTYLKWEEMNT  637

Query  710  -LCKLPRLEVLKLRAAC-VGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL+A+  VG +WE  +  +FC L  L+I+  +DLE W      FP+LEH
Sbjct  638  KIGLLPNLQVLKLKASSFVGAEWETVEG-QFCNLRYLLINMCSDLEWWTTDSSSFPRLEH  696

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQ  360
            L L   +KL EIPSG  EI  L+SI+L  C    V SA+ I +EQ D L   V VV  + 
Sbjct  697  LVLQQLDKLNEIPSGIGEIPTLQSIELNLCHDDAVISAKSIFDEQED-LGLRVRVVARDS  755

Query  359  H  357
            H
Sbjct  756  H  756



>gb|EYU31599.1| hypothetical protein MIMGU_mgv1a025745mg, partial [Erythranthe 
guttata]
Length=692

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 98/170 (58%), Gaps = 12/170 (7%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL +L +LE L         +S + +++Q   +  L  SLK L L     +W+ +  
Sbjct  509  CLDNLDHLHKLESLRFSL-----YSKNKHLVQ---NFILPNSLKKLTLWGTMLKWDDMKT  560

Query  710  -LCKLPRLEVLKLRAAC-VGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL+A+  VG +WE  +  +FC L  L+I    DLE W     HFP+LEH
Sbjct  561  KIGLLPSLQVLKLKASSFVGTEWETIEG-QFCNLRYLLIRSCRDLEWWTTDSNHFPRLEH  619

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            L L   +KLKEIPS   EIS L+SI+L SC    V SA++I +EQ D+ N
Sbjct  620  LHLQFLDKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQEDFGN  669



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 97/170 (57%), Gaps = 8/170 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL +L +LE L     Y    ++  +++Q   +  L  SLK L L     +W  +N 
Sbjct  613  CLDNLGHLHKLESLRF-ILYPRNKASLNDLVQ---NFILPNSLKKLTLMGTKLKWEDMNT  668

Query  710  -LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL+  + VG +WE  +  +FC L  L+I   ++LE W     HFP+LEH
Sbjct  669  KIGLLPNLQVLKLKEYSFVGTEWETVEG-QFCNLKFLLIHMCSELEWWTTDSSHFPRLEH  727

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            L L   +KLKEIPS   EIS L+SIQL  C    V SA+EI +EQ D+ N
Sbjct  728  LQLQFLDKLKEIPSCIGEISTLQSIQLLRCSNEAVISAKEILKEQEDFGN  777



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 99/180 (55%), Gaps = 12/180 (7%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQI----NSHIFLLKSLKGLELRRNCFEWNG  720
             +NL  L  LE L +    ++     P+  QI     S+ F   +LK L L     +W+ 
Sbjct  708  FDNLAKLDNLETLKL---LNDTFPLPPSQCQIPGLPQSYKFP-PNLKKLTLSDTFLDWSH  763

Query  719  INVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
            I+ L  LP LEVLKL+  A  G QWE P D  F  L VL I RT+LE W A+ +HFP+L+
Sbjct  764  ISTLGMLPNLEVLKLKDYAFKGTQWE-PLDGGFRLLRVLHIGRTNLEHWNASGHHFPRLQ  822

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQL--DYLNNIVDVVV  369
             + L  C  L EIP G  E+S L++I+L    P+  ASA+ I++E+   D  +N+  +V+
Sbjct  823  QVFLKHCSSLNEIPFGLVEVSSLQNIELFWPTPAAAASARIIQQEKQEGDIKDNVFKLVI  882



>gb|EYU31597.1| hypothetical protein MIMGU_mgv1a001843mg [Erythranthe guttata]
Length=751

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 99/181 (55%), Gaps = 8/181 (4%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NLV L +LE       +  W+   PN   +  +  L  SLK L L R    W  +  
Sbjct  556  CLDNLVRLHKLESFGCF--FFTWNR--PNRDDVLRNFILPNSLKKLTLHRTNLYWEDMKT  611

Query  710  -LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVL-IIDRTDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL+A + VG +WE  +  +FC L  L I D +DLE W     HFP+LE 
Sbjct  612  KIGLLPNLQVLKLKANSFVGTEWETVEG-QFCNLKFLQICDCSDLERWTTESAHFPRLEQ  670

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQ  360
            L L   ++L+EIPS   EI  L+SI+++ C  + V SA+ I +EQ ++ N  + V V  +
Sbjct  671  LDLRHLDRLEEIPSDIGEIPTLQSIRVQYCSKATVISARRILDEQEEFDNVGLRVRVVAR  730

Query  359  H  357
            +
Sbjct  731  N  731



>ref|XP_009761713.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
[Nicotiana sylvestris]
Length=320

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 90/166 (54%), Gaps = 7/166 (4%)
 Frame = -1

Query  902  ECNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWN  723
            +C   ++ L  LQ+LE L I A+         +++ ++  IF   +LK L+L     +W 
Sbjct  149  DCPAILDPLSLLQELETLTIEADL------GSDLMILSRDIFP-PNLKQLKLSYATLQWE  201

Query  722  GINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
             + VL  LP LEVLK  +A  G  W+L +D  F +L  L +    LE W+AT  +F  LE
Sbjct  202  DMVVLANLPNLEVLKAYSAFEGTNWKLNEDVVFQKLKYLRLQYGGLERWEATNDNFSMLE  261

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
             L L+   KL+EIP    +I  LK IQ+  C  + V SA++I++EQ
Sbjct  262  QLLLYGFRKLEEIPQSIGDIMILKLIQIERCSAAAVTSAKKIQQEQ  307



>ref|XP_009609967.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=468

 Score = 93.6 bits (231),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 79/144 (55%), Gaps = 3/144 (2%)
 Frame = -1

Query  824  WHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQW  648
            W    P  I I   +F   SLK L L    F W  I+ L  LP LE LKL+   V G  W
Sbjct  325  WEYDVPKPISIKMFVFP-TSLKRLTLYEFRFPWKDISTLAMLPNLEELKLKYNAVKGGVW  383

Query  647  ELPDDDKFCQLIVLIIDRTDL-EDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLK  471
             L D+DKF  L +L+I  T     W+A+  +FP L+ L L +C  LK+IP+ F EI  L+
Sbjct  384  RLSDEDKFESLKLLLIATTTFFHHWEASSDNFPNLKRLVLNNCHYLKQIPTDFGEICSLE  443

Query  470  SIQLRSCRPSVVASAQEIKEEQLD  399
            SI+L  C  +   SA++IK+EQ D
Sbjct  444  SIELHYCNTTAEDSARKIKQEQQD  467



>ref|XP_006348578.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=915

 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 95/182 (52%), Gaps = 7/182 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRN-CFEWNGIN-  714
            I ++ +L +LE L   +EY  W ST P  I+     F  KSLK L L    CF W+ I+ 
Sbjct  662  ITDMSSLTKLEALKCVSEYF-WFSTPPISIK---QSFFPKSLKRLTLDGGFCFPWDDIST  717

Query  713  VLCKLPRLEVLKLRAACVGEQ-WELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            +L  LP LE LKL+     +  W L  + KF  L  L+    +L+ W+A+  +FP L  L
Sbjct  718  LLVMLPNLEELKLKDHAANDHVWRLSAETKFESLKFLLFHGLNLKYWEASSDNFPNLRRL  777

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQH  357
             L  C KL EIP  F EI  L+SI+L  C      SA++I++EQ D  NN + + +    
Sbjct  778  VLKKCTKLNEIPIDFGEICTLESIELYQCGVGAEESARKIEQEQEDMGNNFLKIFIHGIE  837

Query  356  GY  351
             Y
Sbjct  838  AY  839


 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = -1

Query  578  WKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            W+A+   FP L+ L+L  C  L EIP+ F EI   +SI+L  C      SA++I++EQ D
Sbjct  850  WEASSDSFPNLKRLALKKCNYLNEIPTDFGEICTFESIELYQCSIGAEESARKIEQEQED  909

Query  398  YLNN  387
              NN
Sbjct  910  MGNN  913



>gb|EYU21829.1| hypothetical protein MIMGU_mgv1a001470mg [Erythranthe guttata]
Length=813

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 90/167 (54%), Gaps = 8/167 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL  L++LE             + PN   +  +  L  SLK L L R  F W  +N 
Sbjct  625  CLDNLCRLRKLESFGCSF----LSQSVPNRDDMLQNFILPNSLKKLTLWRTKFYWEDMNT  680

Query  710  -LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL A ACVG +WE   + +FC L  L+I+  ++LE W     HFP LEH
Sbjct  681  NIGLLPNLQVLKLSADACVGTEWETV-EGQFCNLRYLLINSCSELEWWTTDSSHFPCLEH  739

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            L L   +KL EIPS   EI  L+SI+L  C    V SA+ I +EQ D
Sbjct  740  LVLQQLDKLNEIPSCIGEIPTLQSIELNLCHDDAVISAKRIFDEQED  786



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 83/154 (54%), Gaps = 15/154 (10%)
 Frame = -1

Query  827  EWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQ  651
            +W++  PN             L+ L L  +   W  +  + K+P LEVLKL+  A  G+ 
Sbjct  768  QWNAFPPN-------------LRALTLSGSHLPWEEMVTVGKIPNLEVLKLKDRAFSGQV  814

Query  650  WELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLK  471
            WE P D  F  L  L+++  +LE WKAT  H+P L+HL L  C+ L EIP G  EI  L+
Sbjct  815  WE-PIDGGFLALKFLLLENNELEIWKATSTHYPSLQHLVLRLCDALIEIPCGIGEIPTLQ  873

Query  470  SIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
             I+L SC  S V SA+ I EEQ    N+ ++V +
Sbjct  874  IIELYSCGHSAVRSAKRIHEEQQSIGNDDLEVRI  907



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 81/150 (54%), Gaps = 1/150 (1%)
 Frame = -1

Query  776  LLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLII  600
            L  SL  L L      W  I  +  LP LEVLK++     G  W L D++ F QL +L+I
Sbjct  422  LPTSLNSLTLTDTYLPWEDIANIVMLPNLEVLKIKYHGFYGAFWRLNDNEIFNQLKLLLI  481

Query  599  DRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQE  420
            + T L+ W A   +FPKL+ L L  C  L+EIP  F EI  L+SI+L  C+ S  ASA+ 
Sbjct  482  NETYLKHWDAGSVNFPKLQRLVLKRCFDLEEIPKDFGEICTLESIELHKCKTSAAASAKN  541

Query  419  IKEEQLDYLNNIVDVVVAEQHGYSWVSLPL  330
            I+EEQ    N+ + V++ +       ++P 
Sbjct  542  IQEEQESMGNDCLSVLINDSGPAQAQAVPF  571



>ref|XP_006364178.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=860

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 90/172 (52%), Gaps = 6/172 (3%)
 Frame = -1

Query  905  TECNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEW  726
            TE N  ++ L+ L+ L  L I A      + S N     S    L +L  L L    F W
Sbjct  685  TEWNAFLDCLLVLEGLVTLNIQA------AASLNSPFFLSKDIFLPNLAKLSLNSTFFPW  738

Query  725  NGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKL  546
              + VL KLP LEVLK   A  G  W+L +D  F +L  L +   +LE W+AT  +FP L
Sbjct  739  EDMAVLAKLPNLEVLKADNAFWGTDWKLDEDVVFPELKYLGVHHGNLEIWEATSDNFPML  798

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            E L+L     L+EIP    EI  L+SI+++ C  +V+ SA++I+E Q  Y N
Sbjct  799  EELNLSWLHFLEEIPESIGEIMTLRSIEIKDCNSAVITSAEQIRENQEIYGN  850



>gb|EYU21838.1| hypothetical protein MIMGU_mgv1a001107mg [Erythranthe guttata]
Length=888

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 90/167 (54%), Gaps = 8/167 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL  L++LE             + PN   +  +  L  SLK L L R  F W  +N 
Sbjct  697  CLDNLCRLRKLESFGCSF----LSQSVPNRDDMLQNFILPNSLKKLTLWRTKFYWEDMNT  752

Query  710  -LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL A ACVG +WE   + +FC L  L+I+  ++LE W     HFP LEH
Sbjct  753  NIGLLPNLQVLKLSADACVGTEWETV-EGQFCNLRYLLINSCSELEWWTTDSSHFPCLEH  811

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            L L   +KL EIPS   EI  L+SI+L  C    V SA+ I +EQ D
Sbjct  812  LVLQQLDKLNEIPSCIGEIPTLQSIELNLCHDDAVISAKRIFDEQED  858



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 1/144 (1%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLI  612
            S   L  SL  L LR     W  +  +  LP L+VLK++     G+ W L D+  F QL 
Sbjct  741  STYVLPTSLVRLTLRCTYLPWEDMANIVMLPNLQVLKIKDNGFDGDAWRLSDEQIFNQLK  800

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
             L+IDRT+++ WKA   +FPKL+ L L  C  L+EIP    E+  L+SI+L +CR S   
Sbjct  801  YLLIDRTNVKSWKAGSVNFPKLQRLVLKRCIYLEEIPKDIGEVYTLESIELLNCRTSAAK  860

Query  431  SAQEIKEEQLDYLNNIVDVVVAEQ  360
            S +EI+EEQ    N+ + V + ++
Sbjct  861  SVKEIQEEQESMGNDCLSVRIHDK  884



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 93/173 (54%), Gaps = 12/173 (7%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            + NL NL QLE L      H   ST P+           K+LK L   +       + +L
Sbjct  701  LHNLCNLDQLEELKFDGMPH---STLPHPEAFP------KNLKKLSFSKTHVNLEDLRIL  751

Query  707  CKLPRLEVLKLR--AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
             KLP+LE LKL+  ++ +G +WE+ ++  F QL  L++ R  +  W+A+  HFP+LE L 
Sbjct  752  SKLPKLEALKLKFCSSNIGMEWEVTEEG-FPQLKFLLLSRLGIRHWRASSDHFPRLERLF  810

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            L  C  +  IP  F EI+ L+ I +R C+ SVV SA++I++E  D     ++V
Sbjct  811  LVECANMISIPEDFVEITTLQLIDIRMCKESVVNSAKKIQQEIEDNYGGSIEV  863



>ref|XP_011072173.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=869

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 88/171 (51%), Gaps = 14/171 (8%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C+ NL +L +LE L + AE      T+              SLK L L +    W  I +
Sbjct  697  CLHNLAHLHRLESLSLIAEDLLLEKTA-----------FPTSLKRLSLSKCRIPWGHITI  745

Query  710  LCKL-PRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
            +  L P LEVLKL   A  G +W  P + +F +L VL I  +DL  W+A  +HFP LE L
Sbjct  746  IGSLLPNLEVLKLLNNAFRGSEWS-PVEGQFPRLKVLFISDSDLVSWRADDFHFPHLESL  804

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNI  384
             L    KL+EIPSG   I  L+SI L  C   VV SA++I EEQ  Y N +
Sbjct  805  FLRLMHKLEEIPSGIGHIETLRSIHLNKCSELVVNSAKQILEEQSSYGNEL  855



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 95/164 (58%), Gaps = 5/164 (3%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            ++NL NLQ LE L     +++ ++ +P +++ +   F L +L+ L L  +   W  I  +
Sbjct  840  LKNLANLQYLEAL--KCSFYKQNAEAPRILRPSVLHFPL-TLRKLTLSWSYLPWKDIACI  896

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              LP LEVLKL+  A  G  WE P ++ F +L   +ID T+LE+W+A+  +FP LEHL L
Sbjct  897  AMLPNLEVLKLKNYAFQGPDWE-PTEEAFRRLKHFLIDSTNLENWEASSDNFPCLEHLVL  955

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
              C+ LK IP G  EI+ L+  +L  C  S   SA+ I+ E LD
Sbjct  956  RGCKFLKGIPDGIEEINTLQRFELHYCSESAEISAKGIEVEGLD  999



>ref|XP_009777084.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=838

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 7/155 (5%)
 Frame = -1

Query  869  LQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRL  690
            LQ+LE L I A+         +++ ++  IF   +LK L+L     +W  + VL  LP L
Sbjct  678  LQELETLTIEADL------GSDLMILSRDIFP-PNLKQLKLSYTTLQWEDMVVLANLPNL  730

Query  689  EVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLK  510
            EVLK  +A  G  W+L +D  F +L  L +    LE W+AT   FP LE L L+   KL+
Sbjct  731  EVLKAYSAFEGTNWKLNEDVVFQKLKYLRLQYGGLERWEATNDSFPMLEQLLLYGFRKLE  790

Query  509  EIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            EIP    +I  LK IQ+  C  + V SA++I+EEQ
Sbjct  791  EIPQSIGDIMILKLIQIERCSAAAVTSAKKIQEEQ  825



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 78/143 (55%), Gaps = 0/143 (0%)
 Frame = -1

Query  797  QINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQ  618
            Q+     L  SLK L L    F    +  +  LP LEVLK++     ++W L D++ F Q
Sbjct  707  QLPRKFSLPTSLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKDVFENDEWRLNDEEIFSQ  766

Query  617  LIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSV  438
            L  L+I  T L  W+A   +FPKL+ L L SC  L+EIP  F EI  L+SI+L  C  S 
Sbjct  767  LKFLLISVTFLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSA  826

Query  437  VASAQEIKEEQLDYLNNIVDVVV  369
              S +E++EEQ    N+ + VV+
Sbjct  827  AKSVEELQEEQKSMGNDCLTVVI  849



>ref|XP_010319214.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=882

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 97/185 (52%), Gaps = 4/185 (2%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            I+NL  LQ LE + I      +   + +   + S     + LK L+LR     W  I+++
Sbjct  678  IDNLKYLQHLESVSIENIDFIFQKNTTSFFSLTSPDSFPQKLKELKLRCTYLPWECISII  737

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRY---HFPKLEH  540
             KLP LEVLKL++ + +G +W+  D   F +L  L++D   L +W+ T     HFP LE 
Sbjct  738  SKLPELEVLKLKSKSLIGNEWKATDQVGFPKLRFLLLDNLPLTEWENTTGSHDHFPSLER  797

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQ  360
            L + + + L+EIP GFA+  +L+ I+L  C PS+V  A+ ++ E  + L      V A  
Sbjct  798  LIITNFKFLEEIPQGFADSKKLELIELHYCNPSLVDFAKNVQVEHEEVLGRNKLKVTAFN  857

Query  359  HGYSW  345
             G  W
Sbjct  858  TGLKW  862



>ref|XP_009777083.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=868

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 7/155 (5%)
 Frame = -1

Query  869  LQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRL  690
            LQ+LE L I A+         +++ ++  IF   +LK L+L     +W  + VL  LP L
Sbjct  708  LQELETLTIEADL------GSDLMILSRDIFP-PNLKQLKLSYTTLQWEDMVVLANLPNL  760

