BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12275

Length=979
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002276380.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    202   1e-55   Vitis vinifera
ref|XP_006432540.1|  hypothetical protein CICLE_v10000617mg             186   1e-49   Citrus clementina
ref|XP_006432536.1|  hypothetical protein CICLE_v10000608mg             185   2e-49   Citrus clementina
gb|KDO53815.1|  hypothetical protein CISIN_1g007174mg                   184   3e-49   Citrus sinensis [Valencia orange]
ref|NP_001275851.1|  ethylene-insensitive 3-like 1 protein              181   3e-48   Citrus sinensis [Valencia orange]
gb|AAP04001.1|  EIL5                                                    179   3e-47   Nicotiana tabacum [American tobacco]
ref|XP_009759370.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    177   1e-46   Nicotiana sylvestris
ref|XP_010106128.1|  Protein ETHYLENE INSENSITIVE 3                     176   2e-46   Morus notabilis
ref|XP_002310961.1|  hypothetical protein POPTR_0008s01200g             174   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_009595535.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    172   9e-45   Nicotiana tomentosiformis
ref|XP_010106127.1|  Protein ETHYLENE INSENSITIVE 3                     171   1e-44   Morus notabilis
gb|ADZ97022.2|  EIL6                                                    167   3e-43   Nicotiana tabacum [American tobacco]
ref|XP_002315400.1|  EIN3-like family protein                           166   1e-42   Populus trichocarpa [western balsam poplar]
ref|NP_001234546.1|  EIL3 protein                                       164   3e-42   Solanum lycopersicum
gb|KGN46075.1|  hypothetical protein Csa_6G051520                       162   4e-42   Cucumis sativus [cucumbers]
ref|XP_004140927.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    162   1e-41   Cucumis sativus [cucumbers]
ref|XP_008231880.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    160   1e-40   Prunus mume [ume]
ref|XP_008456656.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    160   1e-40   Cucumis melo [Oriental melon]
ref|NP_001284429.1|  ETHYLENE INSENSITIVE 3-like 1 protein              160   1e-40   Cucumis melo [Oriental melon]
ref|XP_006347695.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     160   1e-40   Solanum tuberosum [potatoes]
ref|XP_008357657.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    155   8e-39   Malus domestica [apple tree]
gb|AGI41325.1|  EIN3-like protein                                       154   9e-39   Malus domestica [apple tree]
gb|AIS20827.1|  EIL                                                     153   3e-38   Pyrus x bretschneideri [bai li]
gb|ADE41155.1|  ethylene insensitive 3 class transcription factor       153   3e-38   Malus domestica [apple tree]
ref|XP_009355060.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    153   3e-38   Pyrus x bretschneideri [bai li]
ref|XP_007220648.1|  hypothetical protein PRUPE_ppa003493mg             150   2e-37   Prunus persica
gb|ABK35086.1|  EIL2                                                    150   3e-37   Prunus persica
emb|CDP16004.1|  unnamed protein product                                150   4e-37   Coffea canephora [robusta coffee]
ref|XP_008346133.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    149   6e-37   Malus domestica [apple tree]
gb|KHG00335.1|  ethylene insensitive 3 -like protein                    146   2e-36   Gossypium arboreum [tree cotton]
ref|XP_010067064.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    147   3e-36   Eucalyptus grandis [rose gum]
ref|XP_008231879.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    147   5e-36   Prunus mume [ume]
gb|ADE41154.1|  ethylene insensitive 3 class transcription factor       146   7e-36   Malus domestica [apple tree]
gb|ACM89299.1|  EIN3-like protein EIL1                                  145   1e-35   Eriobotrya japonica [loquat]
ref|XP_009339245.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    145   2e-35   Pyrus x bretschneideri [bai li]
gb|AGI41324.1|  EIN3-like protein                                       145   2e-35   Malus domestica [apple tree]
ref|XP_008364747.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    144   3e-35   Malus domestica [apple tree]
dbj|BAI44821.1|  ethylene insensitive 3-like                            144   4e-35   Daucus carota [Queen Anne's lace]
ref|XP_007016682.1|  Ethylene insensitive 3 family protein              143   7e-35   Theobroma cacao [chocolate]
ref|XP_011091876.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     141   3e-34   Sesamum indicum [beniseed]
ref|XP_009355361.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    140   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_010247605.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     140   1e-33   Nelumbo nucifera [Indian lotus]
gb|KHG09663.1|  ethylene insensitive 3 -like protein                    139   2e-33   Gossypium arboreum [tree cotton]
gb|KJB26156.1|  hypothetical protein B456_004G227800                    139   2e-33   Gossypium raimondii
ref|XP_010243659.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     139   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_011006497.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     135   6e-32   Populus euphratica
ref|XP_002530192.1|  ETHYLENE-INSENSITIVE3 protein, putative            134   1e-31   Ricinus communis
gb|KHN33829.1|  Protein ETHYLENE INSENSITIVE 3                          134   1e-31   Glycine soja [wild soybean]
ref|XP_003543159.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          134   1e-31   Glycine max [soybeans]
ref|XP_011080514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          134   2e-31   Sesamum indicum [beniseed]
ref|XP_006384758.1|  EIN3-like family protein                           134   2e-31   Populus trichocarpa [western balsam poplar]
emb|CBI29154.3|  unnamed protein product                                126   2e-31   Vitis vinifera
gb|KJB56070.1|  hypothetical protein B456_009G105400                    133   4e-31   Gossypium raimondii
ref|XP_009801714.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     133   4e-31   Nicotiana sylvestris
ref|XP_012066274.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     131   2e-30   Jatropha curcas
ref|XP_010031647.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     131   2e-30   Eucalyptus grandis [rose gum]
dbj|BAA74714.1|  transcription factor TEIL                              131   2e-30   Nicotiana tabacum [American tobacco]
ref|XP_009587969.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     130   5e-30   Nicotiana tomentosiformis
gb|KJB83827.1|  hypothetical protein B456_013G266300                    127   3e-29   Gossypium raimondii
ref|XP_011090234.1|  PREDICTED: LOW QUALITY PROTEIN: protein ETHY...    127   4e-29   Sesamum indicum [beniseed]
gb|KHG04095.1|  ethylene insensitive 3 -like protein                    125   6e-29   Gossypium arboreum [tree cotton]
gb|AHA93899.1|  ethylene insensitive 3                                  125   2e-28   Coffea arabica [arabica coffee]
gb|KDO53813.1|  hypothetical protein CISIN_1g009144mg                   123   3e-28   Citrus sinensis [Valencia orange]
gb|KDO53812.1|  hypothetical protein CISIN_1g009144mg                   122   3e-28   Citrus sinensis [Valencia orange]
gb|KDO53810.1|  hypothetical protein CISIN_1g009144mg                   124   3e-28   Citrus sinensis [Valencia orange]
emb|CDP19134.1|  unnamed protein product                                124   5e-28   Coffea canephora [robusta coffee]
ref|XP_006361129.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    123   8e-28   Solanum tuberosum [potatoes]
ref|NP_001234541.1|  EIL1 protein                                       123   1e-27   Solanum lycopersicum
gb|KJB20248.1|  hypothetical protein B456_003G140600                    122   2e-27   Gossypium raimondii
ref|XP_006364491.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     122   2e-27   Solanum tuberosum [potatoes]
gb|AFI61908.1|  ethylene insensitive 3-like 2 protein                   122   3e-27   Paeonia suffruticosa [moutan peony]
ref|XP_011043514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          122   4e-27   Populus euphratica
gb|AFK45610.1|  unknown                                                 116   6e-27   Lotus japonicus
gb|AHB18380.1|  ethylene insensitive 3                                  120   8e-27   Momordica charantia [balsam pear]
ref|XP_006470438.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    119   2e-26   Citrus sinensis [Valencia orange]
ref|XP_009607827.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     119   2e-26   Nicotiana tomentosiformis
ref|XP_009798829.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    119   2e-26   Nicotiana sylvestris
ref|XP_008451093.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          119   3e-26   Cucumis melo [Oriental melon]
gb|AAP04000.1|  EIL4                                                    119   3e-26   Nicotiana tabacum [American tobacco]
gb|KHN38437.1|  Protein ETHYLENE INSENSITIVE 3                          117   3e-26   Glycine soja [wild soybean]
gb|AGK07288.1|  EIN3-3                                                  119   4e-26   Rosa hybrid cultivar
gb|KDO66378.1|  hypothetical protein CISIN_1g0070172mg                  119   4e-26   Citrus sinensis [Valencia orange]
gb|AID55343.1|  EIN3-like protein EIL1                                  119   4e-26   Actinidia chinensis
ref|XP_011032978.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    119   5e-26   Populus euphratica
ref|XP_003545483.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          118   5e-26   Glycine max [soybeans]
ref|XP_009798827.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    118   5e-26   Nicotiana sylvestris
gb|ABY28269.1|  EIN3-like protein EIL1                                  117   6e-26   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003519487.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          117   9e-26   Glycine max [soybeans]
gb|AFH56407.1|  EIN3-like protein EIL1                                  117   1e-25   Diospyros kaki [Japanese persimmon]
ref|XP_002312841.2|  EIN3-like family protein                           117   1e-25   Populus trichocarpa [western balsam poplar]
gb|KHN26027.1|  Protein ETHYLENE INSENSITIVE 3                          116   3e-25   Glycine soja [wild soybean]
ref|XP_004144109.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3          115   5e-25   Cucumis sativus [cucumbers]
ref|XP_011046481.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    115   5e-25   Populus euphratica
ref|NP_001234721.1|  EIL2 protein                                       115   6e-25   Solanum lycopersicum
ref|XP_009607986.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    115   7e-25   Nicotiana tomentosiformis
ref|XP_006446380.1|  hypothetical protein CICLE_v10014617mg             115   8e-25   Citrus clementina
ref|XP_004288382.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          114   9e-25   Fragaria vesca subsp. vesca
ref|XP_006446382.1|  hypothetical protein CICLE_v10014617mg             114   1e-24   Citrus clementina
ref|XP_003555660.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          114   2e-24   Glycine max [soybeans]
ref|XP_002275284.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3          113   2e-24   Vitis vinifera
gb|AFK80347.1|  ethylene-insensitive 3                                  113   3e-24   Cucumis sativus [cucumbers]
emb|CAB95830.1|  hypothetical protein                                   110   3e-24   Cicer arietinum [garbanzo]
ref|XP_006361131.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     112   6e-24   Solanum tuberosum [potatoes]
gb|ACJ70675.1|  EIN3-like protein EIL2                                  112   7e-24   Actinidia deliciosa [Chinese gooseberry]
dbj|BAB64344.1|  EIN3-like protein                                      112   8e-24   Cucumis melo [Oriental melon]
gb|AID55344.1|  EIN3-like protein EIL2                                  111   1e-23   Actinidia chinensis
ref|XP_004501972.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    111   1e-23   Cicer arietinum [garbanzo]
ref|XP_011012998.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    111   1e-23   Populus euphratica
ref|XP_004491182.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    110   3e-23   Cicer arietinum [garbanzo]
ref|XP_004306440.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    110   4e-23   Fragaria vesca subsp. vesca
gb|AAP70005.1|AF498235_1  EIL                                           107   6e-23   Solanum lycopersicum
ref|NP_001233931.1|  EIN3-like protein                                  108   8e-23   Solanum lycopersicum
gb|AHC70432.1|  ethylene insensitive 3-like protein                     107   4e-22   Cucurbita pepo subsp. pepo [field pumpkin]
gb|AHC70433.1|  ethylene insensitive 3 protein                          106   8e-22   Cucurbita pepo subsp. pepo [field pumpkin]
gb|ACP56697.1|  EIN3-like protein                                       105   1e-21   Lithospermum erythrorhizon
gb|KDO66375.1|  hypothetical protein CISIN_1g0070172mg                  105   2e-21   Citrus sinensis [Valencia orange]
ref|XP_007146083.1|  hypothetical protein PHAVU_006G011200g             102   2e-20   Phaseolus vulgaris [French bean]
ref|XP_003543154.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          101   3e-20   Glycine max [soybeans]
gb|EYU35998.1|  hypothetical protein MIMGU_mgv1a003505mg              99.8    1e-19   Erythranthe guttata [common monkey flower]
gb|EYU26910.1|  hypothetical protein MIMGU_mgv1a026901mg              99.4    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_010694878.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  98.2    4e-19   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_007218956.1|  hypothetical protein PRUPE_ppa003550mg           96.7    1e-18   Prunus persica
gb|AAL76272.1|AF467784_1  transcription factor EIL1                   95.9    2e-18   Vigna radiata [mung bean]
gb|AAL76271.1|AF467783_1  transcription factor EIL2                   95.1    3e-18   Vigna radiata [mung bean]
gb|ABG89103.1|  ethylene insensitive-like protein 4                   94.7    5e-18   Musa acuminata [banana]
ref|XP_007141570.1|  hypothetical protein PHAVU_008G207000g           94.0    1e-17   Phaseolus vulgaris [French bean]
ref|XP_009404687.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  92.4    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010544311.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   92.4    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_007146084.1|  hypothetical protein PHAVU_006G011300g           90.5    1e-16   Phaseolus vulgaris [French bean]
ref|XP_008375510.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   90.1    2e-16   
ref|XP_003617086.1|  Ethylene insensitive 3-like protein              89.7    2e-16   Medicago truncatula
gb|ACJ85584.1|  unknown                                               89.7    2e-16   Medicago truncatula
ref|XP_009339243.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  89.4    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_009339244.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  89.4    4e-16   Pyrus x bretschneideri [bai li]
gb|ACD87815.1|  putative ethylene insensitive transcription factor    87.8    8e-16   Vicia faba [broad bean]
gb|ABG89102.1|  ethylene insensitive-like protein 3                   86.7    2e-15   Musa acuminata [banana]
ref|XP_009341360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  86.7    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_009420955.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  86.3    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54673.1|  ethylene insensitive protein 3                        86.3    3e-15   Phaseolus vulgaris [French bean]
gb|AGV54306.1|  transcription factor EIL1                             86.3    3e-15   Phaseolus vulgaris [French bean]
gb|AAK67355.1|AF387795_1  transcription factor                        85.9    4e-15   Cucumis melo [Oriental melon]
ref|XP_010557480.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   85.9    4e-15   Tarenaya hassleriana [spider flower]
gb|AGI41323.1|  EIN3-like protein                                     85.5    5e-15   Malus domestica [apple tree]
gb|ADE41153.1|  ethylene insensitive 3 class transcription factor     85.5    5e-15   Malus domestica [apple tree]
ref|XP_010544313.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   85.5    5e-15   Tarenaya hassleriana [spider flower]
gb|AEB37086.1|  EIN3                                                  83.2    7e-15   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37127.1|  EIN3                                                  82.8    8e-15   Helianthus annuus
ref|XP_002467935.1|  hypothetical protein SORBIDRAFT_01g036740        84.7    9e-15   Sorghum bicolor [broomcorn]
gb|AEB37094.1|  EIN3                                                  82.8    9e-15   Helianthus annuus
gb|AEB37161.1|  EIN3                                                  82.8    9e-15   Helianthus annuus
gb|AEB37114.1|  EIN3                                                  82.8    9e-15   Helianthus annuus
gb|AEB37115.1|  EIN3                                                  82.8    1e-14   Helianthus annuus
ref|XP_006650014.1|  PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INS...  84.7    1e-14   Oryza brachyantha
gb|AEB37153.1|  EIN3                                                  82.4    1e-14   Helianthus annuus