Query  689  EVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLK  510
            EVLK  +A  G  W+L +D  F +L  L +    LE W+AT   FP LE L L+   KL+
Sbjct  761  EVLKAYSAFEGTNWKLNEDVVFQKLKYLRLQYGGLERWEATNDSFPMLEQLLLYGFRKLE  820

Query  509  EIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            EIP    +I  LK IQ+  C  + V SA++I+EEQ
Sbjct  821  EIPQSIGDIMILKLIQIERCSAAAVTSAKKIQEEQ  855



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 78/143 (55%), Gaps = 0/143 (0%)
 Frame = -1

Query  797  QINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQ  618
            Q+     L  SLK L L    F    +  +  LP LEVLK++     ++W L D++ F Q
Sbjct  707  QLPRKFSLPTSLKRLTLTNTLFPLEDMTNIVMLPNLEVLKIKDVFENDEWRLNDEEIFSQ  766

Query  617  LIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSV  438
            L  L+I  T L  W+A   +FPKL+ L L SC  L+EIP  F EI  L+SI+L  C  S 
Sbjct  767  LKFLLISVTFLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSA  826

Query  437  VASAQEIKEEQLDYLNNIVDVVV  369
              S +E++EEQ    N+ + VV+
Sbjct  827  AKSVEELQEEQKSMGNDCLTVVI  849



>ref|XP_009796331.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=571

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR  594
            ++LK L L   C  W  ++++ KLP+LEVLKL   AC G++WE  D   F +L  L +  
Sbjct  431  QNLKALTLCMTCLWWKDLSIVGKLPKLEVLKLIGDACKGKEWEAADHG-FPRLKFLYLRD  489

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
             D + W+A  +HFP LE L++  C  L  IP  FA+I+ L  I L  C  S   SA++I+
Sbjct  490  VDFQYWRAGCHHFPFLERLAILYCPYLDSIPQDFADITTLARISLTGCPESFGNSAKQIQ  549

Query  413  EEQLDYLNNIVDVVVAEQH  357
            ++ LD   N   VV   +H
Sbjct  550  QDMLDNYGNSSLVVNIVRH  568



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L LR     WN + +LC LP LEVLKL+  A  G +WE   D++F QL  L++D T
Sbjct  749  TLKKLTLRGCQLPWNQMTILCMLPELEVLKLKDYAFQGSEWE-STDERFQQLKFLLLDGT  807

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            DL  W      FPKLE L L +C  L EIP   AEI  L+ I+L  C  S   SA  I+E
Sbjct  808  DLIHWIVDSIQFPKLESLVLKNCYCLSEIPDDVAEIPTLQFIELYHCSSSADVSANRIQE  867

Query  410  EQLDYLNNIVDVVV  369
            EQ    N+  D+VV
Sbjct  868  EQHSMGND--DLVV  879



>ref|XP_006362553.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362554.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=239

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K LK L L    FEW  +++L  LP LEVLKL+  A  G+ WE  +D  F +L 
Sbjct  89   AYIFPQK-LKKLSLVDTWFEWKDMSILGLLPDLEVLKLKEYAFKGQSWE-QEDGGFPRLQ  146

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLR  456
            VL I+RTDL  WKA+  +FP+L+HL+L SC+KL+E+P+  A++  L+ I+L+
Sbjct  147  VLWIERTDLTSWKASSGNFPRLKHLALISCDKLEELPAELADVKNLQLIELQ  198



>ref|XP_009796673.1| PREDICTED: uncharacterized protein LOC104243211 [Nicotiana sylvestris]
Length=270

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 78/125 (62%), Gaps = 3/125 (2%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K LK L L    FEW  +++L  L  LEVLKL+  A  G+ WE P+D  F +L 
Sbjct  125  AYIFPQK-LKKLTLIDTGFEWKDMSILGLLEYLEVLKLKENAFTGQSWE-PEDGGFPRLQ  182

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VL I+RTDL  WKA+  +FP+L+ L L +C+ L E+P+  A++  L+ ++L+S   S   
Sbjct  183  VLWIERTDLSSWKASSGNFPRLKRLVLIACDNLNELPAELADVENLQLLELQSTSVSAAK  242

Query  431  SAQEI  417
            SA+ I
Sbjct  243  SARAI  247



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 95/177 (54%), Gaps = 11/177 (6%)
 Frame = -1

Query  887  IENLVNLQQLERLYI---HAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGI  717
            +E+L NL QLE L I   +  Y      +P  +         + L  L L      W  +
Sbjct  811  LESLANLHQLETLKIIIKNDPYRTSKFVNPPKLSFP------RKLNRLTLSGCGLPWERM  864

Query  716  NVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEH  540
             ++  LP LEVLKL+  AC G++WE  ++ +FC+L  L+++  DL  W+     FP+L+ 
Sbjct  865  TIVGLLPCLEVLKLKKDACRGQEWETVEE-QFCRLKYLLLEELDLVQWRTKEAPFPRLQS  923

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            L + SC +L+EIPS   +I+ L+ I+L  C PS V  A++I+EEQ    N  + V +
Sbjct  924  LIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTWAKQIQEEQESMANEDLKVCI  980



>ref|XP_009796668.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009796669.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
Length=898

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
            ++LK L L    F+W     L +L  LEVLKL+ A  G+ W+L  +  F +L  L ID T
Sbjct  743  RTLKKLTLSDTRFDWREAIGLEQLECLEVLKLKDAFTGKSWKL--EVGFSELQALSIDTT  800

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEI--  417
            D E W+A+ +HFP+L HL L  C+KL+ +P+ FA+I  L+ ++L +   + V SA+EI  
Sbjct  801  DFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKA-VRSAKEIER  859

Query  416  KEEQLDYLNNI  384
            K++++ +LNNI
Sbjct  860  KKQEMQFLNNI  870



>ref|XP_009796670.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X4 [Nicotiana sylvestris]
Length=887

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
            ++LK L L    F+W     L +L  LEVLKL+ A  G+ W+L  +  F +L  L ID T
Sbjct  743  RTLKKLTLSDTRFDWREAIGLEQLECLEVLKLKDAFTGKSWKL--EVGFSELQALSIDTT  800

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEI--  417
            D E W+A+ +HFP+L HL L  C+KL+ +P+ FA+I  L+ ++L +   + V SA+EI  
Sbjct  801  DFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKA-VRSAKEIER  859

Query  416  KEEQLDYLNNI  384
            K++++ +LNNI
Sbjct  860  KKQEMQFLNNI  870



>ref|XP_009796664.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=916

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
            ++LK L L    F+W     L +L  LEVLKL+ A  G+ W+L  +  F +L  L ID T
Sbjct  743  RTLKKLTLSDTRFDWREAIGLEQLECLEVLKLKDAFTGKSWKL--EVGFSELQALSIDTT  800

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEI--  417
            D E W+A+ +HFP+L HL L  C+KL+ +P+ FA+I  L+ ++L +   + V SA+EI  
Sbjct  801  DFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKA-VRSAKEIER  859

Query  416  KEEQLDYLNNI  384
            K++++ +LNNI
Sbjct  860  KKQEMQFLNNI  870



>emb|CDP04880.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 87/141 (62%), Gaps = 3/141 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L +      W+ I+V+ +L  LEVLKL + A  G+QW++ + + F +L  L +D  
Sbjct  872   NLKKLTISNARLPWDEISVIGQLSNLEVLKLLSKAFEGQQWDMREGE-FQKLKFLKLDSL  930

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             D+  W A+  H P LE L + SC++L+EIPS F EIS L+ I+L+ C  S   S ++I +
Sbjct  931   DIVQWSASGEHLPCLEQLVVLSCQQLEEIPSCFGEISTLQLIELKCCSASAKDSVKQILD  990

Query  410   EQLDYLNNIVDV-VVAEQHGY  351
             +Q DY N+ ++V VV  Q G+
Sbjct  991   DQRDYGNHQLNVTVVGSQGGF  1011



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 77/132 (58%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  QINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFC  621
            +I S   L  SLK L L      W  +  + KLP LEVLK++    +G+ W+L D++ F 
Sbjct  726  RIPSMYALPTSLKRLTLCFTSLPWEDMANIVKLPNLEVLKIKDNGFLGDVWKLNDEEIFN  785

Query  620  QLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPS  441
            QL  L+I  T L+ W+A+  +FPKL+ L L  C  L+EIP  F EI  L+SI+L  C  S
Sbjct  786  QLKFLLISWTGLKHWEASSVNFPKLQRLFLKRCMNLEEIPQDFGEICTLESIELHDCSIS  845

Query  440  VVASAQEIKEEQ  405
               S ++IKEEQ
Sbjct  846  AAKSGKDIKEEQ  857



>ref|XP_009796665.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009796666.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=906

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
            ++LK L L    F+W     L +L  LEVLKL+ A  G+ W+L  +  F +L  L ID T
Sbjct  743  RTLKKLTLSDTRFDWREAIGLEQLECLEVLKLKDAFTGKSWKL--EVGFSELQALSIDTT  800

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEI--  417
            D E W+A+ +HFP+L HL L  C+KL+ +P+ FA+I  L+ ++L +   + V SA+EI  
Sbjct  801  DFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKA-VRSAKEIER  859

Query  416  KEEQLDYLNNI  384
            K++++ +LNNI
Sbjct  860  KKQEMQFLNNI  870



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 12/180 (7%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN----SHIFLLKSLKGLELRRNCFEWNG  720
             +NL  L  LE L +    ++     P+  QI+    S+ F   +LK L L     +W+ 
Sbjct  708  FDNLAKLDNLETLKL---LNDTFPLPPSQCQISGLPQSYKFP-PNLKKLTLSDTFLDWSH  763

Query  719  INVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
            I+ L  LP LEVLKL+  A  G QWE P D  F  L VL I RT+LE W A+ +HFP+L+
Sbjct  764  ISTLGMLPNLEVLKLKDYAFKGTQWE-PLDGGFRLLRVLHIGRTNLEHWNASGHHFPRLQ  822

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQL--DYLNNIVDVVV  369
             + L  C  L EIP G  E+  L++++L    P+  ASA+ I++E+   D  +N+  +V+
Sbjct  823  QVFLKHCSSLNEIPFGLVEVPSLQNMELFWPTPAAAASARFIQQEKQKGDIKDNVFKLVI  882



>ref|XP_009620237.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=928

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = -1

Query  782  IFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVL  606
            I  L++LK L L    F+W+  N L +L  LEVLKL+  A +G+ W+ P+   F +L VL
Sbjct  786  ITFLRTLKKLILSNTKFDWSEANSLGELESLEVLKLKENAFIGKSWK-PEIGGFSELQVL  844

Query  605  IIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASA  426
            +I  TDLE W+A+ +HFP+L  L L SC+KL  +P   A +  L+ ++L +   + V SA
Sbjct  845  LIKTTDLETWEASEFHFPRLRQLVLISCDKLTAVPYELAYVHSLREMRLVNACSTAVRSA  904

Query  425  QEIKEEQLD  399
            +EI+ ++L+
Sbjct  905  KEIERKKLE  913



>ref|XP_009796671.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
 ref|XP_009796672.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
Length=776

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 83/131 (63%), Gaps = 5/131 (4%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
            ++LK L L    F+W     L +L  LEVLKL+ A  G+ W+L  +  F +L  L ID T
Sbjct  603  RTLKKLTLSDTRFDWREAIGLEQLECLEVLKLKDAFTGKSWKL--EVGFSELQALSIDTT  660

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEI--  417
            D E W+A+ +HFP+L HL L  C+KL+ +P+ FA+I  L+ ++L +   + V SA+EI  
Sbjct  661  DFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKA-VRSAKEIER  719

Query  416  KEEQLDYLNNI  384
            K++++ +LNNI
Sbjct  720  KKQEMQFLNNI  730



>ref|XP_004246080.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=871

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 79/135 (59%), Gaps = 2/135 (1%)
 Frame = -1

Query  767  SLKGLELRR-NCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR  594
            SLK L L   + F W  I+ L  LP LE LKL+  A  G  W L D+DKF  L +L+   
Sbjct  735  SLKRLTLAGWHSFRWTDISALVMLPNLEELKLKNYAANGYVWRLNDEDKFQSLELLLFCN  794

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
             ++E W+A+  +FP L+ L L  C KLKEIP  F EI  L+SI+L +C      SA++I+
Sbjct  795  INVEHWEASSDNFPNLKRLVLKECRKLKEIPIDFGEICSLESIELHNCSTLAEESARKIE  854

Query  413  EEQLDYLNNIVDVVV  369
            +EQ D  NN + V +
Sbjct  855  QEQEDMGNNCLKVYI  869



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 78/143 (55%), Gaps = 0/143 (0%)
 Frame = -1

Query  797  QINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQ  618
            Q+     L  SLK L L    F    +  +  LP LEVLK++     ++W L D++ F Q
Sbjct  708  QLPRKFSLPTSLKRLTLTNTLFPPEDMTNITMLPNLEVLKMKDVFDSDEWRLNDEEIFSQ  767

Query  617  LIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSV  438
            L  L+I  T L  W+A   +FPKL+ + L SC  L+EIP  F EI  L+SI+L  C  S 
Sbjct  768  LKFLLISVTFLRHWEAGSVNFPKLQRVVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSA  827

Query  437  VASAQEIKEEQLDYLNNIVDVVV  369
              S +E++EEQ    N+ + VV+
Sbjct  828  AKSVEELQEEQESMGNDCLSVVI  850



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 90/172 (52%), Gaps = 15/172 (9%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEY----HEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNG  720
            +++LV+L+QLERL +   Y      W   +P            K+LK L +R     W+ 
Sbjct  646  LDDLVHLKQLERLKLTVPYFWSSSRWEKITPA---------FPKTLKWLTIRGGRRPWSE  696

Query  719  INVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
            + V+  LP L+VLK+R     GE WE   +  F +L  L+I+ + L+ W     HFPKLE
Sbjct  697  MTVVGSLPNLQVLKIRNHGFDGETWE-TSEGGFIELKHLMIEYSKLKYWVTESNHFPKLE  755

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNN  387
             + L  C  L EI  G  EI  L+ I+++ C  S+   A+ ++EEQ DY N+
Sbjct  756  RVLLHDCSYLIEISDGVGEIPTLELIEVKFCTESIAGWAKRMREEQQDYRND  807



>ref|XP_009618247.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
 ref|XP_009618250.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
Length=255

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 3/125 (2%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K LK L L    FEW  +++L  L  LEVLKL+  A  G+ WE P+D  F +L 
Sbjct  110  AYIFPQK-LKKLTLIDTWFEWKDMSILGLLEYLEVLKLKEYAFRGQSWE-PEDGGFPRLQ  167

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VL I+RTDL  WKA+  +FP+L+ L L +C+ LKE+P+  A++  L+ ++L+S   S   
Sbjct  168  VLWIERTDLSSWKASSGNFPRLKRLVLIACDNLKELPAELADVENLQLMELQSTSVSAAK  227

Query  431  SAQEI  417
            SA+ I
Sbjct  228  SARAI  232



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 88/177 (50%), Gaps = 25/177 (14%)
 Frame = -1

Query  905  TECNDCIENLVNLQQLERLYIH-----AEYHEW----HSTSPNMIQINSHIFLLKSLKGL  753
            + C   I N+  L QLE L ++     AE   W        PN             LK L
Sbjct  599  SNCWSYISNVAQLHQLEILKLNFINLFAEERRWVPCVDEFPPN-------------LKKL  645

Query  752  ELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDW  576
             L  +   W  +NVL  LP LEVLKL+  A VG  WE   ++ F +L  L+ID+TDL  W
Sbjct  646  TLSSSYLPWKDMNVLSMLPNLEVLKLKNNAFVGSDWE-QYEEGFSRLKYLLIDKTDLVHW  704

Query  575  KATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            +AT   FP L+HL LF C  L+E+P  FAEI  L+ I +       V S  +IK+EQ
Sbjct  705  RATSTQFPSLKHLRLFRCRCLREVPLDFAEIPYLQIIDVYGSY-DAVRSVMQIKQEQ  760



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 81/148 (55%), Gaps = 9/148 (6%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR--------AACVGEQWELPDD  633
            S +    S+  L LR     W  I  +  LP L+VLK+R             E+WE P +
Sbjct  709  SEVIFPPSVIKLALRSCTITWEFIKSIGSLPNLQVLKMRICDFKTKEMQSSDEEWE-PTE  767

Query  632  DKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRS  453
             +F  L  L++++  L  WKA + HFP+L HL +  C  L+EIP    +I  L+ I+L  
Sbjct  768  GEFSSLQFLLLEKLKLVRWKADKTHFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDE  827

Query  452  CRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            C PSVVASA++I+E+Q +  N+ ++V +
Sbjct  828  CSPSVVASARQIQEDQSENGNDGLEVRI  855



>emb|CDP19634.1| unnamed protein product [Coffea canephora]
Length=1229

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-  594
             +LK L L  N   W+ I+ + KLP+LEVLKL   + VG++WE+ + + F +L VL +   
Sbjct  1081  NLKKLTLEENAQPWSEISTIGKLPKLEVLKLFCYSFVGDEWEMKEGE-FPKLRVLKLSNL  1139

Query  593   TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
              DL  W A+  +FP+LE L +  C  L+E+PS   +   L+ I++R CR SV +S ++I+
Sbjct  1140  MDLRSWTASSDNFPRLEKLVVHGCVHLEEVPSCLGDCPTLEMIEVRGCRESVASSVKQIQ  1199

Query  413   EEQLDYLNNIVDVVVAE  363
             +EQ+D  N ++ +++ +
Sbjct  1200  QEQIDMGNEVLKILIED  1216



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L L + C  W+ ++ + +LP LEVLKL + A  GE+W + + + F +L  L +D  
Sbjct  1315  NLKKLTLSKFCLPWDCVSEIGRLPNLEVLKLLSRAFEGERWNMKEGE-FLKLKFLKLDSL  1373

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             ++  WKA+  H PKL+ L L +C  L+E+PSGFA+I  L  I+++ CR S   S + +KE
Sbjct  1374  NIAQWKASADHLPKLQQLVLRNCRHLEEVPSGFADIPTLVMIEMQLCRSSAEESVRILKE  1433

Query  410   EQL  402
             EQL
Sbjct  1434  EQL  1436



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDR  594
            ++LK L     CF+W  ++++ KLP+LE LKL  +AC+G +W++  D  F  L  L+++R
Sbjct  781  QNLKKLAFYGTCFQWKDLSIVGKLPKLEALKLGISACIGIEWKVVKDG-FPSLKFLLLER  839

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
              +  W+A+  HFP LE L L  C  L  IP  FA+I+ L  I +R C  SV  SA++I+
Sbjct  840  LKVRYWRASCDHFPCLERLFLEHCWDLDSIPQDFADITTLALIDIRWCAESVGNSAKQIQ  899

Query  413  EEQLDYLNNIVDVVVAE  363
            E+ L+   + V+V + E
Sbjct  900  EDILNNYASFVEVNIHE  916



>ref|XP_011072139.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=825

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 86/167 (51%), Gaps = 13/167 (8%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLC  705
            ENL  LQ+LE  Y+  +           + + ++I    SLK L L   C  W  + V  
Sbjct  654  ENLARLQKLESFYLFEKN----------VSLLANISFPTSLKKLRLSNCCIPWEKMTVFG  703

Query  704  K-LPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              LP LE LKL R A  G +W  P + +F +L VLII   DLE W+A   HFP LE L L
Sbjct  704  SILPNLEKLKLYRNAFKGPEWS-PVEGQFPRLKVLIIWYNDLERWRAESLHFPNLERLHL  762

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
               + L+EIP G  +I  L SI L  C  S V SA++I EEQ  + N
Sbjct  763  EFMQCLEEIPWGIGDIPTLLSIHLEDCSDSSVNSAKQILEEQQSFGN  809



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 78/144 (54%), Gaps = 1/144 (1%)
 Frame = -1

Query  797  QINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFC  621
            QI S   L  SLK L L      W  +  +  LP LEVLK++    +G+ W L D++ F 
Sbjct  722  QIPSKYVLPASLKRLTLSCTSLPWEDMANIITLPNLEVLKIKDNGFLGDVWMLNDEEIFK  781

Query  620  QLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPS  441
            QL  L+I  T L+ WKA   +FPKL+ L L  C  L+EIP  F +I  L+SI+L  C  S
Sbjct  782  QLKFLLISWTGLKHWKAGSVNFPKLQRLFLKRCMNLEEIPQDFGDICTLESIELHKCSIS  841

Query  440  VVASAQEIKEEQLDYLNNIVDVVV  369
               S + I+EEQ    N  + V++
Sbjct  842  AATSGKNIQEEQESIGNECLSVLI  865



>ref|XP_011072130.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=864

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 91/177 (51%), Gaps = 13/177 (7%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            +ENL  LQ+LE L +  +           + + ++I    SLK L L   C  W  + V 
Sbjct  691  LENLARLQKLESLLVIEKD----------VSLLANITFPTSLKKLTLTSCCIPWEEMTVF  740

Query  707  CK-LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
               LP LE LKL   A  G +W  P + +F +L VLII   DL  W+A   HFPKLE L 
Sbjct  741  GSVLPNLEKLKLYGNAFKGPEWS-PVEGQFPRLKVLIIWENDLVWWRAESIHFPKLERLD  799

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAE  363
            L+    L+EIPSG  +I  L SI L  C  S + SA++I EEQ    N I+ + V E
Sbjct  800  LYEMHCLEEIPSGIGDIPTLLSIHLWDCSDSSINSAKQILEEQQSSGNEILQLYVDE  856



>ref|XP_011071886.1| PREDICTED: uncharacterized protein LOC105157233 [Sesamum indicum]
Length=336

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 76/142 (54%), Gaps = 3/142 (2%)
 Frame = -1

Query  785  HIFLLKSLKGLELRRNCFEWNGINVLCK-LPRLEVLKL-RAACVGEQWELPDDDKFCQLI  612
            +I    SLK L L   C  W  + V    LP LE LKL  +AC G +W  P + +F +L 
Sbjct  196  NITFPTSLKKLTLSNCCIPWEEMTVFGSVLPNLEKLKLYHSACKGSEWS-PVEGQFPRLK  254

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VLII    L  W+A   HFP LE L L S + L+EIPSG  +I  L SI L  C  S V 
Sbjct  255  VLIIWNNILVRWRAESIHFPNLERLHLSSMQCLEEIPSGIGDIPTLLSIDLYDCSDSCVN  314

Query  431  SAQEIKEEQLDYLNNIVDVVVA  366
            SA++I EEQ  + N  + + V 
Sbjct  315  SAKQILEEQQSFGNETLQLYVG  336



>ref|XP_006357457.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=985

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  QINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFC  621
            QI S   L  SLK L L      W  +  +  LP LEVLK++    +G++W L D++ F 
Sbjct  720  QIPSKYVLPASLKRLTLSCTSLPWKDMANVITLPNLEVLKIKDNGFLGDEWMLNDEEIFK  779

Query  620  QLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPS  441
            QL  L+I  T L+ WKA   +FPKL+ L L  C  L++IP  F EI  L+SI+L  C  S
Sbjct  780  QLKFLLISWTGLKHWKAGSVNFPKLQRLFLKRCMNLEKIPQDFGEICTLESIELHKCSIS  839

Query  440  VVASAQEIKEEQ  405
               S ++I+EEQ
Sbjct  840  AAKSGKDIQEEQ  851



>ref|XP_009589795.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=903

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 91/160 (57%), Gaps = 8/160 (5%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NLV L++LE LY+  E   W  +SP +    S    LK L     R +C +   + VL K
Sbjct  725  NLVYLKKLESLYLSCEM--WELSSP-LADSCSFPISLKRLTIFSGRLSCED---MTVLAK  778

Query  701  LPRLEVLKLR-AACVGEQWELPDDDKFCQL-IVLIIDRTDLEDWKATRYHFPKLEHLSLF  528
            LP LEVLKLR        W+L D+D+F QL  +L++D T ++ W+A+  +FP L  L L 
Sbjct  779  LPNLEVLKLRWVEFRPSVWKLNDEDQFKQLKFLLLVDNTYIKQWEASSVYFPNLRRLVLH  838

Query  527  SCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
                LK IP  FAEI  L+SI+L  C  ++  SA+EI+EE
Sbjct  839  QIRNLKRIPLAFAEICTLESIELYMCSRNLEKSAREIQEE  878



>ref|XP_009785700.1| PREDICTED: putative late blight resistance protein homolog R1B-11 
[Nicotiana sylvestris]
Length=433

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 88/168 (52%), Gaps = 8/168 (5%)
 Frame = -1

Query  869  LQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRL  690
            +Q+LE L I AE        P  I        L +LK L L   CF W  +  L  LP L
Sbjct  264  VQELETLAIIAERDNDPFILPRDI-------FLPNLKHLRLTGTCFPWEDMVALANLPNL  316

Query  689  EVLKLRAACVGEQWELPDDDKFCQLIVL-IIDRTDLEDWKATRYHFPKLEHLSLFSCEKL  513
            E LK  +A  G  W+L +D  F +L  L I++  +LE W+AT  +FP LE L L   +KL
Sbjct  317  EKLKAYSAFEGTNWKLNEDAVFHKLKYLKIVNAINLERWEATSDNFPMLEQLLLSGLKKL  376

Query  512  KEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            +EIP    EI  LK I++  C  +   SA +I+EEQ +  N+ ++V +
Sbjct  377  EEIPQSIGEIMTLKFIKIEWCSSAADTSAMKIQEEQTNCGNDSLEVQI  424



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 0/120 (0%)
 Frame = -1

Query  764  LKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDL  585
            LK L L     +WN ++ L  L  LE+LKL+      +W  P+D  F  L +L I R+DL
Sbjct  750  LKKLTLSDTLLDWNDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDL  809

Query  584  EDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
              W A+  HFP+L+HL +  C  L+ +PSGFA+IS L+ ++L     S  ASA+ I+E++
Sbjct  810  VSWNASARHFPRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKK  869



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 0/120 (0%)
 Frame = -1

Query  764  LKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDL  585
            LK L L     +WN ++ L  L  LE+LKL+      +W  P+D  F  L +L I R+DL
Sbjct  750  LKKLTLSDTLLDWNDMSTLGMLENLEILKLKDNAFKGEWWQPEDGGFRALRILHIGRSDL  809

Query  584  EDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
              W A+  HFP+L+HL +  C  L+ +PSGFA+IS L+ ++L     S  ASA+ I+E++
Sbjct  810  VSWNASARHFPRLKHLFIKHCSSLEALPSGFADISSLQLVELYCTTRSAAASARIIQEKK  869



>ref|XP_009782925.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=795

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 96/182 (53%), Gaps = 15/182 (8%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLY----IHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRR-NCF  732
            ND  +  +++  L +L     +  +Y      SP+ I+         SLK L L R   F
Sbjct  616  NDSAKRFIDMSSLTKLEALKCLRGDY------SPDSIK---SFGFPTSLKRLTLTRWFGF  666

Query  731  EWNGINVLCKLPRLEVLKLRAACVGEQ-WELPDDDKFCQLIVLIIDRTDLEDWKATRYHF  555
             W  I+ L  LP LE LKL+   VG++ W L ++DKF +L  L+  + D   W+A+   F
Sbjct  667  PWEDISTLVMLPYLEELKLKRWVVGDEVWRLSNEDKFERLNFLLFCQLDFRCWEASSDSF  726

Query  554  PKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            P L+ L L  C  L+EIP+ F EI  L+SI+L +C  S   SA+ I++EQ D  NN + V
Sbjct  727  PNLKRLVLNHCPYLEEIPTDFGEICTLESIELHNCSTSAEDSARNIEQEQEDMGNNCLKV  786

Query  374  VV  369
             +
Sbjct  787  YI  788



>ref|XP_009780928.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009780934.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=935

 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 77/125 (62%), Gaps = 2/125 (2%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR  594
            ++LK L L + C  W  ++++ KLP+LEVLKL   AC  ++WE+ D   F +L  L ++ 
Sbjct  780  QNLKTLTLYKTCLWWKDLSIVGKLPKLEVLKLIGDACKDKEWEVADHG-FPRLKFLYLEE  838

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
             D + W+A+ +HFP LE L +  C  L  IP  FA+I+ L  I + SC  SV  SA++I+
Sbjct  839  VDFQYWRASCHHFPCLERLVIGGCYSLDSIPRDFADITTLAHIVVWSCAESVGNSAKQIQ  898

Query  413  EEQLD  399
            ++ LD
Sbjct  899  QDMLD  903



>ref|XP_011072163.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=866

 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 96/184 (52%), Gaps = 16/184 (9%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C+ NLV+L +LE LY+ A+      +  NM           SLK LEL      W  + +
Sbjct  695  CLYNLVHLHKLESLYVRAK----DLSLKNM-------GFPTSLKKLELYECKVPWEDMII  743

Query  710  LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            +  LP LEVL L+     G +W  P + +F +L VL +  ++LE W+A   HFP LE LS
Sbjct  744  IGSLPNLEVLMLKGCGFKGSEWN-PIEGQFPRLKVLELSMSNLECWRAENVHFPNLEKLS  802

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQHG  354
            L   + L+EIPSG   I+ L  I++  C  S+V SA +I EEQ    N  + V V   H 
Sbjct  803  LRLMDDLEEIPSGIGYIATLGLIEVYYCSDSIVNSAMQILEEQRSNGNEDLHVYV---HS  859

Query  353  YSWV  342
            +S+ 
Sbjct  860  FSFT  863



>ref|XP_009784309.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=330

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 70/123 (57%), Gaps = 1/123 (1%)
 Frame = -1

Query  734  FEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYH  558
            F W  I+ L  LP LE LKL+   V GE W L D+DKF  L +L+     LE W+A+   
Sbjct  201  FPWADISTLVMLPNLEELKLKDYAVKGEVWRLRDEDKFESLKLLVFSGLYLERWEASSDS  260

Query  557  FPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVD  378
            FP L+ L L  C  LKEIP  F EI  L+SI+L +C  +   SA  I++EQ D  NN + 
Sbjct  261  FPNLKRLVLKKCFLLKEIPIDFGEICTLESIELHNCSIAAEDSATIIEQEQADMGNNSLK  320

Query  377  VVV  369
            V +
Sbjct  321  VSI  323



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            +HIF  K L+ L L      WN ++VL +L  LEVLKL+    +GE WE P    F  L+
Sbjct  733  AHIFPTK-LRKLTLVDTRLGWNDMSVLGQLEHLEVLKLKENGFMGECWE-PKVGGFSSLL  790

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VL I+RT+L  W A+   FP+L+ L L SC++LKEIP G A+I  L++++L +   +   
Sbjct  791  VLWIERTNLVSWNASADQFPRLKRLVLISCDRLKEIPIGLADIRSLQAVELYNSTKTAAI  850

Query  431  SAQEIKEEQ  405
            SA+E+++++
Sbjct  851  SARELQDKK  859



>emb|CDP04756.1| unnamed protein product [Coffea canephora]
Length=1312

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 3/141 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L L RN   W+ I+ + KLP LEVLKL   +  GE+WE+ D + F  L VL +   
Sbjct  1107  NLKKLTLSRNHQPWSEISTIGKLPNLEVLKLLHRSFDGEEWEMKDGE-FPNLRVLKLSGL  1165

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
                 W A+   FP+LE L +  C KL+E+PS   E   L+ I +R C  SV +S ++I++
Sbjct  1166  QFCSWIASSAIFPRLEKLVVHDCTKLEEVPSCLGECPTLEMINVRRCSESVESSVEQIQQ  1225

Query  410   EQLDYLNNIVDVVVAEQHGYS  348
             EQ+D  N ++ +V+ E  GY+
Sbjct  1226  EQMDMGNEVLRIVI-EYIGYT  1245



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 97/178 (54%), Gaps = 4/178 (2%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGI  717
            ++ I++L+ L  LE+L IH +   + + S  +  + S ++    LK   L   C  W  +
Sbjct  56   SNLIDSLIRLVDLEKLRIHLDISPYENFSLRLPTLLSDVYP-TFLKSSTLVGTCLLWEDM  114

Query  716  NVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEH  540
              L +LP +EVL+L+  A  G  W L ++  F +L +L I+ T+L  W+A+    P+LE 
Sbjct  115  TTLGQLPNVEVLRLKCFAFQGRNWNL-NEGGFKKLKLLQINETNLVHWEASSESLPRLEF  173

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            L L  C KL++IP+   +I  LK  +L +C  +   S++EI EEQ   L N V VV A
Sbjct  174  LILKYCYKLEDIPTEIGDIPTLKLTELHNCSQAAAPSSEEIGEEQ-QSLGNEVLVVRA  230



>gb|EYU40384.1| hypothetical protein MIMGU_mgv1a020875mg, partial [Erythranthe 
guttata]
Length=834

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 89/165 (54%), Gaps = 14/165 (8%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C  NL  L++LE L +                I+ +I    SLK L L      W  +++
Sbjct  682  CWTNLAGLRKLESLVLEFSAG-----------ISDNIAFPDSLKKLALSECKVPWEDMSI  730

Query  710  LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            +  LP LEVLKL+  A  GE+W  P + +F +L  L+ID+ +LE W+A   HFP LEHL 
Sbjct  731  VGSLPNLEVLKLKSGAAKGEKWN-PIEGQFGRLKFLLIDQCELEIWEADNTHFPCLEHLV  789

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            L     LKEIP  FAEI  L+ I L   + S+  SA+EI EE+++
Sbjct  790  LGDV-SLKEIPIDFAEILNLRVIVLPRVKSSLWTSAEEISEERMN  833



>emb|CDP00696.1| unnamed protein product [Coffea canephora]
Length=116

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 65/99 (66%), Gaps = 2/99 (2%)
 Frame = -1

Query  701  LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LPRLEVLKL+  A  G +WE P    FC+L  L+I+ TDL  W+AT +HFP+L++L L S
Sbjct  2    LPRLEVLKLKYFAFHGPKWE-PKTKGFCRLTHLLIENTDLVHWEATVHHFPRLQYLVLKS  60

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            C+ L+EIP    EI  L+ I+L  C  +    A+EI+E+
Sbjct  61   CKLLEEIPVDVKEIGTLQRIELHHCNKTTEILAREIQEQ  99



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 79/129 (61%), Gaps = 2/129 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRT  591
             +L+ L L +    W+ I+ + KLP LEVLKL + A  GE WE+ + + F  L  L +D  
Sbjct  1280  NLRKLTLSKFHLPWSYISEIGKLPNLEVLKLLSKAFEGEVWEMKEGE-FLNLKFLKLDSL  1338

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             +L +W A+  H P+L+HL L SC +LKE+PSGF EI  L+ I+++ C  SV  S + ++ 
Sbjct  1339  NLAEWNASSDHLPQLQHLILRSCRQLKEVPSGFGEICTLEMIEVQLCTRSVGKSVRRLQT  1398

Query  410   EQLDYLNNI  384
             E LD  N +
Sbjct  1399  ESLDMGNEL  1407



>ref|XP_011071868.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=859

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 91/178 (51%), Gaps = 13/178 (7%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            +ENL  LQ+LE LY+  E           + + ++I    SLK L L   C  W  + V 
Sbjct  687  LENLARLQKLESLYLLEEN----------VSLLANISFPTSLKKLSLSNCCIPWEKMTVF  736

Query  707  CK-LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
               LP LE L L   A  G +W  P + +F QL VL I  +DL  W+A   HFP LE L 
Sbjct  737  GSILPNLEKLTLNCNAFKGPEWS-PVEGQFPQLKVLRIWESDLVKWRADSIHFPNLERLH  795

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQ  360
            L++   L+EIP G  +I  L SI L  C  S V SA++I EEQ  + N  + + V ++
Sbjct  796  LYNMFCLEEIPWGIGDIPTLLSIHLLKCSDSCVNSAKQILEEQQSFGNETLQLYVDKK  853



>ref|XP_009764269.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=903

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 90/160 (56%), Gaps = 8/160 (5%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NLV L++LE LY+  E   W  +SP +    S    LK L     R +C     + VL K
Sbjct  725  NLVYLKKLESLYLSCEM--WELSSP-LADSCSFPISLKRLTIFSARLSC---EDMTVLAK  778

Query  701  LPRLEVLKLR-AACVGEQWELPDDDKFCQL-IVLIIDRTDLEDWKATRYHFPKLEHLSLF  528
            LP LEVLKLR        W+L D+D+F QL  +L++D T ++ W+A+  +FP L  L L 
Sbjct  779  LPNLEVLKLRWVEFRPSVWKLNDEDQFKQLKFLLLVDNTYIKQWEASSVNFPNLRRLVLH  838

Query  527  SCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
                LK IP  FAEI  L+SI+L  C  ++  SA+EI+EE
Sbjct  839  QIRNLKRIPLAFAEICTLESIELYMCPWNLEKSAKEIQEE  878



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 91/175 (52%), Gaps = 5/175 (3%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C +NL   ++L+ L        +    P  I  NS      SLK L L    F W  ++ 
Sbjct  726  CFDNLDFFRELQSLKCSVMNPIFQRVVP-AISYNS--IFPTSLKKLTLSGLRFPWGHMSD  782