gb|AEB37087.1|  EIN3                                                  82.0    1e-14   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37162.1|  EIN3                                                  82.0    1e-14   Helianthus annuus
gb|AEB37085.1|  EIN3                                                  82.0    1e-14   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37150.1|  EIN3                                                  82.0    1e-14   Helianthus annuus
gb|AEB37159.1|  EIN3                                                  82.0    1e-14   Helianthus annuus
dbj|BAF44108.1|  ethylene signal transcription factor                 84.0    2e-14   Musa acuminata AAA Group [Cavendish banana]
gb|AEB37063.1|  EIN3                                                  81.6    2e-14   Helianthus petiolaris
gb|AEB37106.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
ref|XP_010521603.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  84.0    2e-14   Tarenaya hassleriana [spider flower]
gb|AEB37151.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37158.1|  EIN3                                                  82.0    2e-14   Helianthus annuus
gb|AEB37082.1|  EIN3                                                  81.6    2e-14   Helianthus exilis
gb|AEB37125.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37108.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37077.1|  EIN3                                                  81.6    2e-14   Helianthus exilis
gb|AEB37084.1|  EIN3                                                  81.6    2e-14   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37060.1|  EIN3                                                  81.6    2e-14   Helianthus petiolaris
gb|AEB37131.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37152.1|  EIN3                                                  82.0    2e-14   Helianthus annuus
ref|XP_010521602.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  84.0    2e-14   Tarenaya hassleriana [spider flower]
gb|AEB37118.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37164.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37064.1|  EIN3                                                  81.6    2e-14   Helianthus petiolaris
gb|AEB37137.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
ref|XP_008368189.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  84.0    2e-14   
gb|AEB37100.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37112.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37102.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37104.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
ref|XP_004984528.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   84.0    2e-14   Setaria italica
gb|AEB37135.1|  EIN3                                                  81.6    2e-14   Helianthus annuus
gb|AEB37079.1|  EIN3                                                  81.3    2e-14   Helianthus exilis
gb|AEB37096.1|  EIN3                                                  81.3    2e-14   Helianthus annuus
gb|AEB37160.1|  EIN3                                                  81.3    2e-14   Helianthus annuus
gb|AEB37066.1|  EIN3                                                  81.3    2e-14   Helianthus paradoxus
gb|AEB37076.1|  EIN3                                                  81.3    2e-14   Helianthus paradoxus
gb|AEB37075.1|  EIN3                                                  81.3    3e-14   Helianthus paradoxus
gb|AEB37068.1|  EIN3                                                  81.3    3e-14   Helianthus paradoxus
gb|AEB37067.1|  EIN3                                                  81.3    3e-14   Helianthus paradoxus
gb|AEB37069.1|  EIN3                                                  81.3    3e-14   Helianthus paradoxus
gb|AEB37080.1|  EIN3                                                  81.3    3e-14   Helianthus exilis
gb|AEB37091.1|  EIN3                                                  80.9    5e-14   Helianthus argophyllus
gb|AEB37154.1|  EIN3                                                  80.1    6e-14   Helianthus annuus
ref|XP_008354838.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   82.0    7e-14   Malus domestica [apple tree]
gb|AEB37061.1|  EIN3                                                  80.1    7e-14   Helianthus petiolaris
ref|XP_010689360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  82.0    7e-14   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|NP_001146219.1|  uncharacterized protein LOC100279789             82.0    7e-14   Zea mays [maize]
gb|AGY30671.1|  ethylene insensitive 3                                82.0    7e-14   Saccharum hybrid cultivar [sugarcane]
ref|NP_001152035.1|  ETHYLENE-INSENSITIVE3-like 1 protein             82.0    8e-14   Zea mays [maize]
gb|AEB37062.1|  EIN3                                                  79.7    1e-13   Helianthus petiolaris
gb|AEB37088.1|  EIN3                                                  79.3    1e-13   Helianthus argophyllus
gb|AAV68142.1|  ethylene insensitive 3-like 4                         80.9    2e-13   Dianthus caryophyllus [carnation]
gb|AEB37081.1|  EIN3                                                  78.2    3e-13   Helianthus exilis
gb|AEB37156.1|  EIN3                                                  78.2    3e-13   Helianthus annuus
ref|XP_009417872.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  80.1    3e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEB37126.1|  EIN3                                                  78.2    3e-13   Helianthus annuus
gb|AEB37098.1|  EIN3                                                  78.2    3e-13   Helianthus annuus
gb|AEB37165.1|  EIN3                                                  78.2    3e-13   Helianthus annuus
gb|AEB37139.1|  EIN3                                                  78.2    3e-13   Helianthus annuus
gb|AEB37155.1|  EIN3                                                  78.2    3e-13   Helianthus annuus
gb|AEB37083.1|  EIN3                                                  77.8    3e-13   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB37089.1|  EIN3                                                  77.8    4e-13   Helianthus argophyllus
gb|AEB37092.1|  EIN3                                                  77.8    4e-13   Helianthus argophyllus
gb|ABF95697.1|  ETHYLENE-INSENSITIVE3-like 1 protein, putative, e...  79.3    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AAZ78349.1|  EIN3-like protein 1                                   79.3    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AEB37146.1|  EIN3                                                  76.6    8e-13   Helianthus annuus
gb|ACN27664.1|  unknown                                               79.0    8e-13   Zea mays [maize]
gb|ACJ85709.1|  unknown                                               76.6    1e-12   Medicago truncatula
gb|AEB37071.1|  EIN3                                                  76.3    1e-12   Helianthus paradoxus
ref|XP_006293460.1|  hypothetical protein CARUB_v10022879mg           78.2    1e-12   Capsella rubella
gb|AEB37157.1|  EIN3                                                  76.3    1e-12   Helianthus annuus
ref|XP_003638449.1|  Ethylene insensitive 3-like protein              77.4    3e-12   
gb|EAY89823.1|  hypothetical protein OsI_11369                        77.4    3e-12   Oryza sativa Indica Group [Indian rice]
gb|ACN31333.1|  unknown                                               76.6    4e-12   Zea mays [maize]
ref|XP_009406830.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  76.3    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACX54782.1|  ethylene insensitive-like protein 1                   76.3    7e-12   Medicago truncatula
dbj|BAF44110.1|  ethylene signal transcription factor                 75.9    8e-12   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002879041.1|  hypothetical protein ARALYDRAFT_481586           75.9    9e-12   Arabidopsis lyrata subsp. lyrata
gb|ABG89100.1|  ethylene insensitive-like protein 1                   75.1    1e-11   Musa acuminata [banana]
ref|XP_009355062.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   75.1    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_010557481.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   73.6    5e-11   Tarenaya hassleriana [spider flower]
ref|XP_006408669.1|  hypothetical protein EUTSA_v10001938mg           73.2    6e-11   Eutrema salsugineum
ref|XP_009145590.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  73.2    6e-11   Brassica rapa
dbj|BAB78462.2|  ethylene-insensitive-3-like protein                  73.2    8e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145591.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  72.8    8e-11   Brassica rapa
ref|XP_009135708.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   72.4    1e-10   Brassica rapa
ref|XP_010417849.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  72.4    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010417850.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  72.4    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010473094.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  72.4    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010510821.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  72.0    2e-10   Camelina sativa [gold-of-pleasure]
dbj|BAJ95094.1|  predicted protein                                    71.6    2e-10   Hordeum vulgare subsp. vulgare [barley]
ref|XP_010521598.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   71.6    2e-10   Tarenaya hassleriana [spider flower]
gb|AFU90136.4|  ethylene-insensitive 3                                71.2    3e-10   Paeonia lactiflora [common garden peony]
gb|AFI61909.1|  ethylene insensitive 3-like 3 protein                 71.2    3e-10   Paeonia suffruticosa [moutan peony]
ref|NP_180273.1|  ethylene insensitive 3-like 1 protein               71.2    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49746.1|  ethylene-insensitive3-like1                           71.2    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KDO66381.1|  hypothetical protein CISIN_1g0070172mg                70.9    3e-10   Citrus sinensis [Valencia orange]
gb|AEB37065.1|  EIN3                                                  69.3    4e-10   Helianthus petiolaris
ref|XP_010943685.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  70.1    7e-10   Elaeis guineensis
ref|XP_010488063.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   69.7    8e-10   Camelina sativa [gold-of-pleasure]
gb|KDO53820.1|  hypothetical protein CISIN_1g007174mg                 69.7    9e-10   Citrus sinensis [Valencia orange]
ref|XP_010509323.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  69.7    9e-10   Camelina sativa [gold-of-pleasure]
emb|CDY19606.1|  BnaA05g20140D                                        69.7    9e-10   Brassica napus [oilseed rape]
ref|XP_010509301.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  69.7    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010466283.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   69.7    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009384965.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   69.7    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006297205.1|  hypothetical protein CARUB_v10013213mg           69.3    1e-09   Capsella rubella
ref|XP_009110178.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   68.9    1e-09   Brassica rapa
gb|ABR17204.1|  unknown                                               68.6    1e-09   Picea sitchensis
emb|CDY06379.1|  BnaC05g31510D                                        68.9    2e-09   Brassica napus [oilseed rape]
gb|EYU46131.1|  hypothetical protein MIMGU_mgv1a003270mg              68.6    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_010554461.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  67.4    6e-09   Tarenaya hassleriana [spider flower]
ref|XP_006406351.1|  hypothetical protein EUTSA_v10020292mg           66.6    9e-09   Eutrema salsugineum
dbj|BAJ33948.1|  unnamed protein product                              66.2    1e-08   Eutrema halophilum
ref|XP_009133914.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  66.2    1e-08   Brassica rapa
dbj|BAF44109.1|  ethylene signal transcription factor                 65.9    2e-08   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009389151.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.9    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK39393.1|  protein ethylene insensitive 3-like                   65.9    2e-08   Arabis alpina [alpine rockcress]
ref|XP_009391636.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.9    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY27563.1|  BnaC01g32460D                                        65.9    2e-08   Brassica napus [oilseed rape]
ref|XP_002885403.1|  ethylene-insensitive3                            65.5    2e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_010943654.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.5    2e-08   Elaeis guineensis
ref|XP_003558012.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.1    3e-08   Brachypodium distachyon [annual false brome]
ref|XP_009402439.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.1    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAV68141.1|  ethylene insensitive 3-like 3                         64.7    4e-08   Dianthus caryophyllus [carnation]
emb|CDY38540.1|  BnaC03g26570D                                        64.7    4e-08   
ref|XP_009414231.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  64.3    5e-08   
emb|CDX83250.1|  BnaA03g22560D                                        64.3    6e-08   
ref|NP_188713.1|  protein ethylene insensitive 3                      64.3    6e-08   
gb|AGE45505.1|  ethylene insensitive like protein                     63.9    7e-08   
gb|ABY88641.1|  ethylene-insensitive3                                 60.8    8e-08   
gb|ABY88627.1|  ethylene-insensitive3                                 60.8    8e-08   
gb|EMS67666.1|  Protein ETHYLENE INSENSITIVE 3                        63.9    9e-08   
gb|ABY88634.1|  ethylene-insensitive3                                 60.8    9e-08   
gb|ABY88644.1|  ethylene-insensitive3                                 60.8    9e-08   
gb|ABY88598.1|  ethylene-insensitive3                                 60.8    1e-07   
gb|ABY88668.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88663.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88653.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88623.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88584.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88600.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88675.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88656.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88662.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88671.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88586.1|  ethylene-insensitive3                                 60.5    1e-07   
ref|XP_006658979.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   62.8    1e-07   
gb|ABY88619.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88674.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88616.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88625.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88602.1|  ethylene-insensitive3                                 60.1    1e-07   
gb|ABY88659.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88605.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88585.1|  ethylene-insensitive3                                 60.1    1e-07   
gb|ABY88610.1|  ethylene-insensitive3                                 60.5    1e-07   
gb|ABY88591.1|  ethylene-insensitive3                                 60.1    2e-07   
gb|ABY88666.1|  ethylene-insensitive3                                 60.1    2e-07   
gb|ABY88622.1|  ethylene-insensitive3                                 60.1    2e-07   
gb|ABY88590.1|  ethylene-insensitive3                                 60.1    2e-07   
gb|ABY88607.1|  ethylene-insensitive3                                 60.1    2e-07   
gb|ABY88588.1|  ethylene-insensitive3                                 60.1    2e-07   
emb|CDY60391.1|  BnaA01g36840D                                        62.4    2e-07   
gb|EMT14050.1|  Protein ETHYLENE INSENSITIVE 3                        62.8    2e-07   
gb|ABY88587.1|  ethylene-insensitive3                                 60.1    2e-07   
ref|XP_008809629.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  62.8    2e-07   
ref|XP_010527327.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   62.4    2e-07   
ref|XP_008790465.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  60.5    9e-07   
ref|XP_006400682.1|  hypothetical protein EUTSA_v10013166mg           56.6    1e-05   
gb|ERM97264.1|  hypothetical protein AMTR_s00119p00117410             56.6    2e-05   
ref|XP_011629273.1|  PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INS...  56.6    2e-05   
ref|XP_009410464.1|  PREDICTED: putative ETHYLENE INSENSITIVE 3-l...  55.8    3e-05   
ref|XP_004958734.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  55.1    5e-05   
ref|NP_001060678.1|  Os07g0685700                                     54.7    7e-05   
gb|EEC82710.1|  hypothetical protein OsI_27382                        54.7    8e-05   
ref|XP_004511180.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   53.1    2e-04   
ref|XP_003532834.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 5 pro...  52.0    5e-04   
gb|KHN29080.1|  ETHYLENE INSENSITIVE 3-like 5 protein                 52.0    5e-04   
ref|XP_006287498.1|  hypothetical protein CARUB_v10000708mg           51.6    6e-04   