Query  710  LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            + +L  LEVLKLR  A  G  WE  + + F +L  L+I+ TDLE W      FP LE L 
Sbjct  783  IAELRNLEVLKLRCYAFQGRAWETYEGE-FFRLKFLLIEDTDLEYWYVDYESFPSLERLI  841

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            L  C KLKE+PS   E+  L+ ++L  C PS+VASA+ I EEQ    N+++ V +
Sbjct  842  LQHCYKLKEMPSEIGELPNLEKMELVDCHPSLVASAKRIAEEQQSAGNDVLQVSI  896



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 84/148 (57%), Gaps = 2/148 (1%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L     C +W  ++++ KLP+LE LKL  +AC+G +W++  D  F  L  L+++R 
Sbjct  781  NLKKLAFYGTCLQWKDLSIVGKLPKLEALKLGISACIGMEWKVVKDG-FPSLKFLLLERL  839

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             +  W+A+  HFP LE L L  C  L  IP  FA+I+ L  I +R C  SV  SA++I+E
Sbjct  840  KVRYWRASCDHFPCLERLFLEHCWDLDSIPQDFADITTLALIDIRWCAESVGNSAKQIQE  899

Query  410  EQLDYLNNIVDVVVAEQHGYSWVSLPLS  327
            + L+   + V+V + E         P+S
Sbjct  900  DILNNYASFVEVNIHEPQNKRRGPSPVS  927



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K LK L L    FEW  +++L  LP LEVLKL+  A  G+ WE  +D  F +L 
Sbjct  741  AYIFPQK-LKKLSLVDTWFEWKDMSILGLLPELEVLKLKENAFKGQSWE-QEDGGFPRLQ  798

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLR  456
            VL I+RTDL  WKA+  +FP+L+HL+L SC+KL+E+P+  A++  L+ I+L+
Sbjct  799  VLWIERTDLTSWKASSGNFPRLKHLALISCDKLEELPAELADVKNLQLIELQ  850



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 90/168 (54%), Gaps = 12/168 (7%)
 Frame = -1

Query  902  ECNDCIENLVNLQQLERL--YIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFE  729
            E +  + NLV+L  LE L    + +   W +   +    N        L+ L L  +   
Sbjct  652  ETSKYLSNLVHLPLLEALKCSFYRDAKPWRTLPWDAFPSN--------LRKLTLSWSYLP  703

Query  728  WNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
            W  +  + +LP+LEVLKLR  A +G +WE P +D+F  L  L+I+ +DL  WKA+  HFP
Sbjct  704  WEDMTNISRLPKLEVLKLRNCAFLGPEWE-PPEDEFLHLKQLLIENSDLVQWKASTIHFP  762

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
             L+ L L +C  L+EIP    EI  L+ ++L +C  S   SA+EI E+
Sbjct  763  SLDRLVLVNCRFLEEIPVEIGEIPTLRLLELHNCSKSAEISAKEIGEQ  810



>emb|CDP18676.1| unnamed protein product [Coffea canephora]
Length=1199

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 81/138 (59%), Gaps = 0/138 (0%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTD  588
             +LK L L      W+ I+ + KLP+LEVLK   + +GE+WE+ + +     I+ +    D
Sbjct  1061  NLKKLTLMHTKLPWSEISKIGKLPKLEVLKFVYSVLGEEWEMKEGEFPSLRILKLRGMWD  1120

Query  587   LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
                W A+  +FP+LE L + SC KL+E+PS   E + L+ I++  CR SV +S Q+I++E
Sbjct  1121  FCSWTASFDNFPRLEKLVVRSCPKLEEVPSCLGECANLEMIEVSGCRESVASSVQQIQQE  1180

Query  407   QLDYLNNIVDVVVAEQHG  354
             Q+D  N  + + + +  G
Sbjct  1181  QIDMGNEALKISIEDCVG  1198



>ref|XP_006365681.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X2 [Solanum tuberosum]
Length=705

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 72/138 (52%), Gaps = 0/138 (0%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTD  588
            +LK L L      W  +N+L  LP LEVLKL  A  G  W++ +D  F +L  L I    
Sbjct  550  NLKKLRLSYTRIPWEAMNLLANLPNLEVLKLDYAFAGTDWKVDEDVVFHKLKYLQIASDC  609

Query  587  LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            LE W+    +FP LE L L+   KL+EIP    EI  L  IQL  C   VV SA++I++E
Sbjct  610  LERWEIGSDNFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQQE  669

Query  407  QLDYLNNIVDVVVAEQHG  354
            Q    N  + V +   +G
Sbjct  670  QQSLGNYELQVQIKSNYG  687



>ref|XP_009778116.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=490

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 77/122 (63%), Gaps = 2/122 (2%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
            +L+ L L     EW+ ++VL +L  LEVLKL+  A  GE WE P    F  L+VL I+R+
Sbjct  348  NLRKLTLLDTWLEWDDMSVLGQLEYLEVLKLKDNAFKGEYWE-PKVGGFRSLLVLWIERS  406

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            DL  W A+  HFP+L+ L L SC+KL+E+P G A+I  L+ ++LR+       SA++I+ 
Sbjct  407  DLASWNASSDHFPRLKRLVLVSCDKLEEVPIGLADICGLQVMELRNSTKQTANSARDIQA  466

Query  410  EQ  405
            ++
Sbjct  467  KK  468



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 92/177 (52%), Gaps = 7/177 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            + NLV+L QLE L +  E       S     +   +     LK L L    F W  +  +
Sbjct  705  LHNLVDLHQLENLKVWVE-----DISREPFPLWEKLAFPVMLKKLTLSGCLFCWEDMTTV  759

Query  707  CKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSL  531
              L  LEV+KL R +  G +WE  + + F +L  L I  T+L+ W     HFP LEHL L
Sbjct  760  GSLQNLEVMKLTRCSFEGCKWETIEGE-FPRLKFLKIRWTNLQHWVTDSSHFPSLEHLQL  818

Query  530  FSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQ  360
            FSC++L EIP    EI  LK I++     S+V SA++IKEEQ  + N+ ++V +  +
Sbjct  819  FSCQRLGEIPDVLGEIPTLKIIEVNRSDRSLVKSAKQIKEEQQSFGNDYLEVRIVRE  875



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRT  591
             SL+ L L  +   W   +++  LPRLEVLKL+  A  G +WE P    FC+L  L+I+ T
Sbjct  990   SLRQLSLSWSYLPWEDTSLIGMLPRLEVLKLKHFAFHGPKWE-PKTKGFCRLTHLLIENT  1048

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             DL  W+AT +HFP+L++L L SC+ L+EIP    EI  L+ I+L  C  +    A+EI+E
Sbjct  1049  DLVHWEATVHHFPRLQYLVLKSCKLLEEIPFDVEEIGTLQRIELHHCNKTTEILAREIQE  1108

Query  410   E  408
             +
Sbjct  1109  Q  1109



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K LK L L    FEW  +++L  LP LEVLKL+  A  G+ WE  +D  F +L 
Sbjct  741  AYIFPQK-LKKLSLVDTWFEWKDMSILGLLPDLEVLKLKENAFKGQSWE-QEDGGFPRLQ  798

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLR  456
            VL I+RTDL  WKA+  +FP+L+HL+L SC+KL+E+P+  A++  L+ I+L+
Sbjct  799  VLWIERTDLTSWKASSGNFPRLKHLALISCDKLEELPAELADVKNLQLIELQ  850



>emb|CDP17919.1| unnamed protein product [Coffea canephora]
Length=1347

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 83/130 (64%), Gaps = 3/130 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L L+ N   W+ I+ + KLP LEVLKL + + VGE+W + ++ +F  L VL +   
Sbjct  1125  NLKKLTLKWNRQPWSEISTIGKLPNLEVLKLLKESFVGEEWAM-EEGEFPSLRVLELSML  1183

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             D+ +W ++  +F +LE L + SC  L+E+PS   E   L+ I+++ CR SV AS  +I+E
Sbjct  1184  DIRNWSSSSDNFSRLEKLLVDSCMYLEEVPSCLGECETLEMIEVKGCRESVAASVMQIQE  1243

Query  410   EQLDYLNNIV  381
             EQLD + N+V
Sbjct  1244  EQLD-MGNVV  1252



>ref|XP_011072138.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=427

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 83/159 (52%), Gaps = 13/159 (8%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            +ENL  LQ+LE LY+  +           + + ++I    SLK L L   C  W  + V 
Sbjct  280  LENLARLQKLESLYLFEKN----------VSLLANITFPTSLKKLSLSNCCIPWEEMTVF  329

Query  707  CK-LPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
               LP LE L L R A  G +W  P + +F +L VLII   DL  W+A   HFP LE L 
Sbjct  330  GSVLPNLEKLTLYRNAFKGAEWS-PVEGQFPRLKVLIIVCNDLVRWRAESIHFPNLERLH  388

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEI  417
            L S E L+EIPSG  +I  L SI L  C  S V SA++I
Sbjct  389  LESMECLEEIPSGIGDIPTLLSIHLWKCSDSSVNSAKQI  427



>ref|XP_006365680.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X1 [Solanum tuberosum]
Length=881

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 72/138 (52%), Gaps = 0/138 (0%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTD  588
            +LK L L      W  +N+L  LP LEVLKL  A  G  W++ +D  F +L  L I    
Sbjct  726  NLKKLRLSYTRIPWEAMNLLANLPNLEVLKLDYAFAGTDWKVDEDVVFHKLKYLQIASDC  785

Query  587  LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            LE W+    +FP LE L L+   KL+EIP    EI  L  IQL  C   VV SA++I++E
Sbjct  786  LERWEIGSDNFPMLEQLLLYGMNKLEEIPESIGEIMTLNLIQLDHCSSGVVISAKKIQQE  845

Query  407  QLDYLNNIVDVVVAEQHG  354
            Q    N  + V +   +G
Sbjct  846  QQSLGNYELQVQIKSNYG  863



>emb|CDO99208.1| unnamed protein product [Coffea canephora]
Length=542

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = -1

Query  812  SPNMIQINSHIFLLK-SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELP  639
            S ++IQ   + F    +LK L L  NC   + I+ + KLP LEVLKLR+ + VGE+W + 
Sbjct  387  SLHLIQFEGYGFKFPLNLKKLTLSGNCQPRSEISTIGKLPNLEVLKLRSESFVGEEWVVK  446

Query  638  DDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQL  459
            + + F +L  L + R  + +W AT  +F  LE L + +C KL+E+P+  AE   L+ I++
Sbjct  447  EGE-FPKLRFLELSRLSIRNWTATSDNFCHLEKLVVCNCLKLEEVPACLAECLTLEMIEV  505

Query  458  RSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            + CR SV  S ++I++EQ+D  N ++ +++
Sbjct  506  KWCRESVANSVKQIQQEQMDSGNEVLKIII  535



>ref|XP_009626592.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=920

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDR  594
            ++LK L   R    WN ++++ KLP+LE LKL   ACVGE WE+ D+  F  L +L+++ 
Sbjct  774  QNLKKLAFSRTFLRWNDLSIVGKLPKLEALKLTYRACVGEAWEVVDEG-FPSLKLLLLED  832

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
             D E W+A+  HFP LE L L  C  L  IP  FA+I  L  I +R C+ SV  SA++I+
Sbjct  833  LDFEYWRASCDHFPCLERLFLERCRFLDSIPQDFADIITLALIDIRRCKESVGNSAKQIQ  892

Query  413  EEQLDYLNNIVDVVVAE  363
            ++  D   + V+V ++E
Sbjct  893  QDMQDNYASSVEVHISE  909



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 88/168 (52%), Gaps = 7/168 (4%)
 Frame = -1

Query  869  LQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRL  690
            L +LE L I   Y  ++   P      S   L  SLK L L      W  +  +  LP L
Sbjct  735  LNKLETLKITC-YRGYYERPPQ-----SKFALPTSLKRLTLESTYLPWEDMANIVMLPNL  788

Query  689  EVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKL  513
            +VLK++    V  +W L D+  F QL  L+I +TDLE WKA   +FP+L+ L L  C  L
Sbjct  789  QVLKIKDNGFVDGRWRLNDEMIFNQLKFLLIHKTDLEQWKAGSVNFPELQCLVLKECISL  848

Query  512  KEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            K+IP    EI  L+SI+L +C  S   S ++I++EQ    N+ + V+V
Sbjct  849  KKIPQDIGEIYTLESIELHNCSTSAENSVKKIQKEQKSMGNDCLTVLV  896



>ref|XP_006365678.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
[Solanum tuberosum]
Length=620

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 80/155 (52%), Gaps = 2/155 (1%)
 Frame = -1

Query  806  NMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDK  627
            N I I S    L +LK L L      W  +N+L  LP LEVL+  AA  G  W L +D  
Sbjct  454  NPIMIFSGDIFLPNLKELTLSSTYIPWEAMNLLANLPNLEVLEY-AAFDGTDWRLNEDVV  512

Query  626  FCQLIVLIIDR-TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSC  450
            F +L  L++    DL+ W+A   +FP LE L +F  EKL+EIP    +I  LK IQ++ C
Sbjct  513  FRKLKRLLLHSCRDLQKWEAGSDNFPMLEKLMMFRLEKLEEIPESIGDIMTLKLIQIKYC  572

Query  449  RPSVVASAQEIKEEQLDYLNNIVDVVVAEQHGYSW  345
               V  SA++I++EQ    N  + V +       W
Sbjct  573  SSGVETSAEKIQQEQQSLGNYELQVQITSLFSQVW  607



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDR  594
            ++LK L   R    WN ++++ KLP+LEVLKL   AC+GE WE+ D+  F  L +L+++ 
Sbjct  775  QNLKKLAFSRTFLRWNDLSIVGKLPKLEVLKLTYRACIGEAWEVVDEG-FPSLKLLLLED  833

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
             D E W+A+  HFP LE L L  C  L  IP  FA+I  L  I +R C+ SV  SA++I+
Sbjct  834  LDFEYWRASCDHFPCLERLFLERCRFLDSIPQDFADIITLSLIDIRRCKESVGNSAKQIQ  893

Query  413  EEQLDYLNNIVDVVVAE  363
            ++  D   + V+V +++
Sbjct  894  QDMQDNYASSVEVHISD  910



>gb|AGW28124.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN--SHIFLLKSLKGLELRRNCFEW  726
            C++ ++++++L +L  L      H  + TS   ++ N  S++    SLK L L      +
Sbjct  526  CDEKLDHVIDLSRLHNL------HTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICY  579

Query  725  NGINVLCKLPRLEVLKLRAACVGE--QWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
              ++++  LP L++LKLR  C  E  +WE P +  FC+L  LI+++ +L  W A    FP
Sbjct  580  RDMSIIGSLPNLQILKLR-GCEFENREWE-PIEGDFCELKCLIMEKLNLVFWTADDICFP  637

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            +LEHL +  C  L EIPSG  +I  L+ I++  CR SV+ SA+ I+EEQ  + N  ++V
Sbjct  638  RLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECRRSVLDSARMIQEEQESWGNEYLEV  696



>ref|XP_009603185.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 96/177 (54%), Gaps = 4/177 (2%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
            + I++L+ L  LE+L IH +   + + S  +  +   +F    LK L L      W  + 
Sbjct  57   NLIDSLIRLVDLEKLRIHLDISPYENFSLRLPTLLLDVFP-TFLKSLTLVGTRLLWEDMT  115

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHL  537
             L +LP LEVL+L+  A  G  W L ++  F +L +L I+R +L  W+A+    P+LE L
Sbjct  116  TLGQLPNLEVLRLKCFAFQGRNWNL-NEGGFKKLKLLQINRKNLVLWEASSESLPRLEFL  174

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
             L  C KL++IP+   +I  +K I+L +C  +   SA+E+ EEQ   L N V VV A
Sbjct  175  ILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQ-QSLGNEVLVVRA  230



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 78/126 (62%), Gaps = 3/126 (2%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K L+ L L      WN ++VL +L  LEVLKL+    +GE WE P    F  L+
Sbjct  554  AYIFPTK-LRKLTLLDTWLGWNDMSVLGQLEHLEVLKLKENGFIGECWE-PKVGGFSSLL  611

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VL I+RT+L  W A+   FP+L+ L L SC++LKEIP G A+I  L++++L +   +   
Sbjct  612  VLWIERTNLVSWNASADQFPRLKRLVLISCDRLKEIPIGLADIRSLQTVELYNSTKTAAI  671

Query  431  SAQEIK  414
            SA+E++
Sbjct  672  SARELQ  677



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L L     +W+ ++ L  LP LEVLKL+  A  G +WE P D  F  L VL + R+
Sbjct  748  NLKKLTLSDTLLDWSEMSTLGMLPNLEVLKLKDYAFKGSRWE-PLDGGFRLLRVLQLGRS  806

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            DL  W A+ +HFP+LE + L  C  L+EIP GF E+S L++++L    P+  ASA+ I+ 
Sbjct  807  DLVHWHASSHHFPRLERVVLKHCTHLEEIPCGFGEVSALQNMELYWPTPAAAASARLIQH  866

Query  410  EQ  405
            ++
Sbjct  867  QK  868



>ref|XP_011087138.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=821

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 74/123 (60%), Gaps = 2/123 (2%)
 Frame = -1

Query  779  FLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLI  603
            F   SL+ L L      W  ++++  LP LEVLKLR  A  G +WE   +  F +L VL+
Sbjct  677  FFPVSLRKLTLGGLGLPWEDMSLIACLPNLEVLKLRCYAFRGPEWET-FEGGFWKLRVLL  735

Query  602  IDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQ  423
            I+ TDLE W+A  Y FP+LE L +  C KLKEIP    E  RL+ I++    PS+VASA+
Sbjct  736  IEDTDLEYWRANGYRFPRLERLFIHHCYKLKEIPQSIEENFRLEVIEIVDGTPSLVASAK  795

Query  422  EIK  414
            +I+
Sbjct  796  QIQ  798



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 94/174 (54%), Gaps = 4/174 (2%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLC  705
            E+L+ L  LE+L IH +   + + S  +  +   +F    LK L L      W  +  L 
Sbjct  16   ESLIRLVDLEKLRIHLDISPYENFSLRLPTLLLDVFP-TFLKSLTLVGTRLLWEDMTTLG  74

Query  704  KLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLF  528
            +LP LEVL+L+  A  G  W L ++  F +L +L I+R +L  W+A+    P+LE L L 
Sbjct  75   QLPNLEVLRLKCFAFQGRNWNL-NEGGFKKLKLLQINRKNLVLWEASSESLPRLEFLILK  133

Query  527  SCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
             C KL++IP+   +I  +K I+L +C  +   SA+E+ EEQ   L N V VV A
Sbjct  134  YCYKLEDIPTEIGDIPTIKLIELHNCSQAAATSAEEMGEEQ-QSLGNEVLVVRA  186



>emb|CDP17914.1| unnamed protein product [Coffea canephora]
Length=743

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 92/150 (61%), Gaps = 3/150 (2%)
 Frame = -1

Query  812  SPNMIQINSHIFLLK-SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELP  639
            S ++IQ   + F    +LK L L  NC   + I+ + KLP LEVLKLR+ + VGE+W + 
Sbjct  588  SLHLIQFEGYGFKFPLNLKKLTLSGNCQPRSEISTIGKLPNLEVLKLRSESFVGEEWVVK  647

Query  638  DDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQL  459
            + + F +L  L + R  + +W AT  +F  LE L + +C KL+E+P+  AE   L+ I++
Sbjct  648  EGE-FPKLRFLELSRLSIRNWTATSDNFCHLEKLVVCNCLKLEEVPACLAECLTLEMIEV  706

Query  458  RSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            + CR SV  S ++I++EQ+D  N ++ +++
Sbjct  707  KWCRESVANSVKQIQQEQMDSGNEVLKIII  736



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 87/155 (56%), Gaps = 4/155 (3%)
 Frame = -1

Query  839  AEYHEWHST--SPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAA  666
            +  H+ H+   S    Q   ++     LK L L+R     + +N + KL  LE+LKL+  
Sbjct  690  SRLHKLHTLKLSSTRFQFTFNVIFPPYLKKLTLKRCTVLDHHLNAIGKLLNLEILKLQEC  749

Query  665  CVGE-QWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFA  489
                 +WE P++ +FCQL  L +D  DL +W     +FP+L+HL +  C  L+EIP    
Sbjct  750  KFKSLRWE-PNEGEFCQLQFLRMDLVDLVNWVVDDTNFPRLDHLVIRGCRHLEEIPLAIG  808

Query  488  EISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNI  384
            +I  LK I++ +  PSV+ASA+EI++ QLD  N++
Sbjct  809  DIPTLKVIEVDNSSPSVLASAREIQQAQLDSGNDL  843



>ref|XP_009803158.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=895

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NL  L+ LERL I+ +   + S+ P++    S   + ++LK L L +  F+W+  ++L +
Sbjct  724  NLGELKCLERLMIYNDGSNY-SSKPHLPP--SFFKIRRTLKKLTLSKTMFDWSEADILGQ  780

Query  701  LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            L  LEVLKL+  A  G  WE+ +   F  L VL I+  DL++W+A+ YHFPKL HL L  
Sbjct  781  LECLEVLKLKENAFKGMSWEV-ERGAFNNLQVLWIEGADLKNWEASEYHFPKLRHLVLKF  839

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQL  402
            CE L+ +P   A++   + ++L + R +   SA+EI+  +L
Sbjct  840  CENLQAVPYELADVPSFEEMKLENTRKA-AESAREIQRRKL  879



>ref|XP_006348601.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1733

 Score = 88.6 bits (218),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  764   LKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTD  588
             LK L L +    W+ I+++ +LP LE+LKL   A  G++WE+ D + F +L  LI+D  +
Sbjct  1590  LKELTLSKFRLPWSEISIIGELPNLEILKLLFRAFEGDRWEVKDAE-FPKLKYLILDNIN  1648

Query  587   LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
                W  +   FP+LE+LSL  CE+L+EIPS F E   +KSI++  C  SV  SA EI+  
Sbjct  1649  FSQWSISDDAFPELENLSLTKCERLEEIPSHFGEAVSIKSIEVNRCGSSVANSALEIQTT  1708

Query  407   QLDYLNN  387
             Q + + N
Sbjct  1709  QHEEMAN  1715



>ref|XP_009625338.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=337

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 92/156 (59%), Gaps = 6/156 (4%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            N+  L  LE+L +    ++   +S  +    ++IF  K LK L L    FEW  +++L  
Sbjct  164  NIGKLDCLEKLKL---VNDTRQSSKQLHLPPAYIFPQK-LKKLTLIDTWFEWKDMSILGL  219

Query  701  LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            L  LEVLKL+  A  G+ WE P++  F +L VL I+RTDL  WK++  +FP+L+ L L +
Sbjct  220  LDYLEVLKLKENAFTGQSWE-PEEGGFPRLQVLWIERTDLSSWKSSCGNFPRLKRLVLIA  278

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEI  417
            C+ LKE+P+  A++  L+ ++L+S   S   SA+ I
Sbjct  279  CDNLKELPAELADVENLQLMELQSTSVSAAKSARAI  314



>emb|CDP12798.1| unnamed protein product [Coffea canephora]
Length=1266

 Score = 88.6 bits (218),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 81/139 (58%), Gaps = 3/139 (2%)
 Frame = -1

Query  764   LKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVG-EQWELPDDDKFCQLIVLIIDRTD  588
             LK L L      W+ I+ + KLP LEVLKLR   +  E+WE+   + F  L  L + + D
Sbjct  1130  LKKLTLSHTNMPWSEISTIGKLPSLEVLKLRNKAIDREKWEMKAGE-FLSLRFLELSQLD  1188

Query  587   LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
             L  W AT  +F +LE L + SC KL+E+PS   E   L+ I+L+ CR S V S ++I+ E
Sbjct  1189  LRSWTATSDNFSRLEKLVVQSCWKLEEVPSCLGECLNLEMIELKWCRESAVTSVKQIQRE  1248

Query  407   QLDYLNNIVDVVVAEQHGY  351
             Q+D  N  + +++ E +G+
Sbjct  1249  QMDAGNEGLRIIL-ENNGF  1266



>emb|CDP20159.1| unnamed protein product [Coffea canephora]
Length=1261

 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 2/136 (1%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAAC-VGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L L  N   W+ I+ + KLP LEVLKL   C VGE+W + + + F +L VL +   
Sbjct  1118  NLKKLVLSHNRQPWSEISTIGKLPNLEVLKLLEDCFVGEEWVMKEGE-FPKLRVLKLSEL  1176

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             +  +W A   +F +LE L L SCE+L+++PS   E   L+ I+++ C  SVV S ++I++
Sbjct  1177  EFRNWTAFSDNFSRLEKLVLHSCEELEKVPSCLGECETLEMIEVKECPESVVDSVKQIQQ  1236

Query  410   EQLDYLNNIVDVVVAE  363
             EQ+D  N ++ + + E
Sbjct  1237  EQIDMGNEVLKIEIDE  1252



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 80/151 (53%), Gaps = 9/151 (6%)
 Frame = -1

Query  887  IENLVNLQQLE--RLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
             +NLV L QLE  R Y H+ +    +T P+     +      +LK LEL   C  W  IN
Sbjct  752  FDNLVYLHQLENLRFYFHSTWKFGEATIPSAEAFPA------TLKKLELNGTCLRWEDIN  805

Query  713  VLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            ++ +LP LEVLK+ +     +W       F QL +L+ID T L  WKAT  +FP LE L 
Sbjct  806  IISELPNLEVLKVLSVMKDNEW-YTVAGGFTQLKLLLIDWTRLNYWKATDDNFPALECLV  864

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPS  441
            L SC  L+EIP  FA+IS L+   + S   S
Sbjct  865  LRSCFNLEEIPIEFADISLLRKPNVYSVNKS  895



>emb|CDP17260.1| unnamed protein product [Coffea canephora]
Length=1080

 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L L  N   W+ I+ + KLP LEVLKL   + +GE+WE+ + + F  L VL +   
Sbjct  919   NLKKLVLEGNRQPWSEISTIGKLPHLEVLKLLDDSFIGEEWEMKEGE-FPSLRVLKLSDL  977

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             D+  W A+  +F  LE L + +C++L+E+PS   E   L++I++  C  SVV S  +I++
Sbjct  978   DIRRWTASSGNFSHLEKLVVDNCDELEEVPSCLGECPTLETIEVTDCPESVVNSVNQIRQ  1037

Query  410   EQLDYLNNIVDVVV  369
             EQLD  N I+ +V+
Sbjct  1038  EQLDMGNAILKIVI  1051



>emb|CDP15718.1| unnamed protein product [Coffea canephora]
Length=905

 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 96/176 (55%), Gaps = 16/176 (9%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNG  720
            CN+ +E   +L QLE L++   Y  W             I    +LK L L  N   W+ 
Sbjct  678  CNEILE-FDSLSQLESLHL---YGFW----------GCGIKFPLNLKKLTLFYNVQPWSE  723

Query  719  INVLCKLPRLEVLKLRAAC-VGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
            I+ + KLP LEVLKL   C VGE+W + + + F +L VL +   +  +W A   +F +LE
Sbjct  724  ISTIGKLPNLEVLKLLNNCFVGEEWVMKEGE-FPKLRVLKLSGLEFHNWTAFSDNFFRLE  782

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
             L L  C KL+++PS   E   L+ IQ++ CR SVV S ++I++EQ+D  N ++ +
Sbjct  783  KLVLHRCRKLEKVPSCLGECETLEMIQVKWCRESVVDSVKQIQQEQMDMGNEVLKI  838



>ref|XP_011072180.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=879

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 74/127 (58%), Gaps = 3/127 (2%)
 Frame = -1

Query  785  HIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIV  609
            HIF  K L  L L      W  ++VL  L  L+VLKL+  A  GE+WE  D   F QL V
Sbjct  740  HIFP-KKLISLTLSYTLLGWEQMSVLGMLENLKVLKLKNDAFTGERWEAADGG-FQQLEV  797

Query  608  LIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVAS  429
            L I+  DL  W+A+ +HFPKL+HLSL +CE+LK +P G A+I  L+ I L         S
Sbjct  798  LQIEYADLVFWEASSHHFPKLQHLSLRNCEELKALPFGLADILSLQVIDLHRTTKLAAVS  857

Query  428  AQEIKEE  408
            A+EI+ +
Sbjct  858  AREIQAD  864



>ref|XP_011072144.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=873

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 78/139 (56%), Gaps = 3/139 (2%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVL-CKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
            SLK L L      W  + ++   LP LEVLKL  A +G +W  P+D +F QL VL I+  
Sbjct  719  SLKKLTLWYCQIPWGKMTIIGSSLPNLEVLKLNNAFMGPKWS-PNDGEFLQLKVLFIESL  777

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRS-CRPSVVASAQEIK  414
            +LE W+A   HFP L  L L+   +LKEIP    +I+ L+SI LR  C  S   SA EI 
Sbjct  778  ELEHWEAEDTHFPNLHGLYLYQMMRLKEIPLSIGDINTLQSIHLRVWCSVSAKNSALEIV  837

Query  413  EEQLDYLNNIVDVVVAEQH  357
            ++Q +  N I+ V + E+ 
Sbjct  838  KDQKEKGNEILQVYIDEKQ  856



>ref|XP_011072171.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=882

 Score = 87.8 bits (216),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 93/180 (52%), Gaps = 15/180 (8%)
 Frame = -1

Query  902  ECNDC-IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEW  726
            + +DC + NLV L +LE L +     E++S   N       I    SLK L L      W
Sbjct  707  DASDCSLSNLVQLNKLESLSL-----EYYSLLEN-------ITFPTSLKKLSLSYCEIPW  754

Query  725  NGINVLCKL-PRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
              + ++  L P LEVLKL  A  G++W+ P + +F +L VL I   DL  W A   HFP 
Sbjct  755  RKMTIISSLLPNLEVLKLNNAFRGQEWD-PSEGEFLRLKVLHISFCDLMLWGAEDIHFPN  813

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            L++LSL    KL+EIP    +I+ L SI L+ C  S V SA EI  EQ +  N  + V V
Sbjct  814  LQYLSLEGMFKLEEIPLSIGDIATLHSIHLQFCGESAVNSATEILTEQKENGNESLQVYV  873



>ref|XP_009786702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=928

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 101/177 (57%), Gaps = 15/177 (8%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPN--MIQINSHIFLLKSLKGLELRRNCFEWNGI  717
            C++NL+ L +LE L I +     +++ P+   +++    +   +LK L L R    W  +
Sbjct  744  CLDNLIYLHELEALSIAS-----YNSEPDGLFLRLPCPGYFPPNLKKLTLCRTFLPWEDM  798

Query  716  NVLCKLPRLEVLKLRAAC------VGEQ-WELPDDDKFCQLIVLIIDRTDLEDWKATRYH  558
             ++ KLP+LEVL+L+A        VGE  WE+ +        +L+  +  L+ W+AT  +
Sbjct  799  AIISKLPKLEVLQLKARAFAGIDIVGETVWEVTEIGFLELKFLLLE-KLHLDYWRATDDY  857

Query  557  FPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNN  387
            FP LE + + +C  L+EIP GFA+   L+ I+L  C PS+V SA+ I++EQL+ L N
Sbjct  858  FPCLERIIIKNCSSLQEIPKGFADSMTLQLIELHQCSPSLVNSAELIRKEQLESLGN  914



>emb|CDP04755.1| unnamed protein product [Coffea canephora]
Length=679

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 85/143 (59%), Gaps = 5/143 (3%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L L  N   W+ I+ + KLP LEVLKL   + VGE+WE+ ++  F  L VL +   
Sbjct  538  NLKKLTLSYNQQPWSEISTIGKLPNLEVLKLLHDSFVGEEWEMKEEG-FLALRVLKLIDL  596

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
                W A+   F +LE L +  C+KL+E+PS   E + L+ I+++ C  SVV+S ++I++
Sbjct  597  HFRSWTASSESFRRLEKLVVHECQKLEEVPSYLGECATLEMIEVKGCGESVVSSVKQIQQ  656

Query  410  EQLDYLNNIVDV-VVAEQHGYSW  345
            EQ+D    I D+ ++ E  G +W
Sbjct  657  EQMDM--GIADLKIIIENCGDAW  677



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 94/175 (54%), Gaps = 3/175 (2%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLC  705
            E LV+LQ+LE L  +A  + + S++    ++ S       L  L L      W  +  L 
Sbjct  730  EQLVHLQELETLK-YAFSNPFVSSALKPDRLPSWRSFPPKLVKLTLSGTSLPWEDMVELS  788

Query  704  KLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLF  528
             LP+LEVLKLR  A  G  W+   +  F +L  L+I  T+LE W A   HFP L+ L L 
Sbjct  789  MLPKLEVLKLRNYAFSGSVWK-SREGGFPRLKFLLIGSTNLEIWDADGTHFPNLQQLVLR  847

Query  527  SCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAE  363
             C+ LKEIP G +E   L+ I+L  C+ S V SA+ ++EEQ    N+ + + ++E
Sbjct  848  HCKFLKEIPYGISEAPLLEKIELHCCKDSAVISARHLQEEQQSLGNDGLKIHISE  902



>gb|AGX27495.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27497.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27498.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN--SHIFLLKSLKGLELRRNCFEW  726
            C++ ++++++L +L  L      H  + TS   ++ N  S++    SLK L L      +
Sbjct  526  CDEKLDHVIDLSRLHNL------HTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICY  579

Query  725  NGINVLCKLPRLEVLKLRAACVGE--QWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
              ++++  LP L++LKLR  C  E  +WE P +  FC+L  LI+++ +L  W A    FP
Sbjct  580  RDMSIIGSLPNLQILKLR-GCEFENREWE-PIEGDFCELKCLIMEKLNLVFWTADDICFP  637

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            +LEHL +  C  L EIPSG  +I  L+ I++  C+ SV+ SA+ I+EEQ  + N  ++V
Sbjct  638  RLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEV  696



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 96/181 (53%), Gaps = 9/181 (5%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSP-NMIQINSHIFLL--KSLKGLELRRNCFEW  726
            ND I +L+ L  L++L I  E     S+ P   I+  + ++ +  ++LK L L     EW
Sbjct  697  NDFIGSLICLVDLQKLSIQLEV----SSHPLFFIRRPAQLWYVFPENLKSLTLVATHLEW  752

Query  725  NGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
              + +L  LP LEVLKL      G  W L D+  F +L +L I +T L  W+AT    P 
Sbjct  753  TDMPMLSSLPNLEVLKLEFYGFEGSNWNL-DEGGFKKLKLLHIHQTRLVHWQATSDSLPV  811

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            LE+L L  C +L+EIP    +I  LK I L  C  + V SA+EI+EEQ    N ++ V V
Sbjct  812  LEYLVLMFCSQLEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEIQEEQKSIGNEVLVVTV  871

Query  368  A  366
            +
Sbjct  872  S  872



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 98/195 (50%), Gaps = 8/195 (4%)
 Frame = -1

Query  902  ECNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWN  723
            + ++   NL +L  LE L     Y       P   ++ S      +LK L L  +   W 
Sbjct  703  QTSEYFSNLASLNLLETLKCSFLYR------PRKHRLPSGDHFPANLKKLTLSGSFLPWE  756

Query  722  GINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKL  546
             +  L  LP+LEVLKLR+ A  G+ W   +   F QL +L+++ +D   W A   HFP L
Sbjct  757  DMAKLAVLPKLEVLKLRSFAFEGQIWGAVEGG-FFQLKLLLVENSDPMSWDADASHFPSL  815

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            + L L  C +L EIP G  +I+ L+ I+++ C   +V SA++I ++Q    N+ + + + 
Sbjct  816  QQLVLRECHRLTEIPQGIGDITTLQMIEVQDCSFYIVRSARKIHQQQQILGNDELGIRII  875

Query  365  EQHGYSWVSLPLSFL  321
               G +  + PL FL
Sbjct  876  TTSGDNHSASPLHFL  890



>gb|AGX27496.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN--SHIFLLKSLKGLELRRNCFEW  726
            C++ ++++++L +L  L      H  + TS   ++ N  S++    SLK L L      +
Sbjct  526  CDEKLDHVIDLSRLHNL------HTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICY  579

Query  725  NGINVLCKLPRLEVLKLRAACVGE--QWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
              ++++  LP L++LKLR  C  E  +WE P +  FC+L  LI+++ +L  W A    FP
Sbjct  580  RDMSIIGSLPNLQILKLR-GCEFENREWE-PIEGDFCELKCLIMEKLNLVFWTADDICFP  637

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            +LEHL +  C  L EIPSG  +I  L+ I++  C+ SV+ SA+ I+EEQ  + N  ++V
Sbjct  638  RLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEV  696



>gb|AGX27493.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 100/178 (56%), Gaps = 10/178 (6%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN--SHIFLLKSLKGLELRRNCFEW  726
            C++ ++++++L +L  L      H  + TS   ++ N  S++    SLK L L      +
Sbjct  526  CDEKLDHVIDLSRLHNL------HTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICY  579

Query  725  NGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
              ++++  LP L++LKLR       +WE P +  FC+L  LI+++ +L  W A    FP+
Sbjct  580  RDMSIIGSLPNLQILKLRGCEFENREWE-PIEGDFCELKCLIMEKLNLVFWTADDICFPR  638

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            LEHL +  C  L EIPSG  +I  L+ I++  C+ SV+ SA+ I+EEQ  + N  ++V
Sbjct  639  LEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEV  696