>ref|XP_002276380.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
 ref|XP_010659025.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
Length=616

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 152/228 (67%), Gaps = 21/228 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K+YTCEY+QCPY+NY++ F DR SRNNHQ+NC YR  S+Q  GM NFQINN+ PA F
Sbjct  394  MDQKMYTCEYTQCPYNNYRLAFLDRASRNNHQMNCLYRSNSSQGFGMSNFQINNEKPAAF  453

Query  791  sapkpaapsvgssssvn----asSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
            S P     +     + +     S  GLPEDGQ+MIS+LMSFYDTN Q+N + N  NLN V
Sbjct  454  SLPFAQPKAAAPPVNQSPAFNVSGLGLPEDGQKMISDLMSFYDTNLQRNKSLNPGNLN-V  512

Query  623  VED-----------HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK  477
            +ED              LQLDD+FF  G  +GG  T ++TNMP+  S FSS+E QF Q K
Sbjct  513  MEDQNQPQQQQQQQKFQLQLDDNFFNQGVMMGGNIT-EETNMPLNHSVFSSSEIQFDQCK  571

Query  476  FQYESPFNGNTCD-PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
              ++SPF+ N  D   +FRFGSPFNLAA +DY ++D LPKQDVS WYL
Sbjct  572  -AFDSPFDTNPNDNIADFRFGSPFNLAA-VDY-TVDPLPKQDVSMWYL  616



>ref|XP_006432540.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006432541.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006471295.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471296.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471297.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471298.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X4 [Citrus 
sinensis]
 gb|ESR45780.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 gb|ESR45781.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
Length=614

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 140/229 (61%), Gaps = 26/229 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE++QCPY++Y  GF DRTSRNNHQ+NC YR  S+Q   M NFQINND PAVF
Sbjct  395  IDQKIYTCEFTQCPYNDYHHGFLDRTSRNNHQLNCPYRNNSSQGCVMPNFQINNDQPAVF  454

Query  791  sapkpaapsvgssssvnasS--------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            S P   +      + V   +         GLP+DGQ+MIS+LMSFYDTN Q N + +   
Sbjct  455  SLPFAQSTHPKPITPVKNQTQPQYNVSGLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGC  514

Query  635  LNAVVEDHN--------LLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQS  480
            LN V ED N         LQLDD F+  G  V  G      NMP+    FSSTE  F Q 
Sbjct  515  LN-VTEDRNQQPEQQKFQLQLDDSFYNQGVGVMKGG-----NMPVNNPVFSSTEVHFDQC  568

Query  479  KFQYESPFNGNTCD-PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            K  ++SPF+ N  D   EFRF SPFN+A+ +DY  MD +PKQDVS WYL
Sbjct  569  K-AFDSPFDNNPGDNIAEFRFNSPFNIAS-VDY-PMDPIPKQDVSMWYL  614



>ref|XP_006432536.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432537.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432538.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432539.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006471293.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 gb|ESR45776.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45777.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45778.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45779.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
Length=617

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 145/228 (64%), Gaps = 20/228 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY +Y++GF +R+SRNNHQ+NC YR  S+Q  GM NFQ+NND    F
Sbjct  394  MDQKIYTCEFPQCPYGDYRLGFLERSSRNNHQLNCPYRHNSSQGFGMPNFQVNNDQTVAF  453

Query  791  sa--------pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            S              P   + S  N S   LP+DGQ+MI++LMSFYDTN QQN + NS N
Sbjct  454  SRPFAQPTQPKPATPPKNQTQSQFNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGN  513

Query  635  LNAVVEDHN-------LLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK  477
            LNA+ + +         LQ+DD F+  GA +G     Q +NMP+  S FSS E +F Q K
Sbjct  514  LNAIGDQNQQQEQRKFQLQMDDSFYSQGAVMGRNMPGQ-SNMPMNNSVFSSAEIRFDQCK  572

Query  476  FQYESPFNGNTCDP-GEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
              ++SP++ N  D   +FRF SPFN+A+ +DY +MD +PKQDVS WYL
Sbjct  573  -AFDSPYDANPSDSIADFRFNSPFNMAS-VDY-AMDSIPKQDVSLWYL  617



>gb|KDO53815.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53816.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53817.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53818.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53819.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
Length=614

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 140/229 (61%), Gaps = 26/229 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE++QCPY++Y  GF DRTSRNNHQ+NC YR   +Q   M NFQINND PAVF
Sbjct  395  IDQKIYTCEFTQCPYNDYHHGFLDRTSRNNHQLNCPYRNNGSQGCVMPNFQINNDQPAVF  454

Query  791  sapkpaapsvgssssvnasS--------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            S P   +      +SV   +         GLP+DGQ+MIS+LMSFYDTN Q N + +   
Sbjct  455  SLPFAQSTHPKPITSVKNQTQPQYNVSGLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGC  514

Query  635  LNAVVEDHN--------LLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQS  480
            LN V ED N         LQLDD F+  G  V  G      NMP+    FSSTE  F Q 
Sbjct  515  LN-VTEDRNQQPEQQKFQLQLDDSFYNQGVGVMKGG-----NMPVNNPVFSSTEVHFDQC  568

Query  479  KFQYESPFNGNTCD-PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            K  ++SPF+ N  D   EFRF SPFN+A+ +DY  MD +PKQDVS WYL
Sbjct  569  K-AFDSPFDNNPGDNIAEFRFNSPFNIAS-VDY-PMDPIPKQDVSMWYL  614



>ref|NP_001275851.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
 gb|ADI40102.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
Length=614

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 139/229 (61%), Gaps = 26/229 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY++Y  GF DRTSRNNHQ+NC YR  S+Q   M NFQINND PAVF
Sbjct  395  MDQKIYTCEFPQCPYNDYHHGFLDRTSRNNHQLNCPYRNNSSQGCVMPNFQINNDQPAVF  454

Query  791  sapkpaapsvgssssvnasS--------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            S P   +      + V   +         GLP+DGQ+MIS+LMSFYDTN Q N + +   
Sbjct  455  SLPFAQSTHPKPITPVKNQTQPQYNVSGLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGC  514

Query  635  LNAVVEDHN--------LLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQS  480
            LN V ED N         LQLDD F+  G  V  G      NMP+    FSSTE  F Q 
Sbjct  515  LN-VTEDRNQQPEQQKFQLQLDDSFYNQGVGVMKGG-----NMPVNNPVFSSTEVHFDQC  568

Query  479  KFQYESPFNGNTCD-PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            K  ++SPF+ N  D   EFRF SPFN+A+ ++Y  MD +PKQDVS WYL
Sbjct  569  K-AFDSPFDNNPGDNIAEFRFNSPFNVAS-VNY-PMDPIPKQDVSMWYL  614



>gb|AAP04001.1| EIL5 [Nicotiana tabacum]
Length=608

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 146/227 (64%), Gaps = 22/227 (10%)
 Frame = -3

Query  977  EHVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGM-QNFQINNDGP  801
            E VD K+YTCEY  CPYSNYQ GF DRTSRNNHQ++C +RF SAQRLGM   +QINN+  
Sbjct  391  ESVDQKLYTCEYLHCPYSNYQAGFLDRTSRNNHQMDCPFRFNSAQRLGMPPKYQINNENN  450

Query  800  AVFsapkpaap----svgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
             VF            SV +SSS+  S  GLPEDGQRMIS+L +FYD N QQN +  S N 
Sbjct  451  TVFPTQTATPKPATSSVTASSSMTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGN-  509

Query  632  NAVVEDHNL-------LQLDDDFFKPGAPVGG-GATFQDTNMPITQSGFSSTETQFGQSK  477
            + ++ + N+       L +DD+F      +G   A  Q+T+M +  S ++STE Q+ Q K
Sbjct  510  SKILANQNMQQNQTVELPMDDNFN-----LGHMEAEAQETSMTMN-SAYTSTEFQYDQCK  563

Query  476  FQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
              +++PF GN  D  ++RFGSPFN+    DY SMDQL KQD+STWYL
Sbjct  564  LPFDAPFTGNLNDITDYRFGSPFNMGGS-DY-SMDQLTKQDISTWYL  608



>ref|XP_009759370.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=608

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 146/227 (64%), Gaps = 22/227 (10%)
 Frame = -3

Query  977  EHVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGM-QNFQINNDGP  801
            E VD K+YTCEY  CPYS+YQ GF DRTSRNNHQ++C +RF SAQRLGM   +QINN+  
Sbjct  391  ESVDQKLYTCEYLHCPYSSYQAGFLDRTSRNNHQMDCPFRFNSAQRLGMPPKYQINNENN  450

Query  800  AVFsapkpaap----svgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
             VF            SV +SSS+  S  GLPEDGQRMIS+L +FYD N QQN +  S N 
Sbjct  451  TVFPTQTATPKPATSSVTASSSMTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGN-  509

Query  632  NAVVEDHNL-------LQLDDDFFKPGAPVGG-GATFQDTNMPITQSGFSSTETQFGQSK  477
            + ++ + N+       L +DD+F      +G   A  Q+T+M +  S ++STE Q+ Q K
Sbjct  510  SKILANQNMQQNQTVELPMDDNFN-----LGHMEAEAQETSMTMN-SAYTSTEFQYDQCK  563

Query  476  FQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
              +++PF GN  D  ++RFGSPFN+    DY SMDQL KQD+STWYL
Sbjct  564  LPFDAPFTGNLNDITDYRFGSPFNMGGS-DY-SMDQLTKQDISTWYL  608



>ref|XP_010106128.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07788.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=607

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 144/224 (64%), Gaps = 17/224 (8%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV-  795
            +D K+YTCEYSQCPY++Y++GF DRTSRNNHQ+NC YR  S Q  GM NFQINN+ PAV 
Sbjct  389  LDQKVYTCEYSQCPYNDYRLGFLDRTSRNNHQMNCPYRPNSCQPFGMSNFQINNEKPAVF  448

Query  794  ---FsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNG-NFNSVNLNA  627
               FS PKP    +  +S  N +   LPEDGQ+MIS+LMSFYD N QQ   + N   LNA
Sbjct  449  PVPFSQPKPGPQPMSQTSHFNVTGLDLPEDGQKMISDLMSFYDNNAQQRSKDLNPGTLNA  508

Query  626  VVEDHN------LLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYE  465
             +E+HN        Q+DD +F  G  V GG   +  N+    + F STE QF Q K  ++
Sbjct  509  -MENHNPAQQKYQFQIDDSYFGQGV-VMGGNIPEQANISSQNAVFPSTEVQFDQCK-AFD  565