>emb|CDP18040.1| unnamed protein product [Coffea canephora]
Length=1243

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 85/135 (63%), Gaps = 3/135 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L L  N   W+ I+ + KLP+LEVLKL   + VGE+WE+ + + F  L VL +   
Sbjct  1101  NLKKLTLFYNKQPWSEISTIGKLPKLEVLKLLDDSVVGEEWEMKEGE-FPSLRVLKLSNL  1159

Query  590   -DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
              +L  W A+  +FP LE L + +CE L+E+PS   E   L+ I+++ CR SV +S ++++
Sbjct  1160  WNLRSWTASSDNFPCLEKLVVRNCENLEEVPSCLGECPTLEMIEVKRCRESVASSVKQVQ  1219

Query  413   EEQLDYLNNIVDVVV  369
             +EQ+D  N ++ +++
Sbjct  1220  QEQIDMGNEVLKILI  1234



>gb|AGX27494.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN--SHIFLLKSLKGLELRRNCFEW  726
            C++ ++++++L +L  L      H  + TS   ++ N  S++    SLK L L      +
Sbjct  526  CDEKLDHVIDLSRLHNL------HTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICY  579

Query  725  NGINVLCKLPRLEVLKLRAACVGE--QWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
              ++++  LP L++LKLR  C  E  +WE P +  FC+L  LI+++ +L  W A    FP
Sbjct  580  RDMSIIGSLPNLQILKLR-GCEFENREWE-PIEGDFCELKCLIMEKLNLVFWTADDICFP  637

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            +LEHL +  C  L EIPSG  +I  L+ I++  C+ SV+ SA+ I+EEQ  + N  ++V
Sbjct  638  RLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEV  696



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 99/178 (56%), Gaps = 8/178 (4%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL+ L +LE L I   Y  +     +   +        +LK L L+     W+ + +
Sbjct  694  CLDNLIYLPELEVLKILL-YDAYGVDFLHKHPVPCVGSFPPNLKKLTLQGTHLLWSQLTI  752

Query  710  LCKLPRLEVLKLRAAC-----VGEQ-WELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
            + KLP+LEVL+L+A       +GE  WE+  D  F +L  L+++   L++W A+   FP 
Sbjct  753  ISKLPKLEVLQLKALLFFGDELGETVWEV-SDMGFPKLRFLLVENKGLKNWNASDDSFPC  811

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            LE + + +C  L+EIP GF++   LK I+L  C PS+V  A+EI+EEQ    NNI+ V
Sbjct  812  LERVIIKNCRFLQEIPKGFSDSMTLKRIELWGCTPSLVNFAKEIQEEQEILGNNILQV  869



>emb|CDP05594.1| unnamed protein product [Coffea canephora]
Length=1250

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = -1

Query  728   WNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
             W  I+ +  L  LEVLKLR  A  G++W++ D++ F +L  L +   D+  WKA+   FP
Sbjct  1129  WTAISTIGGLLHLEVLKLREGAFRGQRWDVGDEE-FLELKFLELSNMDVVLWKASYTPFP  1187

Query  551   KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVV  372
             KLE L +  C  L+EIP  F+EI  LK IQLR C   V  SAQ+I +EQ D  N   DV+
Sbjct  1188  KLEQLVIEDCSDLEEIPFSFSEIEGLKLIQLRRCSYDVEDSAQQILQEQRDSGNPEFDVL  1247

Query  371   V  369
             +
Sbjct  1248  I  1248



>emb|CDP20519.1| unnamed protein product [Coffea canephora]
Length=1251

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L L  N   W+ I+ + KLP+LEVLKL   + VGE+WE+ + + F +L VL +   
Sbjct  1109  NLKKLTLEGNFQPWSEISTIGKLPKLEVLKLLYDSFVGEEWEMKEGE-FPKLRVLKLSHL  1167

Query  590   -DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
              D   W A+  +FP+LE L +  C  L+E+PS   E   L+ I++R CR SV +S ++I+
Sbjct  1168  WDFRRWTASSDNFPRLEKLVVQWCRHLEEVPSCLGECPTLEMIEVRGCRESVASSVKQIQ  1227

Query  413   EEQLDYLNNIVDVVV  369
             +EQ D  N ++ +++
Sbjct  1228  QEQRDGGNEVLRILI  1242



>ref|XP_011087329.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=789

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN--SHIFLLKSLKGLELRRNCFEW  726
            C++ ++++++L +L  L      H  + TS   ++ N  S++    SLK L L      +
Sbjct  614  CDEKLDHVIDLSRLHNL------HTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICY  667

Query  725  NGINVLCKLPRLEVLKLRAACVGE--QWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
              ++++  LP L++LKLR  C  E  +WE P +  FC+L  LI+++ +L  W A    FP
Sbjct  668  RDMSIIGSLPNLQILKLR-GCEFENREWE-PIEGDFCELKCLIMEKLNLVFWTADDICFP  725

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            +LEHL +  C  L EIPSG  +I  L+ I++  C+ SV+ SA+ I+EEQ  + N  ++V
Sbjct  726  RLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEV  784



>gb|AGX27492.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=700

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 102/179 (57%), Gaps = 12/179 (7%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN--SHIFLLKSLKGLELRRNCFEW  726
            C++ ++++++L +L  L      H  + TS   ++ N  S++    SLK L L      +
Sbjct  525  CDEKLDHVIDLSRLHNL------HTLNCTSSKYLKDNLLSNLNFPYSLKKLCLDDCGICY  578

Query  725  NGINVLCKLPRLEVLKLRAACVGE--QWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFP  552
              ++++  LP L++LKLR  C  E  +WE P +  FC+L  LI+++ +L  W A    FP
Sbjct  579  RDMSIIGSLPNLQILKLR-GCEFENREWE-PIEGDFCELKRLIMEKLNLVFWTADDICFP  636

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            +LEHL +  C  L EIPSG  +I  L+ I++  C+ SV+ SA+ I+EEQ  + N  ++V
Sbjct  637  RLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDSARMIQEEQESWGNEYLEV  695



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 103/190 (54%), Gaps = 17/190 (9%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHA---EYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWN  723
            +C++NL++L +LE L I     +  ++    P ++    +      LK L L +    W 
Sbjct  695  ECLDNLIHLHELETLKIAGFNMDLLDFDFRLPRLVSFPPN------LKKLTLSKTYLPWE  748

Query  722  GINVLCKLPRLEVLKLRAACV-----GEQWELPDDDKFCQLIVLIIDRTDLEDWKATRY-  561
             + ++ KLP+LEVL+L+ +        E+WE+ +   F +L  +++++ DL+ W+A    
Sbjct  749  DMTIISKLPKLEVLQLKNSAFVEAWSAERWEVTEMG-FPELKFVLLEKLDLKYWRAADID  807

Query  560  -HFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNI  384
             +FP LE + + +C  LK+IP  FA+   L+ I+L  C PS+V  A++I+E   D  NN+
Sbjct  808  DNFPCLERVVIRNCSYLKQIPKVFADSGTLQRIELWGCSPSLVTFAKKIQENHEDLGNNM  867

Query  383  VDVVVAEQHG  354
            + V   +  G
Sbjct  868  LKVYAFDTIG  877



>emb|CDP12799.1| unnamed protein product [Coffea canephora]
Length=1156

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 79/133 (59%), Gaps = 2/133 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
             SLK L L  N   W+ I+ + KLP LEVLKLR  A VGE+WE+ ++ +F  L  L +   
Sbjct  1024  SLKKLTLWSNHQPWSSISRIGKLPNLEVLKLRYQAFVGEKWEV-EEGEFPNLRFLKLSSL  1082

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             D+  W A+  +F  LE L L  C KL+E+PS   E   L+ I++ SC  S V + ++I++
Sbjct  1083  DIHRWTASSDNFSLLEKLVLHDCVKLEEVPSCLGESPTLEMIEVSSCGKSTVNAIKQIQQ  1142

Query  410   EQLDYLNNIVDVV  372
             EQ+D  N  + +V
Sbjct  1143  EQMDMGNEALKIV  1155



>gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Erythranthe guttata]
Length=887

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 97/184 (53%), Gaps = 14/184 (8%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIF----LLKSLKGLELRRNCFEWN  723
            C+ NL  L++LE L       E        I+I S++        SLK L L R C  W 
Sbjct  696  CLNNLCRLEKLESLGCIFAPEE------KPIKIRSYLLQNLNFPNSLKKLSLDRTCLSWE  749

Query  722  GINV-LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFP  552
             ++V +  LP L+VLKL   A  G++WE  +  +FC L  L+I+   +L  W+    HFP
Sbjct  750  DMSVKIGSLPLLQVLKLYTDAFKGDEWETVEG-QFCNLKFLLIEGCGELRCWRTESSHFP  808

Query  551  KLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVV  372
             LE L L   ++L+EIP G  EI  L++I L+ C  S V SA+EI +EQ +Y N ++  V
Sbjct  809  CLEQLFLRDLDELEEIPWGIGEIPTLETIVLKYCSDSAVFSAKEILDEQEEYGNVLLAFV  868

Query  371  VAEQ  360
               +
Sbjct  869  AKSK  872



>gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythranthe guttata]
Length=852

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 88/170 (52%), Gaps = 7/170 (4%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGIN  714
            D I+ + N+ +L+  Y             N+     H+  L+SL+      N    N + 
Sbjct  666  DVIKRIPNITKLQIFYFEEPQGFLSYCLDNL----GHLHKLESLRFSIYSENKPSLNDMT  721

Query  713  VLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR-TDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL+  + VG  WE  +  +FC L  L+I    DLE W     HFP+LEH
Sbjct  722  KIGLLPNLQVLKLKVNSFVGTDWETIEG-QFCNLRYLLISLCRDLEWWTTDSNHFPRLEH  780

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            L L    KLKEIPS   EIS L+SIQL  C  S V SA+EI +EQ D+ N
Sbjct  781  LHLQFLRKLKEIPSCIGEISTLQSIQLIWCSKSAVKSAKEILKEQEDFGN  830



>ref|XP_009774012.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=887

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K LK L L     +W  +++L  L  LEVLKL+  A  G+ WE PDD  F +L 
Sbjct  737  AYIFPQK-LKKLTLIDTWLKWKDMSILGLLEYLEVLKLKENAFRGQSWE-PDDGGFPRLQ  794

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VL I RTDL  WKA+  +FP+L+ L L SC+KL+E+P+  A++  L+ ++L     S   
Sbjct  795  VLWIQRTDLSSWKASSLNFPQLKRLVLISCDKLEELPAALADVQSLQLMELHYTSESAAK  854

Query  431  SAQEIKEEQL  402
            SA+ I +++L
Sbjct  855  SARAILKKRL  864



>emb|CDP12547.1| unnamed protein product [Coffea canephora]
Length=1233

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 71/133 (53%), Gaps = 0/133 (0%)
 Frame = -1

Query  770   KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
             ++LK L L        GI+ + +LP L VLK R     +      + +F  L  L I  +
Sbjct  1099  RALKKLTLFNCLLPRTGISAIGQLPNLVVLKFRLIDFAKHTFYMKEGEFSSLKFLRIYNS  1158

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             + E W      FP LE+L L  C KL+EIPS FAEIS L+ I++R C P+V  SAQ I E
Sbjct  1159  EFERWAVPAEPFPSLENLVLIDCTKLQEIPSSFAEISTLRMIKVRGCSPNVEKSAQTIFE  1218

Query  410   EQLDYLNNIVDVV  372
             EQ D  N  + ++
Sbjct  1219  EQKDMGNGDLQLI  1231



>gb|ABJ99601.1| NBS-LRR type resistance protein [Beta vulgaris]
Length=899

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 84/159 (53%), Gaps = 4/159 (3%)
 Frame = -1

Query  884  ENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLC  705
            E L N++ LE L  + +     +    +     H     +L+ L +      W   ++L 
Sbjct  721  EALANMKYLETLKFYGDVSS--NARSKISHFPGHNKFPPNLRNLTITDTMLSWEHTDILG  778

Query  704  KLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLF  528
             LP L +LKL+  A +GE W+ P DD F  L V  + RT+L+ W+A+ YHFP L+ L L 
Sbjct  779  MLPNLVMLKLKENAFMGEYWK-PKDDGFRTLEVFYLGRTNLQKWEASNYHFPSLKKLILK  837

Query  527  SCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             C++L+ + S  A+IS L+ I +    P V A A++I++
Sbjct  838  FCDRLEGLSSSLADISTLQLIDIHMANPVVAACARQIQK  876



>emb|CDP08021.1| unnamed protein product [Coffea canephora]
Length=854

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 88/170 (52%), Gaps = 12/170 (7%)
 Frame = -1

Query  905  TECNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEW  726
            T CN     L  L  LE L I    +  H         N    L  SLK L L R C  W
Sbjct  684  TSCNQ-FPRLKFLSHLESLKIFYYGNPLH---------NGEFNLPLSLKELTLSRFCLPW  733

Query  725  NGINVLCKLPRLEVLKLRAAC-VGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
            + I+ +  LP LEVLKL +   VG  W++ +D+ F +L  L +D  D+ +W A+  H PK
Sbjct  734  SHISAIGTLPNLEVLKLLSGTFVGRTWDMMEDE-FQKLKFLSLDTLDIAEWNASYDHLPK  792

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            LE L L +C+ L++IP   + I+ L++I++  C  SV  SA EI++   D
Sbjct  793  LERLVLRNCKGLEKIPEDLSNIASLETIEVHWCGQSVEESAIEIRKTTGD  842



>gb|ABJ99598.1| NBS-LRR type resistance protein [Beta vulgaris]
Length=895

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 84/161 (52%), Gaps = 4/161 (2%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
              E L N++ LE L  + +     +    +     H     +L+ L +      W   ++
Sbjct  715  TFEALANMKYLETLKFYGDVSS--NARSKISHFPGHNKFPPNLRNLTITDTMLSWEHTDI  772

Query  710  LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            L  LP L +LKL+  A +GE W+ P DD F  L V  + RT+L+ W+A+ YHFP L+ L 
Sbjct  773  LGMLPNLVMLKLKENAFMGEYWK-PKDDGFRTLEVFYLGRTNLQKWEASNYHFPSLKKLI  831

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            L  C++L+ + S  A+IS L+ I +    P V A A++I++
Sbjct  832  LKFCDRLEGLSSSLADISTLQLIDIHMANPVVAACARQIQK  872



>emb|CDP12770.1| unnamed protein product [Coffea canephora]
Length=811

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L L  N   W+ I+ + KLP+LEVLKL     VGE+WE+ + + F  L VL +   
Sbjct  672  NLKKLTLVYNKQPWSEISTIGKLPKLEVLKLLDGFFVGEEWEMKEGE-FPSLRVLQLSNL  730

Query  590  -DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
                 W A+  +FP+L+ L + +CE L+E+PS   E   L+ I+++ CR SV  S ++I+
Sbjct  731  WKFRSWTASSDNFPRLQKLVVHNCENLEEVPSCLGECPTLEMIEVKWCRTSVANSVKQIQ  790

Query  413  EEQLDYLNNIVDVVVAEQHG  354
            +EQ+D  N ++ + + ++ G
Sbjct  791  QEQIDMGNEVLKISIEDRVG  810



>ref|XP_011077104.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=898

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 89/179 (50%), Gaps = 7/179 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN-----SHIFLLKSLKGLELRRNCFEWN  723
            + NLV+L QLE+L I      W S SP  I  +       +   + LK L L        
Sbjct  719  LHNLVHLHQLEKLKISMPISSWESHSPTWIPESRVPLWEKLAFPRMLKKLTLGGFMLSQQ  778

Query  722  GINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKL  546
             +  +  LP L VLKLR     G +WE  + + F QL  L I+ T+L+ W     HFP L
Sbjct  779  DMATIGSLPNLHVLKLRRCSFRGGKWETTEGE-FAQLKFLKIESTNLKHWVTDSSHFPTL  837

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVV  369
            E L L+ C +L EIP+   EI  L+ I+++S    +  SA+ IK+EQ D  N  + V +
Sbjct  838  ERLLLYHCPELYEIPNVIGEIPTLELIEVKSWDEFLGNSAKRIKQEQEDSGNECLRVRI  896



>ref|XP_011086979.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=870

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (57%), Gaps = 8/145 (6%)
 Frame = -1

Query  782  IFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVL  606
            IF L+ L+ + L      W+ ++   KLPRLEVLKLR  AC G  W+  D+ +F  L  L
Sbjct  717  IFELRYLRKVTLTGLGLPWHDMSSFGKLPRLEVLKLRCNACRGPVWK-SDEVRFRGLRYL  775

Query  605  IIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIP------SGFAEISRLKSIQLRSCRP  444
            +++  DLE W A  + F  L++LS+  C KLK+IP        F     LK I+L  C  
Sbjct  776  LLEDVDLEKWDADCFSFQMLQYLSIRHCYKLKKIPLEIGKTIQFRGPPTLKGIELVDCGE  835

Query  443  SVVASAQEIKEEQLDYLNNIVDVVV  369
            SVVASA++I +EQ+   N ++ V V
Sbjct  836  SVVASAKQIVDEQVKLGNKLLQVYV  860



>ref|XP_010677242.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010677243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
Length=1165

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 81/143 (57%), Gaps = 5/143 (3%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCK-LPRLEVLKL-RAACVGEQWELPDDD-KFCQLIVLIID  597
             SLK L L   C  W  ++VL K +P+LEVLKL   A  GEQ ++  D+ +F +L    + 
Sbjct  1019  SLKQLTLSEFCLPWKQMSVLAKSMPKLEVLKLVNIAFEGEQCDMDTDEVEFSELKFFKLK  1078

Query  596   RTDLEDW--KATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQ  423
               ++ +W    +   FPKLE L +  C+KL++IPS F +  +L+ I L  C+ SV  SA 
Sbjct  1079  GINIHNWIISCSADAFPKLECLVIKYCDKLRKIPSSFVDNKKLRLILLEGCKSSVEKSAN  1138

Query  422   EIKEEQLDYLNNIVDVVVAEQHG  354
             +IKEEQ DY N   +VV     G
Sbjct  1139  QIKEEQQDYGNKNFEVVTRPSDG  1161



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (58%), Gaps = 7/139 (5%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK + L     +W+ ++ L  LP LEVLKL+  A  G +WE P D  F  L VL I RT
Sbjct  749  NLKKITLSDTLLDWDHMSTLGMLPNLEVLKLKDYAFKGSRWE-PLDGGFRLLRVLKIGRT  807

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASA-----  426
            DL  W A+ +HFP+L+ +    C  L+ IPSG AE+S L++++L   +P+   SA     
Sbjct  808  DLIWWDASGHHFPRLQCVVFRHCSSLEAIPSGLAEVSALQNMELHWPKPTAAYSARLIQR  867

Query  425  QEIKEEQLDYLNNIVDVVV  369
            Q+++ +QL  LN    + +
Sbjct  868  QKLQMQQLGLLNTAFKLFI  886



>emb|CDP12797.1| unnamed protein product [Coffea canephora]
Length=1287

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 2/135 (1%)
 Frame = -1

Query  764   LKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTD  588
             LK L L R    W  I+ + KL  LEVLKL+  A VGE+WE+   + F  L  L + + D
Sbjct  1138  LKKLTLSRTHMRWTLISRIGKLSSLEVLKLQHTAVVGEKWEMKAGE-FLNLRFLGLTKLD  1196

Query  587   LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
             L  W AT  +F  LE L +  C +L+E+PS   E S L+ I+L  CR S V S ++I +E
Sbjct  1197  LRSWTATSDNFSCLEKLVVEGCWELEEVPSCLGECSNLEVIELTGCRKSAVTSVKQIHQE  1256

Query  407   QLDYLNNIVDVVVAE  363
             Q+   N  + V++ +
Sbjct  1257  QMGMGNEGLRVIIED  1271



>emb|CDP20607.1| unnamed protein product [Coffea canephora]
Length=626

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRT  591
            +LK L L  NC  W+ I+ + KLP L VLKL  ++ +GE+W + + + F  L VL + R 
Sbjct  481  NLKKLSLSENCQPWSEISTIGKLPNLIVLKLHDSSFIGEEWVMKEGE-FPNLRVLELLRL  539

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            D+ +W A+   F  LE L +  C+KL+E+P+   E   L+ IQ+ +C  S+  S ++I++
Sbjct  540  DIRNWTASSDDFCHLEKLVVRHCKKLEEVPACLGECPTLEMIQVENCSESLANSIKQIQQ  599

Query  410  EQLDYLNNIVDVVV  369
            EQ+D  N ++ +++
Sbjct  600  EQMDSGNEVLKIII  613



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 90/191 (47%), Gaps = 29/191 (15%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYI-----------HAEYHEWHSTSPNMIQINSHIFLLKSLKGLE  750
              C+ NL  +  LE L +           H     W++  PN             LK L 
Sbjct  706  GSCLNNLHQMYSLETLKLLFNLPMKNPLPHNSIQRWNAFPPN-------------LKNLT  752

Query  749  LRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWK  573
            L  +   W    VL  LP LEVLKL+  +  G +WE  D++ F +L  L+++  DL  WK
Sbjct  753  LSCSLLLWQDARVLGNLPNLEVLKLKYFSFQGPEWE-TDEEGFHRLKYLLVESRDLVIWK  811

Query  572  ---ATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQL  402
                  Y FP L+HL    C KLKEIP    +I  L+ I+L SC P     A+ I+++Q+
Sbjct  812  QASTDSYPFPALQHLVFRFCNKLKEIPFEIGDIPSLQVIELYSCSPYATRLARMIQQDQI  871

Query  401  DYLNNIVDVVV  369
            D  N+ ++V +
Sbjct  872  DSGNSCLEVFI  882



>ref|XP_009766276.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 76/129 (59%), Gaps = 2/129 (2%)
 Frame = -1

Query  770   KSLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDR  594
             ++LK L L      W  I+++ +LP LEVLKL R A  GE+WE+ DD+ F  L  L +D 
Sbjct  1676  ENLKKLTLSNFRLPWKEISIIARLPNLEVLKLLRKAFEGEKWEVKDDE-FPALKALKLDD  1734

Query  593   TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
               +  W  +   FP LE L L  C+KLKEIPS F     ++SI++  C  SV  SA++I+
Sbjct  1735  VVISQWDVSDDAFPSLEKLVLQRCKKLKEIPSCFGYNCSIQSIEVSWCSLSVTESAKQIQ  1794

Query  413   EEQLDYLNN  387
             + Q++ + N
Sbjct  1795  DTQVNDMGN  1803



>ref|XP_011073039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=868

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVL-CKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRT  591
            SLK L L      W  + ++   LP LEVLKL  ACVG +W  P+D +F QL VL+I   
Sbjct  719  SLKKLSLWDCEIPWEKMTIIGSSLPNLEVLKLNNACVGPEWS-PNDGEFLQLKVLVIWSE  777

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
            +LE W A   HFP L  L L   ++LKEIP    +I  L+SI L  C  S + SA +I +
Sbjct  778  ELEHWGAEDIHFPNLHGLYLELMDELKEIPLSIGDIYTLQSIHLLGCSVSAMNSAVQIVK  837

Query  410  EQLDYLNNIVDVVV  369
            +Q +  N  + V V
Sbjct  838  DQKEKGNENLQVYV  851



>ref|XP_004236959.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=884

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 96/163 (59%), Gaps = 7/163 (4%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIF-LLKSLKGLELRRNCFEWNGINV  711
            I NL  L++LE L +  +   + + +   +Q+ +  F L++++K L LR   F W+    
Sbjct  701  INNLEELKRLEHLKLLNDVPHYMNKT---VQLPATFFRLVRTVKKLTLRNTRFSWSEAEK  757

Query  710  LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            L +L  LEVLKL+  A VG+ W+ P+   FC+L VL I+R +LE W+A+  ++P L +L 
Sbjct  758  LGQLESLEVLKLKENAFVGDTWK-PELGGFCKLRVLWIERAELETWEASNLNYPILRNLV  816

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
            L SC+KL  +P   A+I  L+ ++L +     V SA++I E +
Sbjct  817  LVSCDKLNAVPVELADIPNLREMKLENT-IKAVKSAKDILERK  858



>ref|XP_009788847.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=900

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 76/129 (59%), Gaps = 2/129 (2%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDR  594
            ++LK L L      W  I+++ +LP LEVLKL R A  GE+WE+ DD+ F  L  L +D 
Sbjct  766  ENLKKLTLSNFRLPWKEISIIARLPNLEVLKLLRKAFEGEKWEVKDDE-FPALKALKLDD  824

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
              +  W  +   FP LE L L  C+KLKEIPS F     ++SI++  C  SV  SA++I+
Sbjct  825  VVISQWDVSDDAFPSLEKLVLQRCKKLKEIPSCFGYNCSIQSIEVSWCSLSVTESAKQIQ  884

Query  413  EEQLDYLNN  387
            + Q++ + N
Sbjct  885  DTQVNDMGN  893



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 87/167 (52%), Gaps = 3/167 (2%)
 Frame = -1

Query  869  LQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNC-FEWNGINVLCKLPR  693
            L QLE+L    E      T    + +       ++LK L    +    W  ++++ KLP+
Sbjct  698  LYQLEKLEFQTERATAPPTDVPTLLLPPPDAFPQNLKSLTFSGDFNLAWKDLSIVGKLPK  757

Query  692  LEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEK  516
            LEVLKL   A +GE WE+ ++  F  L  L +D   +  W+A+  HFP LE L L  C  
Sbjct  758  LEVLKLSGHAFIGEGWEVVEEG-FPHLKFLFLDEVYIRYWRASSDHFPYLERLFLRDCYF  816

Query  515  LKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            L  IP  FA+I+ L    + SCR SVV SA++I+++  D   + ++V
Sbjct  817  LDSIPRDFADITTLALTDISSCRQSVVNSAKQIQQDIQDNYGSSIEV  863



>gb|EYU17763.1| hypothetical protein MIMGU_mgv1a002610mg [Erythranthe guttata]
Length=654

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 5/126 (4%)
 Frame = -1

Query  779  FLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLI  603
            F  ++LK L LR+   +W+ ++ L K+ +LEVLKL+  A VG QW +   D F  L  L+
Sbjct  507  FFPRNLKRLTLRKTSLQWSDMSTLAKIEKLEVLKLKQGAFVGIQWTV--RDVFPSLQFLL  564

Query  602  IDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQ  423
            ID  DL  W+A+  HFP L  LS+  C+KLKEIP   A+   L+ + +   R S  ASA+
Sbjct  565  IDDADLVIWEASAKHFPSLTCLSIKKCQKLKEIPLELAK--NLQRLDIDFLRKSATASAR  622

Query  422  EIKEEQ  405
             I+E +
Sbjct  623  AIQERK  628



>ref|XP_009798711.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=663

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = -1

Query  776  LLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLII  600
             L++L+ L L    F W+  N L +L  LEVLKL+  A +G+ W+ P+   F QL VL I
Sbjct  447  FLRTLRKLTLANTRFSWSEANKLGQLESLEVLKLKEDAFIGDSWQ-PEIRGFSQLQVLWI  505

Query  599  DR-TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQ  423
            ++ T LE W+A+  +FP L HL L SC+KLK +P G A+I  L+ ++L +     V SA+
Sbjct  506  EKATKLETWEASNLNFPVLRHLVLISCDKLKAVPLGLADIPNLQEMRLENTS-KAVKSAK  564

Query  422  EIKEEQL  402
            +++E ++
Sbjct  565  DVQESKI  571



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 100/188 (53%), Gaps = 3/188 (2%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            I+NL  L +LE L I  + + +         + S   L  +LK L+L +   +W  + V+
Sbjct  696  IDNLQYLPELEELSIATQGYLFEREEVECFSLTSPDALPLNLKKLKLSKTYLQWKYMAVI  755

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRY--HFPKLEHL  537
             KLP+LEVL+L+  A VG +W+  D  +F +L  L++D   L +W+ T    HF  LE +
Sbjct  756  GKLPKLEVLQLKDHAFVGNEWKATDQVRFHELKFLLLDCLYLRNWRTTDSNDHFSSLERV  815

Query  536  SLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQH  357
             +  C  LKEIP GFA    L+ I+L  C PSVVA AQ+I+E+   Y    + V+  +  
Sbjct  816  IIKGCNFLKEIPEGFAGSKNLELIELHKCTPSVVAIAQKIQEKHEYYGRCKLKVIDYDTA  875

Query  356  GYSWVSLP  333
            G     +P
Sbjct  876  GIFERQMP  883



>ref|XP_009789218.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789219.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009789220.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=775

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 94/193 (49%), Gaps = 27/193 (14%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSH-IFLLK-----------SLKGL  753
            ND I +L+ L  L++L I              ++++SH +F ++           +LK L
Sbjct  588  NDFIGSLICLVDLQKLSIQ-------------LKVSSHPLFFIRRPAQLWYVFPENLKSL  634

Query  752  ELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDW  576
             L     EW  + +L  LP LEVLKL      G  W L D+  F +L +L I +T L  W
Sbjct  635  TLVATHLEWTDMPMLSSLPNLEVLKLEFYGFEGSNWNL-DEGGFKKLKLLHIHQTRLVHW  693

Query  575  KATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDY  396
            +A     P LE+L L  C +L+EIP    +I  LK I L  C  + V SA+EI EEQ   
Sbjct  694  QAASDSLPVLEYLVLMFCSELEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEILEEQKSI  753

Query  395  LNNIVDVVVAEQH  357
             N ++ V V+  H
Sbjct  754  GNEVLVVTVSPDH  766



>ref|XP_009614364.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=887

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLI  612
            ++IF  K LK L L    FEW  +++L  L  LEVLKL+  A  G+ WE P+D  F  L 
Sbjct  737  AYIFPQK-LKKLTLIDTWFEWKDMSILGLLEYLEVLKLKQNAFRGQSWE-PEDGGFPCLQ  794

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VL I+RTDL  WKA+  +FP+L+ L L SC+KL+E+P+  A+   L+ ++L     S   
Sbjct  795  VLWIERTDLSSWKASSGNFPQLKRLVLISCDKLEELPAALADAQSLQLMELHYTSESAAK  854

Query  431  SAQEIKEEQL  402
            SA+ I + +L
Sbjct  855  SARVILKRRL  864



>emb|CDP20463.1| unnamed protein product [Coffea canephora]
Length=1160

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 79/140 (56%), Gaps = 3/140 (2%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDDDKFCQLIVLIIDRT  591
             +LK L LR     W+ I+ + KLP+LEVLKL     VGE+WE+ + + F  L VL +   
Sbjct  1021  NLKKLTLRGTDQGWSEISTIGKLPKLEVLKLLYCYAVGEEWEMKEGE-FPSLRVLQLSNL  1079

Query  590   -DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIK  414
                  W A+  +FP+LE L + SC  LKE+PS   E   L+ I++  C  SV +S ++I+
Sbjct  1080  WKFRSWTASSDNFPRLEKLVVHSCRNLKEVPSCLGECPTLEMIEVSGCHESVASSVKQIQ  1139

Query  413   EEQLDYLNNIVDVVVAEQHG  354
             +EQ D  N  + + +   +G
Sbjct  1140  QEQRDMGNEALKISIKYLYG  1159



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 81/129 (63%), Gaps = 4/129 (3%)
 Frame = -1

Query  788  SHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLI  612
            + IF  K L+ L L     EW+ ++VL +L  L+VLKL+  A  GE WEL +D  F  L 
Sbjct  737  ASIFPTK-LRKLTLLDTWLEWDDMSVLKQLENLQVLKLKDNAFKGENWEL-NDGGFPFLQ  794

Query  611  VLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVA  432
            VL I+R +L  W A+  HFP+L+HL + SC+KL++IP G A+I  L+ + LR+   S   
Sbjct  795  VLCIERANLVSWNASGDHFPRLKHLHI-SCDKLEKIPIGLADICSLQVMDLRNSTKSAAK  853

Query  431  SAQEIKEEQ  405
            SA+EI+ ++
Sbjct  854  SAREIQAKK  862



>ref|XP_011071935.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=888

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 98/207 (47%), Gaps = 25/207 (12%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINS-------------HIFLLKSLKGL  753
            + I+ + NL++L   Y +    + H +  N+ Q+N               I    SL+ L
Sbjct  675  EVIKRMPNLKKLRSSYSNGLVKDSHYSLCNLAQLNKLASLYLEHYSLSEGIAFPTSLEKL  734

Query  752  ELRRNCFEWNGINVL-CKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRTDLED  579
             L R    W  + ++   LP LEVL+L+     G +W L +++ F +L VL I    L  
Sbjct  735  TLSRCSIPWEEMTIIGSSLPNLEVLELKHPTFQGAEWNLVEEE-FLRLRVLSISGCKLVS  793

Query  578  WKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            W+    HFPKLE L L     LKEIPS   +I+ L SI L +C  SV+ SA ++  EQ+D
Sbjct  794  WRVESNHFPKLERLFLEDMHDLKEIPSSIGDIATLVSIHLDTCGNSVLHSAMQMLNEQVD  853

Query  398  YLN---------NIVDVVVAEQHGYSW  345
            Y N         +I  +++ E     W
Sbjct  854  YGNEFELLINGEDIYSLILGEGKDMGW  880



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 94/178 (53%), Gaps = 10/178 (6%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL+ L +LE L I +     +    ++   +S      +LK L LR+    W  + +
Sbjct  721  CLDNLIYLHELEELKISSYILTRYDVLLSLPFASS---FPPNLKKLTLRKTFLLWEDMTI  777

Query  710  LCKLPRLEVLKLRAAC------VGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPK  549
            + KLP+LEVL+L+A        V   WE+ +        +L+    DL+ W+A   +FP 
Sbjct  778  ISKLPKLEVLQLKADAFVISYPVDTVWEVTEMGFLELKFLLLE-WLDLDYWRAADDYFPC  836

Query  548  LEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            LEH+ + +C  LKEIP GFA+   L+ IQL  C  S+V  A++I+E      NN++ V
Sbjct  837  LEHIVIRNCRTLKEIPEGFADSLTLQQIQLHRCTSSLVTFAEQIQENHESLGNNMLKV  894



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 93/176 (53%), Gaps = 3/176 (2%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NL  L++LE L +           P +I  +   F   +LK L L R C  WN +N+  K
Sbjct  699  NLKYLKELEALNVTVPPDFIFDRLPCLINPSPGSFP-PNLKKLTLSRTCLPWNCMNIFSK  757

Query  701  LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LP LEVL+L+A A  G +WE+ +   F +L  L+++   L  W AT  +F  LE + +  
Sbjct  758  LPNLEVLELKARAFSGNEWEITETG-FPKLKCLLLEDLYLRYWTATDDYFECLERVCIRE  816

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAEQH  357
            C  LKEIP GFA+   L+ I+L  C   +V  A++I+ +  +  NN++ V   + +
Sbjct  817  CILLKEIPEGFADSETLQLIELHKCGRPLVTFAKQIQGKHEELGNNMLKVYAFDSY  872



>ref|XP_011087334.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=821

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 97/169 (57%), Gaps = 9/169 (5%)
 Frame = -1

Query  899  CNDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQIN-SHIFLLKSLKGLELRRNCFEWN  723
            C++ ++++ +L +L +L      H    TS    + + S++    SLK L LR       
Sbjct  656  CDEKVDHVRDLSRLHKL------HSLKCTSVYDGRTHFSNLIFPDSLKKLTLRDCGIRDP  709

Query  722  GINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKL  546
             +N + KLP LE+LKL+    V  +WE PD+ +F +L  L+++  +L +W A   HF +L
Sbjct  710  DMNRIGKLPNLEILKLQGCQFVSRKWE-PDEGEFHRLRFLLMENLNLVNWVADESHFRRL  768

Query  545  EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLD  399
            +HL +  C  L+ IP    +I  L+ I++ +CRPSV+ SA+ I+EEQL+
Sbjct  769  QHLFIQHCSDLEAIPLVIRDIPTLQVIEVHNCRPSVMNSARMIQEEQLE  817



>ref|XP_010677240.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
Length=1165

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 97/184 (53%), Gaps = 10/184 (5%)
 Frame = -1

Query  890   CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
             C   L  L  LE L++ + Y  W + +  +  ++    L  S+K L L   C  W  ++V
Sbjct  983   CFHALDFLNHLEILHL-SFYESWAARNHKVATLS----LPPSVKQLTLSEFCLPWKQMSV  1037

Query  710   LCK-LPRLEVLKL-RAACVGEQWELPDDD-KFCQLIVLIIDRTDLEDWK--ATRYHFPKL  546
             L K +P+LEVLKL   A  GE+ ++  D+ +F +L    +   ++ +W    +   FPKL
Sbjct  1038  LAKSMPKLEVLKLVNNAFEGEECDMDSDEVEFSELKFFKLKGINIRNWNISCSADAFPKL  1097

Query  545   EHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
             E L +  C KL++IPS F +  +L+ I L  C+ SV  SA +IKEEQ DY N   +VV  
Sbjct  1098  ECLVIKYCNKLRKIPSSFVDNEKLRLILLEGCKSSVEKSANQIKEEQQDYGNKNFEVVTR  1157