Query  464  SPFNGNTCD-PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            SPF+ N  D   + RF SPFN+ AP+++  +D LPKQDVS WYL
Sbjct  566  SPFDNNPNDNIVDLRFSSPFNM-APVEF-PVDSLPKQDVSLWYL  607



>ref|XP_002310961.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 ref|XP_006379422.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEE88328.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 gb|ERP57219.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 138/215 (64%), Gaps = 9/215 (4%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD K+Y CEY QCPY++ + GF D T+RNNHQ+NC YR  ++Q  GM NFQIN+D PAVF
Sbjct  395  VDQKMYRCEYPQCPYNDSRFGFLDVTARNNHQMNCSYRTNTSQGFGMSNFQINSDKPAVF  454

Query  791  sa--pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
            S   P+  A +   + S N S  GLPEDG++ IS+LMSFYDTN Q++ N N  + N   +
Sbjct  455  SLPFPQTKAAAPNQTPSFNVSGLGLPEDGKKSISDLMSFYDTNLQRDKNMNPGSANQ--Q  512

Query  617  DHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTCD  438
                 QLDD F+  GA +G   T + T+MP+  S F STE QF   K  ++S F+ N  D
Sbjct  513  QKFQFQLDDSFYGQGAIMGNNIT-EVTSMPVNSSAFPSTEMQFDHCK-AFDSAFDANVND  570

Query  437  -PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
               +FRFGSPF +  P+DY SMD +PKQD   WY+
Sbjct  571  NVADFRFGSPFTM-PPVDY-SMDPMPKQDAGMWYV  603



>ref|XP_009595535.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=609

 Score =   172 bits (435),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 146/227 (64%), Gaps = 22/227 (10%)
 Frame = -3

Query  977  EHVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGM-QNFQINNDGP  801
            E VD K+YTCEY  CPYS+YQ GF DRTSRNNHQ+NC +RF SAQRLGM   +QINN+  
Sbjct  392  ESVDQKMYTCEYLHCPYSSYQAGFLDRTSRNNHQMNCPFRFNSAQRLGMPPKYQINNENN  451

Query  800  AVFsapkpaap----svgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
             VF A   +      SV +SSS+  S  GLPEDGQRMIS+L +FYD N QQN +  S N 
Sbjct  452  TVFPAQTASPKPAASSVTASSSMTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGN-  510

Query  632  NAVVEDHNL-------LQLDDDFFKPGAPVGG-GATFQDTNMPITQSGFSSTETQFGQSK  477
            + ++ + N+       L +DD+F      +G   A  Q+T+M +  S +  T+ Q+ Q K
Sbjct  511  SKILTNQNMQQNQTVELPMDDNFN-----LGHLEAEAQETSMTMN-SAYPLTDFQYDQRK  564

Query  476  FQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
              +++PF GN  D  ++RFGSPFN+    DY S+DQL KQD+STWYL
Sbjct  565  LPFDTPFAGNLNDITDYRFGSPFNMGGS-DY-SIDQLTKQDISTWYL  609



>ref|XP_010106127.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07787.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=617

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 140/225 (62%), Gaps = 16/225 (7%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV-  795
            +D KIY CE+ QCPY +Y++GF DRTSRNNHQ+NC YR  S+Q  GM  FQ+NND PAV 
Sbjct  396  LDQKIYNCEHPQCPYHDYRLGFLDRTSRNNHQMNCPYRCNSSQAFGMSGFQVNNDKPAVL  455

Query  794  ---FsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN------GNFNS  642
               FS PKP    V  ++ V  +  GLPEDGQ+MIS+L+SFYD N  Q       GNF +
Sbjct  456  SMPFSQPKPPPAPVTQTAQVGIAGLGLPEDGQKMISDLLSFYDINMPQRRKSLNPGNFTA  515

Query  641  VNLNAVVEDHNLLQLDDDFFKPGAPVGGGATFQ--DTNMPITQSGFSSTETQFGQSKFQY  468
               +   + +   Q+DD F+  G+ V GG T     TN+P   + F S++ QF Q K  +
Sbjct  516  TEHHDPQQQNYQFQMDDGFYSQGSGVMGGNTNAPLQTNIPSHHAVFPSSDVQFDQCK-AF  574

Query  467  ESPFNGNTCD-PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            +S  + N  D   + RFGSPFNL AP +Y ++D LPKQDVS WY+
Sbjct  575  DSSLDNNPTDNISDIRFGSPFNL-APAEY-TVDSLPKQDVSLWYI  617



>gb|ADZ97022.2| EIL6, partial [Nicotiana tabacum]
Length=607

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 144/225 (64%), Gaps = 22/225 (10%)
 Frame = -3

Query  977  EHVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGM-QNFQINNDGP  801
            E VD K+YTCEY  CPYS+YQ GF DRTSRNNHQ+NC +RF SAQRLGM   +QINN+  
Sbjct  392  ESVDQKMYTCEYLHCPYSSYQAGFLDRTSRNNHQMNCPFRFNSAQRLGMPPKYQINNENN  451

Query  800  AVFsapkpaap----svgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
             VF A   +      SV +SSS+  S  GLPEDGQRMIS+L +FYD N QQN +  S N 
Sbjct  452  TVFPAQTASPKPAASSVTASSSMTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGN-  510

Query  632  NAVVEDHNL-------LQLDDDFFKPGAPVGG-GATFQDTNMPITQSGFSSTETQFGQSK  477
            + ++ + N+       L +DD+F      +G   A  Q+T+M +  S +  T+ Q+ Q K
Sbjct  511  SKILTNQNMQQNQTVELPMDDNFN-----LGHLEAEAQETSMTMN-SAYPLTDFQYDQRK  564

Query  476  FQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTW  342
              +++PF GN  D  ++RFGSPFN+    DY S+DQL KQD+STW
Sbjct  565  LPFDTPFAGNLNDITDYRFGSPFNMGGS-DY-SIDQLTKQDISTW  607



>ref|XP_002315400.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEF01571.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 137/215 (64%), Gaps = 9/215 (4%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD K+Y CE+ QCPY++  +GF D T+RNNHQ+NC YR  ++Q LG+ NFQINND PAVF
Sbjct  395  VDQKVYRCEHPQCPYNDSGLGFLDITARNNHQMNCPYRTNTSQGLGLSNFQINNDKPAVF  454

Query  791  sapkpaapsvgssssvnasSFG--LPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
            S P P   +   + + + +  G  L EDGQ+ IS+LMSFYDTN Q++ N N  + N   +
Sbjct  455  SLPFPQTKAAAPNQTPSFNVSGLRLSEDGQKTISDLMSFYDTNLQRDKNINPGSANQ--Q  512

Query  617  DHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTCD  438
                 QLDD F+  GA VG   T + T+MP+    FSSTE QF   K  ++S F+ N  D
Sbjct  513  QKFQFQLDDSFYGQGAMVGNNIT-EATSMPVNNPVFSSTENQFDHCK-AFDSAFDTNVND  570

Query  437  -PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
               +FRFGSPF  + P+DY SMD + KQDV  WY+
Sbjct  571  NITDFRFGSPFP-SPPVDY-SMDLIQKQDVGMWYV  603



>ref|NP_001234546.1| EIL3 protein [Solanum lycopersicum]
 gb|AAK58859.1|AF328786_1 EIL3 [Solanum lycopersicum]
Length=601

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 105/221 (48%), Positives = 141/221 (64%), Gaps = 14/221 (6%)
 Frame = -3

Query  977  EHVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPA  798
            E VD KIYTCEY  CPYSNYQ GF DRTSRNNHQ++C +RF SAQ L    +QIN +   
Sbjct  388  ESVDQKIYTCEYLHCPYSNYQAGFLDRTSRNNHQMSCPFRFNSAQTLTTPKYQINYEHNT  447

Query  797  VFsapkpaap----svgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
            VF A    +     SV +SSS++AS  GLPED QR+IS+L++ YD NFQQNG+  S  ++
Sbjct  448  VFPAQTATSKPAVSSVTASSSMSASGLGLPEDDQRIISDLITSYDNNFQQNGSICS-GIS  506

Query  629  AVVEDHNLLQLDDDFFKPGAPVGGG---ATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
             ++ + +L Q           +  G    + Q+T+MP+    + STE Q+ Q K  +++P
Sbjct  507  EILVNQSLPQQQTVELPMDGNINLGHMETSAQETSMPV----YRSTEFQYDQCKMSFDAP  562

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            F GN  D  ++RFGSPFNL    DY +++QL KQD+STWYL
Sbjct  563  FGGNINDITDYRFGSPFNLGGS-DY-AVEQLTKQDISTWYL  601



>gb|KGN46075.1| hypothetical protein Csa_6G051520 [Cucumis sativus]
Length=431

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 139/231 (60%), Gaps = 31/231 (13%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG----  804
            ++ +IYTCEYSQCPY++ ++GF DR SRNNHQ+NC +R  S+    M +FQ N D     
Sbjct  213  MNPRIYTCEYSQCPYNSARLGFLDRNSRNNHQLNCPFRSDSSHIFSMPSFQTNEDKSSSP  272

Query  803  -PAVFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
             P  F+ PK  A  +  +     S  GLPEDGQ+MIS+L+SFYD+N QQ+   NS NL+ 
Sbjct  273  IPPSFNHPKAPARLMNPTPPFRVSGLGLPEDGQKMISDLLSFYDSNLQQDKPLNSGNLD-  331

Query  626  VVEDHN--------LLQLDDDFFKPGAPVGGGATFQDTNMPITQ-SGFSSTETQFGQSKF  474
            + +DHN         LQ+DD+ +   A VG         MPI Q + FSS +  F + K 
Sbjct  332  MPDDHNQQQQLPKFQLQVDDNLYSQAAMVG-------NTMPIQQHADFSSNKHPFDEYKA  384

Query  473  QYESPF----NGNTCDPGEFRFGSPFNLAAPIDYSSMD-QLPKQDVSTWYL  336
             +++PF    N N  D   FRFGSPFNLA+ IDY++ D QLPKQD   WYL
Sbjct  385  AFDTPFGMYPNDNISD---FRFGSPFNLAS-IDYAAADTQLPKQDTPLWYL  431



>ref|XP_004140927.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis sativus]
 ref|XP_011656591.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis sativus]
Length=615

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 137/228 (60%), Gaps = 31/228 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG-----PA  798
            +IYTCEYSQCPY++ ++GF DR SRNNHQ+NC +R  S+    M +FQ N D      P 
Sbjct  400  RIYTCEYSQCPYNSARLGFLDRNSRNNHQLNCPFRSDSSHIFSMPSFQTNEDKSSSPIPP  459

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
             F+ PK  A  +  +     S  GLPEDGQ+MIS+L+SFYD+N QQ+   NS NL+ + +
Sbjct  460  SFNHPKAPARLMNPTPPFRVSGLGLPEDGQKMISDLLSFYDSNLQQDKPLNSGNLD-MPD  518

Query  617  DHN--------LLQLDDDFFKPGAPVGGGATFQDTNMPITQ-SGFSSTETQFGQSKFQYE  465
            DHN         LQ+DD+ +   A VG         MPI Q + FSS +  F + K  ++
Sbjct  519  DHNQQQQLPKFQLQVDDNLYSQAAMVG-------NTMPIQQHADFSSNKHPFDEYKAAFD  571

Query  464  SPF----NGNTCDPGEFRFGSPFNLAAPIDYSSMD-QLPKQDVSTWYL  336
            +PF    N N  D   FRFGSPFNLA+ IDY++ D QLPKQD   WYL
Sbjct  572  TPFGMYPNDNISD---FRFGSPFNLAS-IDYAAADTQLPKQDTPLWYL  615



>ref|XP_008231880.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=622

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 132/231 (57%), Gaps = 28/231 (12%)
 Frame = -3

Query  959  IYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsa--  786
            IYTCEY QCPY +Y+  F D T+RNNHQ+NC YR  S Q  GM +FQ+NN+ PAVFS   
Sbjct  395  IYTCEYPQCPYHDYRRAFLDITARNNHQLNCAYRSNSLQVFGMSSFQLNNEKPAVFSLPL  454

Query  785  ---pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVED  615
                +     V  + S NAS FGL +DGQ+MISELMSFYD+N   N N N  NLN VVE 
Sbjct  455  GQPTQAVQQPVSQAGSFNASGFGLADDGQKMISELMSFYDSNIHPNKNSNPGNLN-VVEG  513

Query  614  HNLLQ------LDDDFFKPGA------------PVGGGATFQDTN-MPITQSGFSSTETQ  492
            HN  Q      ++D+FF  G             PV  G    +T  MP+ +  F S E Q
Sbjct  514  HNQQQAGFRFAMNDNFFGQGVDMGRNMSEPNSMPVDMGCNISETTPMPMHRQAFPSAEVQ  573

Query  491  FGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            F Q    ++SPF  N  D  + RF SP +L AP DY+ +D  PKQD S W+
Sbjct  574  FDQCTI-FDSPFGDNPNDTVDLRFDSPLHL-APADYNVLDP-PKQDASFWF  621



>ref|XP_008456656.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 ref|XP_008456657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
Length=615

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 136/228 (60%), Gaps = 31/228 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG-----PA  798
            K+YTCEYSQCPY++ ++GF DR SRNNHQ+NC +R  S+    M +FQ N D      P 
Sbjct  400  KMYTCEYSQCPYNSARLGFLDRNSRNNHQLNCPFRSDSSHIFSMPSFQSNEDKSASPIPP  459

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
             F+ PK  A  +  +     S  GLPEDGQ+MIS+L+SFYD+N QQ+ + NS NL+ + +
Sbjct  460  SFNHPKAPARLMNPTPPFRVSGLGLPEDGQKMISDLLSFYDSNLQQDKHLNSGNLD-MQD  518

Query  617  DHN--------LLQLDDDFFKPGAPVGGGATFQDTNMPITQ-SGFSSTETQFGQSKFQYE  465
            DHN         LQ+DD+ +         AT     MPI Q   FSS +  F + K  ++
Sbjct  519  DHNQQQQLPKFQLQVDDNLY-------CQATMVGNTMPIQQHPDFSSNKHPFDEYKAAFD  571

Query  464  SPF----NGNTCDPGEFRFGSPFNLAAPIDYSSMD-QLPKQDVSTWYL  336
            SPF    N N  D   FRFGSPFNLA+ IDY++ D QLPKQD   WYL
Sbjct  572  SPFGMYPNDNISD---FRFGSPFNLAS-IDYAAADTQLPKQDTPLWYL  615



>ref|NP_001284429.1| ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 dbj|BAB64345.1| EIN3-like protein [Cucumis melo]
Length=615

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 136/228 (60%), Gaps = 31/228 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG-----PA  798
            K+YTCEYSQCPY++ ++GF DR SRNNHQ+NC +R  S+    M +FQ N D      P 
Sbjct  400  KMYTCEYSQCPYNSARLGFLDRNSRNNHQLNCPFRSDSSHIFSMPSFQSNEDKSASPIPP  459

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
             F+ PK  A  +  +     S  GLPEDGQ+MIS+L+SFYD+N QQ+ + NS NL+ + +
Sbjct  460  SFNHPKAPARLMNLTPPFRVSGLGLPEDGQKMISDLLSFYDSNLQQDKHLNSGNLD-MQD  518

Query  617  DHN--------LLQLDDDFFKPGAPVGGGATFQDTNMPITQ-SGFSSTETQFGQSKFQYE  465
            DHN         LQ+DD+ +         AT     MPI Q   FSS +  F + K  ++
Sbjct  519  DHNQQQQLPKFQLQVDDNLY-------CQATMVGNTMPIQQHPDFSSNKHPFDEYKAAFD  571

Query  464  SPF----NGNTCDPGEFRFGSPFNLAAPIDYSSMD-QLPKQDVSTWYL  336
            SPF    N N  D   FRFGSPFNLA+ IDY++ D QLPKQD   WYL
Sbjct  572  SPFGMYPNDNISD---FRFGSPFNLAS-IDYAAADTQLPKQDTPLWYL  615



>ref|XP_006347695.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=604

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 141/225 (63%), Gaps = 22/225 (10%)
 Frame = -3

Query  977  EHVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPA  798
            E VD KIYTCEY  CPYSNYQ GF DRTSRNNHQ++C +RF SAQ L    +QIN +   
Sbjct  391  ESVDQKIYTCEYLHCPYSNYQAGFLDRTSRNNHQMSCPFRFNSAQTLSTPKYQINYEHNT  450

Query  797  VFsapkpaap----svgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNS----  642
            VF A    +     SV +SSS++AS  GLPED QR+IS+L++ YD NFQQNG+  S    
Sbjct  451  VFPAQTAPSKPAVSSVTASSSMSASGLGLPEDDQRIISDLITSYDNNFQQNGSICSGISE  510

Query  641  --VNLNAVVEDHNLLQLDDDFFKPGAPVGGGAT-FQDTNMPITQSGFSSTETQFGQSKFQ  471
              VN N   +    L +D +F      +G   T  Q+T+MP     + STE Q+ Q K  
Sbjct  511  ILVNQNLQQQQTVELPMDGNFN-----LGHMETSAQETSMP----AYRSTEFQYDQCKMS  561

Query  470  YESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            +++PF GN  D  ++RFGSPFNL    DY +M+QL KQD+STWYL
Sbjct  562  FDAPFGGNINDITDYRFGSPFNLGGS-DY-AMEQLTKQDISTWYL  604



>ref|XP_008357657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=625

 Score =   155 bits (391),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 134/237 (57%), Gaps = 32/237 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            K+YTCEY QCPY +Y++GF D T+RNNHQ+NC +R  S+Q LGM +FQ++N+ P  FS P
Sbjct  391  KVYTCEYLQCPYHDYRLGFLDITARNNHQLNCPHRSNSSQVLGMSSFQLHNETPVXFSLP  450

Query  782  kpaapsvgssssvnasSF----------------------GLPEDGQRMISELMSFYDTN  669
                P+  +     +S F                      G+ EDGQ+MISELMSFYD+N
Sbjct  451  IAQQPTPANQPVNQSSMFDDSGLGIQQPVNQSGRFDASGLGVAEDGQKMISELMSFYDSN  510

Query  668  FQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQDTN-MPITQSGF  510
             QQN N N  NLN V++D N  Q      ++D+ F  G  +G      + + M +   GF
Sbjct  511  IQQNKNCNPGNLN-VIDDRNQQQANYQFPMNDNLFGHGVDIGRNMNMSEPSPMLMLHPGF  569

Query  509  SSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            SS E QF Q    +ESPF  N+ +  + RF SPF+LA  + Y++MD    QD S W+
Sbjct  570  SSPEVQFDQL-MAFESPFGNNSSEDVDIRFDSPFHLAH-VGYNAMDPPVNQDASPWF  624



>gb|AGI41325.1| EIN3-like protein [Malus domestica]
Length=625

 Score =   154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 134/237 (57%), Gaps = 32/237 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            K+YTCEY QCPY +Y++GF D T+RNNHQ+NC +R  S+Q LGM +FQ++N+ P  FS P
Sbjct  391  KVYTCEYLQCPYHDYRLGFLDITARNNHQLNCPHRSNSSQVLGMSSFQLHNETPVSFSLP  450

Query  782  kpaapsvgssssvnasSF----------------------GLPEDGQRMISELMSFYDTN  669
                P+  +     +S F                      G+ EDGQ+MISELMSFYD+N
Sbjct  451  IAQQPTPANQPVNQSSMFDDSGLGIQQPVNQSRRFDASGLGVAEDGQKMISELMSFYDSN  510

Query  668  FQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQDTN-MPITQSGF  510
             QQN N N  NLN V++D N  Q      ++D+ F  G  +G      + + M +   GF
Sbjct  511  IQQNKNCNPGNLN-VIDDRNQQQANYQFPMNDNLFGHGVDIGRNMNMSEPSPMLMLHPGF  569

Query  509  SSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            SS E QF Q    +ESPF  N+ +  + RF SPF+LA  + Y++MD    QD S W+
Sbjct  570  SSPEVQFDQL-MAFESPFGNNSSEDVDIRFDSPFHLAH-VGYNAMDPPVNQDASPWF  624



>gb|AIS20827.1| EIL [Pyrus x bretschneideri]
Length=600

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 131/219 (60%), Gaps = 15/219 (7%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCEY QCPY +Y++GF + T+RNNHQ+NCQYR  S+Q  GM +FQ++N+    FS P
Sbjct  385  KIYTCEYPQCPYHDYRLGFLNITARNNHQMNCQYRSNSSQVFGMSSFQLHNEKSVGFSLP  444

Query  782  kpaaps----vgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVED  615
                P+       + +   ++ G+ +DGQ+MISELMSFYD+N QQN N N  NL+ +VE+
Sbjct  445  IAQPPAPTFQQSVNQASRFNASGV-DDGQKMISELMSFYDSNVQQNQNCNPGNLH-IVEN  502

Query  614  HNLLQ------LDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKFQYESPF  456
             N  Q      ++D+FF  G   G      +   MP+   GF+S E QF Q    ++SPF
Sbjct  503  RNQQQSKYQFPMNDNFFGQGVDTGCNINMSEPAPMPMLHPGFASPEVQFDQC-IAFDSPF  561

Query  455  NGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
              N  +    RF SP +L AP DY+ MD  PKQD   W+
Sbjct  562  GNNPIENVNMRFDSPLHL-APADYNVMDTPPKQDAPPWF  599



>gb|ADE41155.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=625

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/237 (41%), Positives = 134/237 (57%), Gaps = 32/237 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            K+YTCEY QCPY +Y++GF D T+RNNHQ+NC +R  S+Q LGM +FQ++N+ P  FS P
Sbjct  391  KVYTCEYLQCPYHDYRLGFLDITARNNHQLNCPHRSNSSQVLGMSSFQLHNETPVSFSLP  450

Query  782  kpaapsvgssssvnasSF----------------------GLPEDGQRMISELMSFYDTN  669
                P+  +     +S F                      G+ EDGQ+MIS+LMSFYD+N
Sbjct  451  IAQQPTPANQPVNQSSMFDDSGLGIQQPVNQSRRFDASGLGVAEDGQKMISDLMSFYDSN  510

Query  668  FQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQDTN-MPITQSGF  510
             QQN N N  NLN V++D N  Q      ++D+ F  G  +G      + + M +   GF
Sbjct  511  IQQNKNCNPGNLN-VIDDRNQQQANYQFPMNDNLFGHGVDIGRNMNMSEPSPMLMLHPGF  569

Query  509  SSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            SS E QF Q    +ESPF  N+ +  + RF SPF+LA  + Y++MD    QD S W+
Sbjct  570  SSPEVQFDQL-MAFESPFGNNSSEDVDIRFDSPFHLAH-VGYNAMDPPVNQDASPWF  624



>ref|XP_009355060.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009355061.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=606

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 131/219 (60%), Gaps = 15/219 (7%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCEY QCPY +Y++GF + T+RNNHQ+NCQYR  S+Q  GM +FQ++N+    FS P
Sbjct  391  KIYTCEYPQCPYHDYRLGFLNITARNNHQMNCQYRSNSSQVFGMSSFQLHNEKSVGFSLP  450

Query  782  kpaaps----vgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVED  615
                P+       + +   ++ G+ +DGQ+MISELMSFYD+N QQN N N  NL+ +VE+
Sbjct  451  IAQPPAPTFQQSVNQASRFNASGV-DDGQKMISELMSFYDSNVQQNQNCNPGNLH-IVEN  508

Query  614  HNLLQ------LDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKFQYESPF  456
             N  Q      ++D+FF  G   G      +   MP+   GF+S E QF Q    ++SPF
Sbjct  509  RNQQQSKYQFPMNDNFFGQGVDTGCNINMSEPAPMPMLHPGFASPEVQFDQC-IAFDSPF  567

Query  455  NGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
              N  +    RF SP +L AP DY+ MD  PKQD   W+
Sbjct  568  GNNPIENVNMRFDSPLHL-APADYNVMDTPPKQDAPPWF  605



>ref|XP_007220648.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
 gb|EMJ21847.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
Length=570

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 125/215 (58%), Gaps = 18/215 (8%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCEY QCPY + ++GF D T+RNNHQ+NC YR  S+Q  GM  F +NND P  FS P
Sbjct  360  KIYTCEYPQCPYHDCRLGFLDITARNNHQLNCAYRGNSSQVFGMSGFHLNNDKPVGFSLP  419

Query  782  kpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
                           SSF     GL EDGQ+MIS+LMSFYD+N QQN N N  NLN VVE
Sbjct  420  ITQPKPAIQQPVNQTSSFNASGLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLN-VVE  478

Query  617  DHNLLQ------LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            DHN  Q      ++D+F+  G  +G   + + T++P+  S F STE QF   K  ++SP+
Sbjct  479  DHNQQQVKFQFPMEDNFYGQGLVIGRNMS-EPTSLPMLHSVFPSTEIQFDPCKL-FDSPY  536

Query  455  NGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDV  351
              +  DP    FG+  N    +DY+  D + KQD 
Sbjct  537  GNHPNDPVNLGFGTHLN---SVDYND-DSMLKQDA  567



>gb|ABK35086.1| EIL2 [Prunus persica]
Length=601

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 125/215 (58%), Gaps = 18/215 (8%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCEY QCPY + ++GF D T+RNNHQ+NC YR  S+Q  GM  F +NND P  FS P
Sbjct  391  KIYTCEYPQCPYHDCRLGFLDITARNNHQLNCAYRGNSSQVFGMSGFHLNNDKPVGFSLP  450

Query  782  kpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
                           SSF     GL EDGQ+MIS+LMSFYD+N QQN N N  NLN VVE
Sbjct  451  ITQPKPAIQQPVNQTSSFNASGLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLN-VVE  509

Query  617  DHNLLQ------LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            DHN  Q      ++D+F+  G  +G   + + T++P+  S F STE QF   K  ++SP+
Sbjct  510  DHNQQQVKFQFPMEDNFYGQGLVIGRNMS-EPTSLPMLHSVFPSTEIQFDPCKL-FDSPY  567

Query  455  NGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDV  351
              +  DP    FG+  N    +DY+  D + KQD 
Sbjct  568  GNHPNDPVNLGFGTHLN---SVDYND-DSMLKQDA  598