Query  365   EQHG  354
                G
Sbjct  1158  PSDG  1161



>ref|XP_006347943.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=491

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 3/121 (2%)
 Frame = -1

Query  764  LKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTD  588
            L+ L L     EW+ ++VL +L  L+VLKL+  A  GE WEL +D  F  L VL I+R +
Sbjct  347  LRRLTLSDTWLEWDDMSVLKQLEYLQVLKLKDNAFKGEHWEL-NDGGFPFLEVLCIERAN  405

Query  587  LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            L  W A+  HFP+L+HL + SC+KL++IP G A+I  L+ + L++   S   SA+EI+ +
Sbjct  406  LVSWNASGDHFPRLKHLHI-SCDKLEKIPIGLADIRSLQVMDLQNSTKSAAKSAREIQAK  464

Query  407  Q  405
            +
Sbjct  465  K  465



>gb|EPS70910.1| hypothetical protein M569_03853 [Genlisea aurea]
Length=723

 Score = 84.7 bits (208),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 78/142 (55%), Gaps = 2/142 (1%)
 Frame = -1

Query  809  PNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKL-RAACVGEQWELPDD  633
            P M+ I  +  L ++LK + L      W  I+++ KLP L  +KL   A  GE W + ++
Sbjct  442  PLMVFIPENCILPQNLKKVTLNNTRIPWESISIVGKLPELRTMKLMNNAFRGENW-IANE  500

Query  632  DKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRS  453
            ++F +L  L+ID  DL+ W A + HFP+LEHL++  C  L  IP     I  +K I++  
Sbjct  501  NEFKKLQHLVIDGADLKFWTAEKDHFPRLEHLTILDCIHLDGIPPQIPLIDTIKMIEVDD  560

Query  452  CRPSVVASAQEIKEEQLDYLNN  387
               S + SA EIK+E  + + N
Sbjct  561  ASSSALISAGEIKKEMQENIEN  582



>ref|XP_009786264.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=884

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 71/133 (53%), Gaps = 1/133 (1%)
 Frame = -1

Query  764  LKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRTD  588
            LK L L      W  +  +  LP L+ LK++     G+ W+L D++ F QL  L+I   +
Sbjct  746  LKRLTLSYTSLPWEDMANIVVLPNLQELKIKYNGFDGDVWKLNDEEAFNQLKFLLISTIN  805

Query  587  LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            L+ W+A+  +FP+LE L L  C  L+EIP    EI  L SI+L  C  S   S  EI+EE
Sbjct  806  LKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQEE  865

Query  407  QLDYLNNIVDVVV  369
            Q    NN + V+ 
Sbjct  866  QASMGNNCLSVIT  878



>ref|XP_009786258.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786259.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786260.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786261.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786262.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786263.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=884

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 71/133 (53%), Gaps = 1/133 (1%)
 Frame = -1

Query  764  LKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRTD  588
            LK L L      W  +  +  LP L+ LK++     G+ W+L D++ F QL  L+I   +
Sbjct  746  LKRLTLSYTSLPWEDMANIVVLPNLQELKIKYNGFDGDVWKLNDEEAFNQLKFLLISTIN  805

Query  587  LEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            L+ W+A+  +FP+LE L L  C  L+EIP    EI  L SI+L  C  S   S  EI+EE
Sbjct  806  LKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKSVNEIQEE  865

Query  407  QLDYLNNIVDVVV  369
            Q    NN + V+ 
Sbjct  866  QASMGNNCLSVIT  878



>gb|EYU29923.1| hypothetical protein MIMGU_mgv1a026346mg, partial [Erythranthe 
guttata]
Length=303

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 64/122 (52%), Gaps = 2/122 (2%)
 Frame = -1

Query  767  SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACV-GEQWELPDDDKFCQLIVLIIDRT  591
            SLK L L  +  +W  +  +  LP LEVLKL    V G +W  P + +F +L  L I  +
Sbjct  170  SLKKLTLSGSNLDWEELKGIGSLPNLEVLKLEYHSVRGSKWN-PIEGQFLRLKYLRIAHS  228

Query  590  DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             L+ W A  +HFP LE+L L    KL EIPSG  EI  L  I L  C  S   SA  I E
Sbjct  229  TLKYWNAESFHFPALENLVLQKLHKLAEIPSGIGEIPTLGLIHLYDCSKSAAISAMGILE  288

Query  410  EQ  405
            EQ
Sbjct  289  EQ  290



>emb|CDP12821.1| unnamed protein product [Coffea canephora]
Length=1248

 Score = 85.1 bits (209),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -1

Query  767   SLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRT  591
             +L+ L L  N   W+ I+ + KLP LEVLKL   + VGE+WE+ + + F  L  L +   
Sbjct  1068  NLRKLTLANNGQPWSKISAIGKLPSLEVLKLCCDSFVGEKWEMKEGE-FQNLRFLELSEL  1126

Query  590   DLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKE  411
             D   W A+  +F  LE L L SCE L+E+PS   E   L  I+L  CR SVV S ++I+ 
Sbjct  1127  DFRWWTASSDNFCCLEKLVLSSCESLEEVPSCLGEALTLDMIELEGCRASVVTSVKQIQH  1186

Query  410   EQLDYLNNIVDVVVAEQHG  354
             +Q+D  NN + ++   + G
Sbjct  1187  QQMDMGNNDLKLMKDGRSG  1205



>emb|CDP21314.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 88/162 (54%), Gaps = 8/162 (5%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVL  708
            + NLV LQ+LE L        +H+ +  + +      L  +LK L L R+   W  +  +
Sbjct  77   LNNLVCLQELETLEC-----SFHTQNREVRKNLGLAALPVTLKHLSLSRSYLPWEDMTFI  131

Query  707  CKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKAT-RYHFPKLEHLS  534
              LP LEVLKL+  A  G +WE P ++ F  L  L+I+ TDL  W+A    HFP L+HL 
Sbjct  132  AMLPNLEVLKLKNYAFQGPKWE-PTEEGFHSLKHLLIENTDLIHWEAIIVRHFPCLQHLV  190

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEE  408
            L  C+ L+EIP G  E+  L+ ++   C   +  SA+EI+E+
Sbjct  191  LKPCKLLEEIPFGVEELGTLQRLEAHYCSEPIENSAKEIQEQ  232



>ref|XP_011075016.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Sesamum indicum]
Length=860

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 86/154 (56%), Gaps = 4/154 (3%)
 Frame = -1

Query  818  STSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGE--QWE  645
            S+  N   I S+I L  S+K L L+      + +N + KLP LE+LKL+  C  E   WE
Sbjct  709  SSKYNRYNILSNIILPPSIKKLTLKGCRIRDHELNEIGKLPNLEILKLQY-CYFESGNWE  767

Query  644  LPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSI  465
              +D +FC+L  L++    L +W A   HFP+LE L +  C +LKEIP    +I  LK +
Sbjct  768  -GEDGEFCRLQFLLMKGLKLVNWTADDTHFPRLEELVIQYCFELKEIPLAIGDIPTLKVM  826

Query  464  QLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVAE  363
            ++  C  S  ASA+EI E Q+D  N+ + V + E
Sbjct  827  EVLRCGDSAKASAREIMEAQVDNGNDELQVRILE  860



>ref|XP_009783712.1| PREDICTED: putative late blight resistance protein homolog R1B-13 
[Nicotiana sylvestris]
Length=168

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 9/136 (7%)
 Frame = -1

Query  770  KSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDR  594
            K LK L L++    W  I  + KLP+LEVLKL+   C G  WE  +D  F QL  L++D 
Sbjct  29   KYLKKLTLQKTFVPWEDITTVSKLPKLEVLKLKIYNCRGTVWETIEDG-FPQLKFLLLDG  87

Query  593  TDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISR-LKSIQLRSCRPSVVASAQEI  417
            TD+  WK +  HFP LE L L +C+ L    S F   +  L+ I+L  C+ SVV SA++I
Sbjct  88   TDVALWKTSSDHFPCLECLVLGNCDSLH---SRFCRYNHTLQLIELNMCKHSVVNSAKQI  144

Query  416  KEEQLDYLNNIVDVVV  369
            ++E  D   N++DV V
Sbjct  145  QQEVGD---NVLDVRV  157



>gb|EYU23523.1| hypothetical protein MIMGU_mgv1a025044mg [Erythranthe guttata]
Length=727

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 83/166 (50%), Gaps = 12/166 (7%)
 Frame = -1

Query  896  NDCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGI  717
            ++C+ N   LQ+LE L    +Y   H    ++         L SLK L LR    +W  +
Sbjct  527  DNCLYNCCRLQKLESLKF--QYPREHDALQDLT-------FLSSLKKLYLRCCTIKWEDL  577

Query  716  NVLCKLPRLEVLKLRAA--CVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLE  543
              +  LP LEVLKLR +    G  W  P + +F +L  L I+   L +W A   HFP LE
Sbjct  578  TTIGSLPHLEVLKLRLSPNTAGHVWN-PIEGEFLRLKFLFIECIYLVNWNADSSHFPVLE  636

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQ  405
             L L   EKL+EIP    EI  L +I L+SC  S   SA +I EE+
Sbjct  637  KLVLEEMEKLEEIPLDIGEIPALGAISLKSCSESSAISAVKIAEER  682



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 91/170 (54%), Gaps = 3/170 (2%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NL  L++LE L +           P +I  +   F   +LK L L R C  WN + +  K
Sbjct  697  NLKYLKELEALNVTVPPDFISDRLPCLINPSPGSFP-SNLKKLTLSRTCLPWNCMIIFSK  755

Query  701  LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LP LEVL+L+  A  G +WE+ +   F +L  L+++   L  W AT  +F  LE + +  
Sbjct  756  LPNLEVLELKVHAFSGNEWEITEMG-FPKLKCLLLEDLYLRYWTATDDYFQCLERVCIRE  814

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            C  LKEIP GFA+   L+ I+L  CR  +V  A++I+E+  +  NN++ V
Sbjct  815  CTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQEKHEELGNNLLKV  864



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 91/170 (54%), Gaps = 3/170 (2%)
 Frame = -1

Query  881  NLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCK  702
            NL  L++LE L +           P +I  +   F   +LK L L R C  WN + +  K
Sbjct  698  NLKYLKELEALNVTVPPDFISDRLPCLINPSPGSFP-SNLKKLTLSRTCLPWNCMIIFSK  756

Query  701  LPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFS  525
            LP LEVL+L+  A  G +WE+ +   F +L  L+++   L  W AT  +F  LE + +  
Sbjct  757  LPNLEVLELKVHAFSGNEWEITEMG-FPKLKCLLLEDLYLRYWTATDDYFQCLERVCIRE  815

Query  524  CEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDV  375
            C  LKEIP GFA+   L+ I+L  CR  +V  A++I+E+  +  NN++ V
Sbjct  816  CTLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQEKHEELGNNLLKV  865



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 92/171 (54%), Gaps = 8/171 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C++NL  L +LE    + + + +     +M+Q   +  +  S+K L L     +W  +  
Sbjct  718  CLKNLGRLGKLESFDCYFD-NGYELNRNDMLQ---NFIIPNSIKKLTLSWTYLKWEDMKT  773

Query  710  -LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVL-IIDRTDLEDWKATRYHFPKLEH  540
             +  LP LEVLKL+  + +G +WE  +  +FC L  L I + +DLE W     HFP+LE 
Sbjct  774  KIGWLPNLEVLKLKYKSFLGGEWETVEG-QFCNLRFLQICEDSDLEWWTTDSTHFPRLEQ  832

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNN  387
            L L+   KLKEIPS   EI  L SI+L  C  S V SA+EI +EQ D  N 
Sbjct  833  LKLWDLYKLKEIPSCIGEIPTLGSIELIYCSKSAVISAKEILDEQEDLGNT  883



>gb|EYU20585.1| hypothetical protein MIMGU_mgv1a019584mg, partial [Erythranthe 
guttata]
Length=1018

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 85/150 (57%), Gaps = 4/150 (3%)
 Frame = -1

Query  806   NMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLRAACVGEQ-WELPDDD  630
             NM +    I LL  ++ L L   C  W  ++V+ +L +LEV KLR   V E+ WE   + 
Sbjct  861   NMYRKWVGISLLPGIRKLVLSDLCLTWEMLSVIGRLQKLEVFKLRCTAVEERIWE-TREG  919

Query  629   KFCQLIVLIIDRTDLEDWK-ATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRS  453
             +F +L VL ++  +L +W   +  HFPKL+ L L  C +LKEIP    EI  L+ I++R 
Sbjct  920   EFQELRVLKLEGLELAEWNVGSSEHFPKLQQLVLRDCTELKEIPCDVGEIVTLQLIEVRG  979

Query  452   -CRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
              C  S+V SA +IK+EQ D  N    VV+A
Sbjct  980   FCEKSLVKSAIKIKDEQRDIGNEEFRVVIA  1009



>gb|EYU17765.1| hypothetical protein MIMGU_mgv1a022339mg [Erythranthe guttata]
Length=839

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 82/146 (56%), Gaps = 4/146 (3%)
 Frame = -1

Query  812  SPNMIQINSHIFLLKSLKGLELRRNCFEWNGINVLCKLPRLEVLKLR-AACVGEQWELP-  639
            SP    + S +   K++K + L    F W  +  +  LP L VLKLR +A  G +WE   
Sbjct  676  SPRCRAVCSMVNFPKNIKKITLSGCGFPWENVKAIADLPNLLVLKLRWSAFCGAKWETTT  735

Query  638  --DDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSI  465
              ++  F +L +L+++  D++ W+A   HFP LE L +  C KL++IP    +I  L+ I
Sbjct  736  CGEEIGFPKLKLLLMEDLDIQKWEAGNEHFPMLERLIIRHCYKLEKIPPEIGDIPLLEMI  795

Query  464  QLRSCRPSVVASAQEIKEEQLDYLNN  387
            Q+  C P+VV SA+ I++++  + N+
Sbjct  796  QVDDCNPAVVTSARGIQDKKASWGND  821



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 93/176 (53%), Gaps = 11/176 (6%)
 Frame = -1

Query  887  IENLVNLQQLERLYIHAEYHEWHSTSPN-MIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            + NL++  QLE+L +           P  + +   ++    SLK L L      W  + +
Sbjct  584  LNNLLHFHQLEKLKV--------KIFPTFLFRRKLNLAFPPSLKKLTLSGWQRPWEDMGI  635

Query  710  LCKLPRLEVLKLR-AACVGEQWELPDDDKFCQLIVLIIDRTDLEDWKATRYHFPKLEHLS  534
            +  LP LEVLKLR  A  G +WE  +++  C L  L++D++DL+ W     HFP L+ L 
Sbjct  636  VSLLPNLEVLKLRDYAFRGYKWETSEEEFRC-LKFLLLDKSDLQHWITESSHFPNLKCLV  694

Query  533  LFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLNNIVDVVVA  366
            L+ C  LKEIP GF EI  L+ I++     S+V SA++I+E Q  + N+   V V 
Sbjct  695  LYRCWCLKEIPDGFGEIPTLELIKVDDGNISLVDSARQIQEVQQGWGNDAFQVRVG  750



>ref|XP_011072172.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=786

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 92/191 (48%), Gaps = 18/191 (9%)
 Frame = -1

Query  893  DCIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINS-------------HIFLLKSLKGL  753
            D +E + NL++L   Y+     +      ++ Q+N               I    SLK L
Sbjct  589  DVVERIPNLKKLNVSYLRFGRDDSCYYLRDLAQLNKLESLYELFCPSLEQIIFPTSLKKL  648

Query  752  ELR--RNCFEWNGINVL-CKLPRLEVLKLRAACVGEQWELPDDDKFCQLIVLIIDRTDLE  582
             L   RN F W  + ++   LP LEVLKL  A  G +W +P +  F +L VL+I    LE
Sbjct  649  SLSMTRN-FPWGQMTIIGSSLPNLEVLKLYRAFRGYEW-IPVEGAFLRLKVLVIGLCYLE  706

Query  581  DWKATRYHFPKLEHLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQL  402
             W A   HFP L+ L+L S   LKEIP    +I  L+ I L  C  SV+ SA EI E+Q 
Sbjct  707  QWGAEDIHFPNLQSLTLTSMNSLKEIPLSIGDICTLQFIHLDRCSKSVIKSAYEILEDQE  766

Query  401  DYLNNIVDVVV  369
            +  N  + V V
Sbjct  767  EKGNESLQVYV  777



>gb|EYU21842.1| hypothetical protein MIMGU_mgv1a020462mg, partial [Erythranthe 
guttata]
Length=846

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 86/171 (50%), Gaps = 9/171 (5%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C+ NLV L +LE       ++ W+   PN   +  +  L  SLK L L      W  +  
Sbjct  652  CLNNLVRLCKLESF--GCSFNTWNK--PNRDDMLQNFILPNSLKKLTLEGTNLYWEDMGT  707

Query  710  -LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLII--DRTDLEDWKATRYHFPKLE  543
             +  LP L+VLKL+A + +G +WE  +  +FC L  L I      LE W     HFP+LE
Sbjct  708  KIGLLPNLQVLKLKAKSFIGPEWETVEG-QFCNLRFLGIYDSHCGLEWWTTDSSHFPRLE  766

Query  542  HLSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
             L L   +   EIPS   EI  L+SIQL +C  S V SA+ I E+Q +  N
Sbjct  767  RLVLHFLDNFVEIPSAIGEIPTLQSIQLNNCTDSAVISAKRILEDQEELQN  817



>gb|EYU33968.1| hypothetical protein MIMGU_mgv1a026820mg, partial [Erythranthe 
guttata]
Length=880

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 91/170 (54%), Gaps = 6/170 (4%)
 Frame = -1

Query  890  CIENLVNLQQLERLYIHAEYHEWHSTSPNMIQINSHIFLLKSLKGLELRRNCFEWNGINV  711
            C+ NL  L++LE L  +    +      +++Q   ++    SLK L L R    W  + +
Sbjct  694  CLNNLCRLEKLESLGCYFAPEKEPIIRNHLLQ---NLNFPHSLKKLLLYRTRLHWGDMAI  750

Query  710  -LCKLPRLEVLKLRA-ACVGEQWELPDDDKFCQLIVLII-DRTDLEDWKATRYHFPKLEH  540
             +  LP L+VLKL   A  G++WE  +  +FC L  L+I D  +L  W+    HFP LE 
Sbjct  751  KIGSLPFLQVLKLETNAFCGDEWETIEGRQFCNLKFLLIEDCGELRYWRTESSHFPCLEQ  810

Query  539  LSLFSCEKLKEIPSGFAEISRLKSIQLRSCRPSVVASAQEIKEEQLDYLN  390
            LSL   + L+EIP    EI  L++I L+ C  S V SA+EI EEQL+  N
Sbjct  811  LSLRDLDILEEIPWDIGEIPTLETIVLKYCSHSAVISAKEIVEEQLENGN  860



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2077268246224