>emb|CDP16004.1| unnamed protein product [Coffea canephora]
Length=608

 Score =   150 bits (378),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 129/224 (58%), Gaps = 17/224 (8%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTC+  QCPYS Y MGF DRT RNNHQINC YR +++Q LG+ N+Q     P V 
Sbjct  388  LDQKIYTCQNPQCPYSGYNMGFHDRTLRNNHQINCPYRLSASQNLGIMNYQPYKKKPDVI  447

Query  791  sapkpaapsvgssssv-----nasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
            SAP                  + S  G+PEDGQ+MIS LMS YD + Q+   F+   ++ 
Sbjct  448  SAPSVQLKPASQPVIEHPSCLSISKLGIPEDGQKMISGLMSMYDDSVQEKTCFD-FGIDT  506

Query  626  VVEDHNLLQL------DDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQF--GQSKFQ  471
              ED NL Q       D  FF+PG  +GG  + ++T++ ++ S F STE  +  G  K  
Sbjct  507  AAEDQNLQQQIIQLHGDQSFFRPGVTMGGSIS-KETSLTLSHSAFPSTEFLYDNGNCKST  565

Query  470  YESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
             +S FNGN     +F FG  FN+ + +DY SMD  PK+D++TWY
Sbjct  566  DDSGFNGNLNSNLDFSFGPEFNMES-VDY-SMDLFPKEDITTWY  607



>ref|XP_008346133.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
 ref|XP_008346139.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=606

 Score =   149 bits (376),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 130/218 (60%), Gaps = 13/218 (6%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINND---GPAVF  792
            KIYTCEY QCPY +Y++GF + T+RNNHQ+NCQYR  S+Q  GM +FQ++N+   G ++ 
Sbjct  391  KIYTCEYPQCPYHDYRLGFLNITARNNHQMNCQYRSNSSQVFGMSSFQLHNEKSVGXSLP  450

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
             A  PA     S +  +  +    +DGQ+MISELMSFYD+N QQN N N  NL+ +V++ 
Sbjct  451  IAQPPAPTIQQSVNQASRFNASGVDDGQKMISELMSFYDSNVQQNKNCNPGNLH-IVDNR  509

Query  611  N------LLQLDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKFQYESPFN  453
            N       L ++D+FF  G   G      +   MP+   GF+S E QF Q    ++SPF 
Sbjct  510  NQQQSKYQLPMNDNFFGQGVDTGCNINXSEPAPMPMLHPGFASQEVQFDQC-IAFDSPFG  568

Query  452  GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
             N  +  + RF SP +L AP DY+ MD   KQD   W+
Sbjct  569  NNPIENVDMRFDSPLHL-APADYNVMDAPLKQDAPPWF  605



>gb|KHG00335.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=397

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 127/228 (56%), Gaps = 21/228 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            V+ KIYTCE+ QCPYS +++GF DRT+R+NHQ+ C YR +SAQ  G  NF +N   P +F
Sbjct  173  VEQKIYTCEFLQCPYSEFRLGFHDRTARDNHQLTCPYRNSSAQ-FGGSNFSVNEVKPVIF  231

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                  +       +  ++ F     G+PEDGQ+ I ELMS YD N Q N N N  N N 
Sbjct  232  PRQFGQSKPAAPQVTSVSTPFDLSGLGVPEDGQKTIGELMSVYDNNIQGNKNMNPSN-NL  290

Query  626  VVEDHNLLQ-----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
            V +  N+LQ       D+FF+    +  G  F+D++M   Q  FS  E QF + K    S
Sbjct  291  VTKGQNVLQPKIQHQQDEFFRGQGVMMEGNFFEDSSMLHNQQMFSQGEAQFERFK-GLNS  349

Query  461  PFNGNTCDPG-EFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
            P + N  + G +  FGSPF+LA+  DY        MD +PKQDVS W+
Sbjct  350  PLDSNHNNNGFQLMFGSPFDLAS-FDYKEDLHAVGMDSMPKQDVSIWF  396



>ref|XP_010067064.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067065.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067066.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 gb|KCW65129.1| hypothetical protein EUGRSUZ_G02632 [Eucalyptus grandis]
Length=617

 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 124/226 (55%), Gaps = 21/226 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFA--SAQRLGMQNFQINNDGPA  798
            +D KIYTCE+SQCP+S++  GF DRT RNNHQ++C YR     +Q +G+ NFQ+NN   A
Sbjct  397  MDQKIYTCEFSQCPHSDHSFGFLDRTLRNNHQLSCPYRSKPIPSQAIGISNFQVNNGQQA  456

Query  797  VFsapkpaapsvgssssvn----asSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
             F              +          GLPEDGQ+ IS LMSFYD N QQN   ++  L 
Sbjct  457  AFLHSFAQPNPSPPPGTHTPSFNIRGIGLPEDGQKTISNLMSFYDVNLQQNST-SAGKLG  515

Query  629  AVVEDHNLL----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
            A   +  LL     + D  F  GA   GG T ++ N+P+  S F S  +Q  QSK  ++S
Sbjct  516  APSNEQQLLNVQHSMGDSLFAHGA-FMGGKTHEEINLPLNHSVFQSMGSQHDQSK-AFDS  573

Query  461  PF----NGNTCDPGEFRFGSPFNL-AAPIDYSSMDQLPKQDVSTWY  339
            PF    N  T D    RFGSPF++ AA  D + MD LPKQD   WY
Sbjct  574  PFEFCLNDGTVD---SRFGSPFSVTAAAADCNRMDLLPKQDGFVWY  616



>ref|XP_008231879.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=601

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 123/215 (57%), Gaps = 18/215 (8%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCEY QCPY + ++GF D T+RNNHQ+NC YR  S+Q  GM  F +NND P  FS P
Sbjct  391  KIYTCEYPQCPYHDCRLGFLDITARNNHQLNCAYRGNSSQVFGMSGFHLNNDKPVGFSLP  450

Query  782  kpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
                           SSF     GL EDGQ+MIS+LMSFYD+N QQN N N  NLN VVE
Sbjct  451  ITQPKPAIQQPVNQTSSFNASGLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLN-VVE  509

Query  617  DHNLLQ------LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            DHN  Q      ++D+F+  G  +G   + + T++P+    F  TE QF   K  ++SP+
Sbjct  510  DHNQQQVKFQFPMEDNFYGQGLVIGRNMS-EPTSLPMLHPVFPPTEIQFDPCKL-FDSPY  567

Query  455  NGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDV  351
              +  DP    FG+  N    +DY+  D + KQD 
Sbjct  568  GNHPNDPVNLGFGTHLN---SVDYND-DSMLKQDA  598



>gb|ADE41154.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=611

 Score =   146 bits (368),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 133/225 (59%), Gaps = 22/225 (10%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRL----GMQNFQINNDGPAV  795
            KI+TCEY QCPY +Y++GF D T+RNNHQ+NC +   S Q      GM +FQ++N+ P  
Sbjct  391  KIFTCEYMQCPYHDYRLGFLDITARNNHQLNCSFGSNSTQVFGMSSGMSSFQLHNEKPVG  450

Query  794  FsapkpaapsvgssssvnasS------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
            FS P    P+  S   VN +S       GL ++GQ+  SELMSFYD+N QQN N N  NL
Sbjct  451  FSIPIAQPPAPASQPPVNQASRFNASGLGLVDNGQK--SELMSFYDSNIQQNKNCNPANL  508

Query  632  NAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKF  474
            + +V++ N  Q      ++D+FF  G  VG      +   MP+   GF+S E QF Q   
Sbjct  509  H-IVDNRNQQQSKYQFPMNDNFFGQGMDVGRNINMSELAPMPMLHPGFASPEVQFDQC-L  566

Query  473  QYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
             ++SPF  NT +  + RF SP +L AP DY+ MDQ PKQD S W+
Sbjct  567  AFDSPFGNNTNENVDIRFESPLHL-APADYNVMDQPPKQDASLWF  610



>gb|ACM89299.1| EIN3-like protein EIL1 [Eriobotrya japonica]
Length=558

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 130/219 (59%), Gaps = 15/219 (7%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCEY QCPY  Y++GF + T+RNNHQ+NCQY   S+Q  GM +FQ++N+    FS P
Sbjct  343  KIYTCEYPQCPYHGYRLGFLNITARNNHQLNCQYCSNSSQVFGMSSFQLHNEKSVGFSLP  402

Query  782  kpaapsvgssssvnasSF----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVED  615
                P+      VN +S     G+ +DGQ+MISELMSFYD+N QQN N+N  NL+ +V++
Sbjct  403  IAQPPASTIQQPVNQASRFNASGV-DDGQKMISELMSFYDSNVQQNKNYNPGNLH-IVDN  460

Query  614  HNLLQ------LDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKFQYESPF  456
             N  Q      ++D+FF  G   G      +   MP+   GF+S E QF Q    ++SPF
Sbjct  461  RNQQQSKYQFPMNDNFFGQGVDTGCNINMSEPAPMPMLHPGFASPEVQFDQC-IAFDSPF  519

Query  455  NGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
              N  +  + RF SP +L AP DY+ +D   KQD   W+
Sbjct  520  GNNPIENVDMRFDSPLHL-APADYNVVDAPLKQDAPPWF  557



>ref|XP_009339245.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339246.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339249.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339251.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=611

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 132/225 (59%), Gaps = 22/225 (10%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQN----FQINNDGPAV  795
            KI+TCEY QCPY +Y +GF D T+RNNHQ+NC +R  S Q  GM +    FQ++N+ P  
Sbjct  391  KIFTCEYLQCPYHDYHLGFLDITARNNHQLNCPFRSNSTQVFGMSSGMSGFQLHNEKPVG  450

Query  794  FsapkpaapsvgssssvnasS------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
            FS P    P+  S   VN +S       GL ++GQ+  SELMSFYD+N QQN N N  NL
Sbjct  451  FSLPIAQPPAPASQPPVNQASRFNASGLGLVDNGQK--SELMSFYDSNIQQNKNCNPANL  508

Query  632  NAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKF  474
            + +V++ N  Q      ++D+FF  G  VG      +   MP+   GF+S E QF Q   
Sbjct  509  H-IVDNRNSQQSKYQFPMNDNFFGQGVDVGRNINMSELAPMPMLHPGFASPEVQFDQC-M  566

Query  473  QYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
             ++ PF  NT +  + RF SP +L AP+DY+ MDQ  KQD S W+
Sbjct  567  AFDPPFGNNTNENVDIRFESPLHL-APVDYNVMDQPLKQDASIWF  610



>gb|AGI41324.1| EIN3-like protein [Malus domestica]
Length=611

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 132/225 (59%), Gaps = 22/225 (10%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRL----GMQNFQINNDGPAV  795
            KI+TCEY QCPY +Y++GF D T+RNNHQ+NC +   S Q      GM +FQ++N+ P  
Sbjct  391  KIFTCEYMQCPYHDYRLGFLDITARNNHQLNCSFGSNSTQVFGMSSGMSSFQLHNEKPVG  450

Query  794  FsapkpaapsvgssssvnasS------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
            FS P    P+  S   VN +S       GL ++GQ+  SELMSFYD+N  QN N N  NL
Sbjct  451  FSQPIAQPPAPASQPPVNQASRFNASGLGLVDNGQK--SELMSFYDSNIHQNKNCNPANL  508

Query  632  NAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKF  474
            + +V++ N  Q      ++D+FF  G  VG      +   MP+   GF+S E QF Q   
Sbjct  509  H-IVDNRNQQQSKYQFPMNDNFFGQGMDVGRNINMSELAPMPMLHPGFASPEVQFDQC-L  566

Query  473  QYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
             ++SPF  NT +  + RF SP +L AP DY+ MDQ PKQD S W+
Sbjct  567  AFDSPFGNNTNENVDIRFESPLHL-APADYNVMDQPPKQDASLWF  610



>ref|XP_008364747.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=611

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 132/225 (59%), Gaps = 22/225 (10%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRL----GMQNFQINNDGPAV  795
            KI+TCEY QCPY +Y++GF D T+RNNHQ+NC +   S Q      GM +FQ++N+ P  
Sbjct  391  KIFTCEYMQCPYHDYRLGFLDITARNNHQLNCSFGSNSTQVFGMSSGMSSFQLHNEKPVG  450

Query  794  FsapkpaapsvgssssvnasS------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
            FS P    P+  S   VN +S       GL ++GQ+  SELMSFYD+N  QN N N  NL
Sbjct  451  FSXPIAQPPAPASQPPVNQASRFNASGLGLVDNGQK--SELMSFYDSNIXQNKNCNPANL  508

Query  632  NAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQD-TNMPITQSGFSSTETQFGQSKF  474
            + +V++ N  Q      ++D+FF  G  VG      +   MP+   GF+S E QF Q   
Sbjct  509  H-IVDNRNQQQSKYQFPMNDNFFGQGMDVGRNINMSELAPMPMLHPGFASPEVQFDQC-L  566

Query  473  QYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
             ++SPF  NT +  + RF SP +L AP DY+ MDQ PKQD S W+
Sbjct  567  AFDSPFGNNTNENVDIRFESPLHL-APADYNVMDQPPKQDASLWF  610



>dbj|BAI44821.1| ethylene insensitive 3-like [Daucus carota]
Length=619

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 138/223 (62%), Gaps = 18/223 (8%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K+YTC Y QCPY++Y++GF DR SR+ H+I+C +R  S+Q + +  FQIN D PA F
Sbjct  391  IDQKVYTCVYPQCPYNDYRLGFHDRNSRHTHEISCPHRVDSSQGISVPTFQINKDDPAAF  450

Query  791  sapkpaapsvgssssvn----asSFGLPEDGQRMISELMSFYD----TNFQQNGNFNSVN  636
            S P     S     +      AS  GLP+DG++MISELMSFYD     N  QN N NS N
Sbjct  451  SIPFAPPNSTVQPVNKQPPFNASVVGLPDDGEKMISELMSFYDNNIHQNQNQNLNMNSGN  510

Query  635  LNAVVEDHNL----LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY  468
            LN ++ DHN+     QLDD+FF  G  V G    Q T++P+ Q  + ST+ QFGQ K  Y
Sbjct  511  LN-ILGDHNMQQQKFQLDDNFFGQGI-VMGDNISQGTSIPLNQPVYPSTDFQFGQCK-AY  567

Query  467  ESPFNGNT-CDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTW  342
            +S F+ N+  +P +F++GSPFNL    DY++ D L  Q+ S W
Sbjct  568  DSVFDANSNGNPLDFQYGSPFNLGT-ADYTA-DPLSNQNGSMW  608



>ref|XP_007016682.1| Ethylene insensitive 3 family protein [Theobroma cacao]
 gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma cacao]
Length=615

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 124/228 (54%), Gaps = 26/228 (11%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCE+  CPYS  ++GF DRT R+NHQ+ C +R +SAQ  G  NF IN   P +F   
Sbjct  393  KIYTCEFIHCPYSELRLGFHDRTLRDNHQLTCPFRNSSAQ-FGGSNFNINEVKPVIFPQT  451

Query  782  kpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
               +       +   +SF     G+PEDGQ+MISELMS YD N Q   N N  N N V E
Sbjct  452  FAQSKPAAPPITSVPTSFDLSALGVPEDGQKMISELMSIYDNNIQGTKNMNPGN-NPVTE  510

Query  617  DHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKF----QYE  465
              NLLQ       D++F+    +  G  F++++MP     FS  E QF + K     Q+E
Sbjct  511  GQNLLQPKIQQQQDEYFRGQGVIMEGNFFEESSMPNNNQMFSQGEGQFDRFKALNTPQFE  570

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
            +  N N+    +  FGSPF+LA+  DY        MD LPKQDVS W+
Sbjct  571  TNHNNNSF---QLMFGSPFDLAS-FDYKEDLQAVGMDTLPKQDVSMWF  614



>ref|XP_011091876.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Sesamum indicum]
Length=580

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 137/227 (60%), Gaps = 18/227 (8%)
 Frame = -3

Query  977  EHVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPA  798
            E +D KIYTCE+ QCPY++++MGF DRT RNNHQI+C +RF+S+   G  ++QINN  P 
Sbjct  359  EPIDRKIYTCEFPQCPYNDFRMGFNDRTCRNNHQISCPFRFSSSGNFGPPSYQINNKKPP  418

Query  797  VFsapkpaapsvgs------sssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            +FS P     S          +SV+ S  G+PEDGQ++ISELMS Y+ N Q    F+S N
Sbjct  419  IFSVPSAETNSAALPMNNDPLTSVSVSGLGIPEDGQKVISELMSSYNGNNQHGNTFHSEN  478

Query  635  LNAVVEDHN------LLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKF  474
             + ++E  N       LQ +DD  K GA   G   FQ T++P++ S FSS+  Q+ Q K 
Sbjct  479  FH-ILEGQNQQQPAAYLQQNDDDSKQGASSQG--IFQGTSVPLSSSVFSSSAFQYDQCKS  535

Query  473  QYESPFNGNTCD-PGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
               S F  N  D   +FRFGSP N +  +DY  +D LPK +VS WYL
Sbjct  536  SCNSSFTSNVSDNISDFRFGSPLN-STQLDY-FVDPLPKHEVSLWYL  580



>ref|XP_009355361.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=627

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 129/238 (54%), Gaps = 33/238 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            K+YTCEY QCPY +Y++GF D T+RNNHQ+NC +R  S+Q LGM +FQ+ N+ P  FS P
Sbjct  392  KVYTCEYLQCPYHDYRLGFLDITARNNHQLNCPHRSISSQVLGMSSFQLRNEKPVSFSLP  451

Query  782  kpaapsvgssssvnasS-----------------------FGLPEDGQRMISELMSFYDT  672
                P+      VN SS                        G+ EDG++MISELMSFYD+
Sbjct  452  IAQQPTPAIQQPVNQSSMFNDSGVGIQQPVNQSGRFDASGLGIAEDGKKMISELMSFYDS  511

Query  671  NFQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGAPVGGGATFQDTN-MPITQSG  513
            N QQN N  +     V++D N  Q      ++D FF  G  +G      + + M +   G
Sbjct  512  NIQQN-NNCNPGNLNVIDDRNQQQANYQFPVNDTFFGQGVDIGRNMNISEPSPMLMLHPG  570

Query  512  FSSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            FSS E QF Q    +ESP   N  +  + RF SPF+L AP+ Y++MD    QD S W+
Sbjct  571  FSSPEVQFDQL-MAFESPVGNNYSEDVDIRFDSPFHL-APVGYNAMDPPVNQDASPWF  626



>ref|XP_010247605.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=618

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 127/228 (56%), Gaps = 19/228 (8%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD KIY  EY +CPYS+Y++G  DR+SRNN Q+N  Y        G+ NF+I  D PAVF
Sbjct  394  VDHKIYNREYLRCPYSDYRLGKPDRSSRNNQQVNSPYGSVRTG-FGISNFEITEDKPAVF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
            S P           +   S+F     GLPEDGQ+ ISELMSFYD+N Q+N   N  N+ A
Sbjct  453  SMPFGQPKRAAPPLNPTQSTFSLSGLGLPEDGQKTISELMSFYDSNLQRNKCSNPGNVAA  512

Query  626  V----VEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
            +     E    +QL+++F+  G+ VGG   F++ NMP+    F   E QF Q K      
Sbjct  513  MDGQNSEPQPKVQLEENFYGQGSAVGGN-MFEENNMPMNHQMFPREEIQFDQYKVFDPPA  571

Query  458  FNGNTCD-PGEFRFGSPFNLAAPIDY------SSMDQLPKQDVSTWYL  336
            +  N  D P +FRFGSPFN+ + +D+       +++ + K + S WYL
Sbjct  572  YETNHDDIPSDFRFGSPFNMPS-VDFGEVLPRGTVETMSKTESSIWYL  618



>gb|KHG09663.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=634

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 131/232 (56%), Gaps = 29/232 (13%)
 Frame = -3

Query  974  HVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV  795
            +++ KIYTCE+ QCPYS  Q+GF DRT+R+NHQ+ C +R +SAQ  G  NF IN+  P +
Sbjct  412  NIEHKIYTCEFLQCPYSELQLGFHDRTARDNHQLTCPHRNSSAQ-FGGSNFNINDVKPVI  470

Query  794  FsapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
            F  P         S++  ++ F     G+PEDGQ+MIS LMS YD N Q N N + +  N
Sbjct  471  FPPPFAQLKPAAPSTTSVSTPFDLSGLGVPEDGQKMISNLMSIYDNNVQANKNASPIK-N  529

Query  629  AVVEDHNLLQLD-----DDFFKPGAPVGGGAT-FQDTNMPITQSGFSSTETQFGQSKFQ-  471
             V E  NLLQ       D+FF+     G G + F ++N+P         E QF Q K   
Sbjct  530  PVTEGQNLLQPKTQQQQDEFFR-----GQGLSFFNESNIPANNQILPQGEAQFDQLKTSN  584

Query  470  --YESPFNGNTCDPGEFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
              +E+ +N N  +  +  FGSPF+L++  DY+       MD +PKQDVS W+
Sbjct  585  SPFETTYNNNN-NGFKLMFGSPFDLSS-FDYNDDLQADGMDAMPKQDVSIWF  634



>gb|KJB26156.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
 gb|KJB26157.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
Length=614

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 125/229 (55%), Gaps = 22/229 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            V+ KIYTCE+ QCPYS +++GF DRT+R+NHQ+ C YR +SAQ  G  NF +N   P +F
Sbjct  389  VEQKIYTCEFLQCPYSEFRLGFHDRTARDNHQLTCPYRNSSAQ-FGGSNFNVNELKPVIF  447

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                  +       +  ++ F     G+PEDGQ+ I ELMS YD N Q N N N  N N 
Sbjct  448  PRQFGQSKPAAPQVTSVSTPFDLSGLGVPEDGQKTIGELMSVYDNNIQGNKNMNPSN-NL  506

Query  626  VVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
            V +  N+LQ       D+FF+    +  G  F+D++M      FS  E QF + K    S
Sbjct  507  VTKGQNVLQPKIQHQQDEFFRGQGVMMEGNFFEDSSMLHNHQMFSQGEAQFERFK-GLNS  565

Query  461  PFNGNTCDPGEFR--FGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
            P + N  +   F+  FGS F+LA+  DY        MD +PKQDVS W+
Sbjct  566  PLDSNHNNNNSFQLMFGSSFDLAS-FDYKEDLHAVGMDSMPKQDVSIWF  613



>ref|XP_010243659.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=615

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 124/228 (54%), Gaps = 20/228 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD KIYTCE  QCPY++Y++GF DRTSRNNHQ NC YR  S    G+ NFQI  D P VF
Sbjct  392  VDRKIYTCENLQCPYNDYRLGFLDRTSRNNHQANCPYRNVSTG-FGISNFQITEDKPTVF  450

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
            S P           +    SF     GL EDGQ+ I ELMSFYD+N Q+N   N   +  
Sbjct  451  SLPFAQPKPAAPPLNQTQPSFNLSGLGLTEDGQKTIGELMSFYDSNLQRNKGPNPGGVVL  510

Query  626  VVEDHNL---LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
              ++  L   +QL+++ +  GA +GG   F++ NMP+    F   E QF Q K     P+
Sbjct  511  GGQNSALQPKIQLEENIYGEGASIGGN-MFEENNMPMNHQMFHREEIQFDQCKVFDAPPY  569

Query  455  NGNTCD-PGEFRFGSPFNLAAPIDY-------SSMDQLPKQDVSTWYL  336
              N  D   +FRFGS FN+ + +D+       +    L KQ+ S WYL
Sbjct  570  ETNNGDLTSDFRFGS-FNIPS-VDFGEDLPRGTVETPLSKQENSIWYL  615



>ref|XP_011006497.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
 ref|XP_011006504.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
Length=617

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 125/227 (55%), Gaps = 20/227 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD KIYTCE  QC +S  ++GF DR +R+ HQ+NC YR  S +  G  NF +N   P ++
Sbjct  395  VDQKIYTCEAVQCAHSQIRLGFPDRAARDTHQLNCPYRSTSLEFRG-SNFHVNEIKPVIY  453

Query  791  sapkpaapsvgssssvnasSF---GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
              P   + +     +   SSF   G+PEDGQ+MISELMS YDTN Q N N N  N N V 
Sbjct  454  PQPSAQSKTTAPLGNPAPSSFNLSGVPEDGQKMISELMSIYDTNIQGNKNTNRGN-NLVT  512

Query  620  EDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            EDHN+ Q       D+ F+  + +  G  F+++N+      FS    QF + K    SPF
Sbjct  513  EDHNVFQPKIQHQQDNHFRGQSNMINGNIFEESNINQNHQMFSQEVGQFDRFK-PLNSPF  571

Query  455  NGNTCDPG-EFRFGSPFNLAAPIDYSS------MDQLPK-QDVSTWY  339
              N  + G    FGSPF+L++  DY        MD LPK QDVSTW+
Sbjct  572  ETNQNNSGFSLMFGSPFDLSS-FDYKDDLQVLGMDTLPKHQDVSTWF  617



>ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
 gb|EEF32182.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
Length=617

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 125/231 (54%), Gaps = 26/231 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD K+YTCE+ QCPYS  ++GF DRTSR+NHQ+ C YR +S+   G  NF +N   P +F
Sbjct  392  VDQKVYTCEFVQCPYSQLRLGFHDRTSRDNHQLTCPYR-SSSLEFGGSNFHVNEVKPVIF  450

Query  791  sapkpaapsvgssssvnasSF---GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
              P        S  +    +F   G+PEDGQ+MISELMS YDTN Q  GN NS N N V 
Sbjct  451  PQPCAQPKPAASMVNNAPPAFDLSGVPEDGQKMISELMSIYDTNVQ--GNKNSGN-NQVT  507

Query  620  EDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            E HNL Q       D++F+  + V     F+D+N+      FS   +QF + K    SPF
Sbjct  508  EGHNLFQPKIHHQQDNYFRSQSNVMDANIFEDSNIHNNHQMFSQDGSQFDRFK-ALNSPF  566

Query  455  N-----GNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPK-QDVSTWY  339
                   N        FGSPF+L++  DY       +M+ LPK QD + W+
Sbjct  567  ESSNQHNNNNSSFNLMFGSPFDLSS-FDYKEDLQGLAMESLPKQQDAAIWF  616



>gb|KHN33829.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=621

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 118/228 (52%), Gaps = 19/228 (8%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCPYS  + GF DR SR+NHQ++C YR A A   G  NFQ+N   P +F
Sbjct  395  MDQKIYTCEQPQCPYSETRHGFADRNSRDNHQLSCPYRGA-ASDYGASNFQVNEVKPVIF  453

Query  791  -----sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL--  633
                              S ++ +  G+PEDGQ+MIS+LMS YDTNFQ N N +S N   
Sbjct  454  PQSFVQPKPTTQSVNLVPSVIDLTGLGVPEDGQKMISDLMSIYDTNFQSNKNLSSSNHVA  513

Query  632  --NAVVEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
              N  +    + Q  D+FF+       G  +++ NMP     F+  E+QF + K     P
Sbjct  514  AENPSLPQPGIRQQQDNFFRSQGITMEGNFYEEANMPNNHHMFAREESQFDRFKALNAPP  573

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYSS-------MDQLPKQ-DVSTWY  339
            F  N  +     FGSP +LA+  D+         MD L KQ D+S WY
Sbjct  574  FESNHNNNFHLMFGSPCDLAS-FDFKEDMQGGGGMDALQKQADISIWY  620



>ref|XP_003543159.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=621

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 118/228 (52%), Gaps = 19/228 (8%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCPYS  + GF DR SR+NHQ++C YR A A   G  NFQ+N   P +F
Sbjct  395  MDQKIYTCEQPQCPYSETRHGFADRNSRDNHQLSCPYRGA-ASDYGASNFQVNEVKPVIF  453

Query  791  -----sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL--  633
                              S ++ +  G+PEDGQ+MIS+LMS YDTNFQ N N +S N   
Sbjct  454  PQSFVQPKPTTQSVNLVPSVIDLTGLGVPEDGQKMISDLMSIYDTNFQSNKNLSSSNHVA  513

Query  632  --NAVVEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
              N  +    + Q  D+FF+       G  +++ NMP     F+  E+QF + K     P
Sbjct  514  AENPSLPQPGIRQQQDNFFRSQGITMEGNFYEEANMPNNHHMFAREESQFDRFKALNAPP  573

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYSS-------MDQLPKQ-DVSTWY  339
            F  N  +     FGSP +LA+  D+         MD L KQ D+S WY
Sbjct  574  FESNHNNNFHLMFGSPCDLAS-FDFKEDMQGGGGMDALQKQADISIWY  620



>ref|XP_011080514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
 ref|XP_011080515.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
Length=616

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 119/226 (53%), Gaps = 20/226 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP++  + GFQDR SR+NHQ++C Y+ +S    G+ NF IN+  P VF
Sbjct  396  MDHKIYTCEFLQCPHNELRHGFQDRISRDNHQLSCPYKHSS--EFGVSNFNINDIKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          +    SF     G+PE+GQRMI+ELMSFYD N Q N N N+ N   
Sbjct  454  PQSFVQPKPSALPVNPTPPSFDLSGLGVPEEGQRMINELMSFYDNNVQGNKNSNTGNAAN  513

Query  626  VVE----DHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
              E     H+     D + +    V  G  F+D  +P   S F   + +F  SK    SP
Sbjct  514  AKEQSLQQHSAQSRQDGYLQNQGLVLEGNIFEDKTIPNNLSIFRPPD-RFDHSKV-ITSP  571

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
            FN N  +  +  F SPFN+  P+DY+        + LPKQD++ WY
Sbjct  572  FNPNPTENFQLMFSSPFNI-PPVDYTENFPGVPRNNLPKQDITIWY  616



>ref|XP_006384758.1| EIN3-like family protein [Populus trichocarpa]
 gb|ERP62555.1| EIN3-like family protein [Populus trichocarpa]
Length=617

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 124/227 (55%), Gaps = 20/227 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
             D KIYTCE  QC +S  ++GF DR SR+NHQ+NC YR  S +  G  NF +N   P ++
Sbjct  395  ADQKIYTCEAVQCAHSQIRLGFPDRASRDNHQLNCPYRSTSLEFRG-SNFHVNEVKPVIY  453

Query  791  sapkpaapsvgssssvnasSF---GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
              P   + +     +   SSF   G+PEDGQ+MISELMS YDTN Q N N N  N N V 
Sbjct  454  PQPSAQSKTTAPLVNPAPSSFNLSGVPEDGQKMISELMSIYDTNIQGNKNTNRGN-NLVT  512

Query  620  EDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            E HN+ Q       D+ F+  + +  G+ F+ +N+      FS    QF + K    SPF
Sbjct  513  EGHNVFQPKIQHQQDNHFRSQSNMINGSIFEGSNINQNHQMFSQEGGQFDRFK-PLNSPF  571

Query  455  NGNTCDPG-EFRFGSPFNLAAPIDYS------SMDQLPK-QDVSTWY  339
              N  + G    FGSPF+L++  DY        MD LPK QDVSTW+
Sbjct  572  ETNQNNSGFNLMFGSPFDLSS-FDYKDDLQVLGMDTLPKHQDVSTWF  617



>emb|CBI29154.3| unnamed protein product [Vitis vinifera]
Length=148

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 4/118 (3%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K+YTCEY+QCPY+NY++ F DR SRNNHQ+NC YR  S+Q  GM NFQINN+ PA F
Sbjct  26   MDQKMYTCEYTQCPYNNYRLAFLDRASRNNHQMNCLYRSNSSQGFGMSNFQINNEKPAAF  85

Query  791  sapkpaapsvgssssvn----asSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
            S P     +     + +     S  GLPEDGQ+MIS+LMSFYDTN Q+N + N  NLN
Sbjct  86   SLPFAQPKAAAPPVNQSPAFNVSGLGLPEDGQKMISDLMSFYDTNLQRNKSLNPGNLN  143



>gb|KJB56070.1| hypothetical protein B456_009G105400 [Gossypium raimondii]
Length=612

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 123/226 (54%), Gaps = 22/226 (10%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIYTCE+ QCPYS  ++GF DRT+R+NHQ+ C +R +SAQ  G  NF +N   P +F  P
Sbjct  391  KIYTCEFLQCPYSELRLGFHDRTARDNHQLTCPFRNSSAQ-FGGSNFNVNEVKPVIFPQP  449

Query  782  kpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
               +     S +   + +     G+PEDGQ+MIS+LMS YD N Q N N N  N N   E
Sbjct  450  FAPSKPTAPSITSAPTPYELSGLGVPEDGQKMISDLMSIYDNNIQGNKNMNPGN-NPGTE  508

Query  617  DHNLLQLD-----DDFFKPGAPV-GGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
              NLLQ       D+FF     V   G  F++++MP     F   E QF + K    SPF
Sbjct  509  GQNLLQSKSQPQQDEFFNGHQGVMMEGNFFEESSMPRNHQMFMQGEGQFDRFK-GLNSPF  567

Query  455  NGNTCDPG-EFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
              N  +   +  FGSPF+LA+  DY        +D +PKQDVS W+
Sbjct  568  EANHNNNSFQLMFGSPFDLAS-FDYKEDLQAVGVDTMPKQDVSIWF  612



>ref|XP_009801714.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana sylvestris]
 gb|AAP03998.1| EIL2 [Nicotiana tabacum]
Length=616

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 121/226 (54%), Gaps = 22/226 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCP+S  + GFQDR+SR+NHQ+ C +R  ++ + G+ NF ++   P VF
Sbjct  398  MDQKIYTCECLQCPHSELRNGFQDRSSRDNHQLTCPFR--NSPQFGVSNFHVDEVKPVVF  455

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          +    SF     G+PEDGQRMI+ELMSFYD+N Q  GN NS+  N 
Sbjct  456  PQQYVQPKPASLPINQAPPSFDLSGLGVPEDGQRMINELMSFYDSNIQ--GNKNSMAGNV  513

Query  626  VVEDHNLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
            V+      Q      +++      V  G  F DTN+    S F   + +F QSK    SP
Sbjct  514  VMSKEQPRQQPSIQQNNYLHNQGIVLDGNIFGDTNISANHSVFPQGD-RFDQSKV-LTSP  571

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
            FN  + D   F FGSPFNL +  DY+      + D +PKQDV  WY
Sbjct  572  FNAGSNDNFHFMFGSPFNLQS-TDYTEALSGITQDNMPKQDVPVWY  616



>ref|XP_012066274.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 ref|XP_012066275.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 ref|XP_012066276.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Jatropha curcas]
 gb|KDP42896.1| hypothetical protein JCGZ_23838 [Jatropha curcas]
Length=619

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 125/232 (54%), Gaps = 26/232 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD KIYTCE+ QCPYS  ++GF DR SR+NHQ+NC YR   +   G  NF  N   P +F
Sbjct  392  VDQKIYTCEFVQCPYSQLRLGFNDRASRDNHQLNCPYR--CSLDFGGSNFHCNEVKPVIF  449

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGN-FNSVNLNAVVED  615
              PKPA   V ++      S G+PEDGQ+MISELMS YDTN Q N N     N   V E 
Sbjct  450  PHPKPAPLMVNAAPPTFDLS-GVPEDGQKMISELMSIYDTNIQGNKNTNAGNNGVNVNES  508

Query  614  HNLLQLD-------DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            H+L Q         D++F+  A V  G  F+++N+      FS    QF + K    SPF
Sbjct  509  HSLFQPKIHHHHQPDNYFRGQANVIEGNIFEESNIHNNHQMFSQDSNQFERFK-ALNSPF  567

Query  455  NGN------TCDPGEFRFGSPFNLAAPIDYSS------MDQLPK-QDVSTWY  339
              N        +   F+FGSPF+LA+  DY        MD LPK QDVS W+
Sbjct  568  ESNHHPTAAATNNSSFKFGSPFDLAS-FDYKEDLQGLVMDALPKQQDVSIWF  618



>ref|XP_010031647.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031648.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031649.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 gb|KCW51004.1| hypothetical protein EUGRSUZ_J00631 [Eucalyptus grandis]
Length=611

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 127/227 (56%), Gaps = 27/227 (12%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KI+TCE+ QCPYS  ++GF+DRTSR+NHQ++C YR  S++  G  NF +N   P +F
Sbjct  394  MDHKIFTCEFLQCPYSELRLGFRDRTSRDNHQLSCPYRSNSSE-FGGSNFHVNEVKPVIF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                  +  + S+ +  ++ F     G+PEDGQ++IS+LMS YDT+ Q N N N  N +A
Sbjct  453  PQGFVQSKPMTSTVNSASTPFDLSGLGVPEDGQKVISDLMSIYDTSIQGNKNMNPAN-DA  511

Query  626  VVEDHNL----LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES-  462
            ++ED +     LQ  ++F         G+ FQ  N       FS  + QF + K    S 
Sbjct  512  IIEDQSRPQPKLQQQNEFV--------GSFFQQPNASANHHMFSREDIQFDRFKTMNSSF  563

Query  461  PFNGNTCDPGEFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
              N +  D  +  FGSPF+L++  D+        MD LPKQDV+ W+
Sbjct  564  EANNHNHDNLQLMFGSPFDLSS-FDFKEELPGGVMDPLPKQDVTIWF  609



>dbj|BAA74714.1| transcription factor TEIL [Nicotiana tabacum]
Length=615

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 120/226 (53%), Gaps = 22/226 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCP+S  + GFQDR+SR+NHQ+ C +R  ++ + G+ NF ++   P VF
Sbjct  397  MDQKIYTCECLQCPHSELRNGFQDRSSRDNHQLTCPFR--NSPQFGVSNFHVDEVKPVVF  454

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          +    SF     G+PEDGQRMI+ELMSFYD N Q  GN +S+  N 
Sbjct  455  PQQYVQPKPASLPINQAPPSFDLSGIGVPEDGQRMINELMSFYDNNIQ--GNKSSMAANV  512

Query  626  VVEDHNLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
            V+      Q      +++      +  G  F DTN+    S F   + +F QSK    SP
Sbjct  513  VMSKEQPRQQPSIQQNNYLHNQGIILDGNIFGDTNISANHSMFPQGD-RFDQSKV-LTSP  570

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
            FN  + D   F FGSPFNL +  DY+      + D +PKQDV  WY
Sbjct  571  FNAGSNDNFHFMFGSPFNLQS-TDYTEALSGITQDNMPKQDVPVWY  615



>ref|XP_009587969.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 gb|AAP03997.1| EIL1 [Nicotiana tabacum]
Length=618

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 120/226 (53%), Gaps = 22/226 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCP+S  + GFQDR+SR+NHQ+ C +R  ++ + G+ NF ++   P VF
Sbjct  400  MDQKIYTCECLQCPHSELRNGFQDRSSRDNHQLTCPFR--NSPQFGVSNFHVDEVKPVVF  457

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          +    SF     G+PEDGQRMI+ELMSFYD N Q  GN +S+  N 
Sbjct  458  PQQYVQPKPASLPINQAPPSFDLSGIGVPEDGQRMINELMSFYDNNIQ--GNKSSMAGNV  515

Query  626  VVEDHNLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
            V+      Q      +++      +  G  F DTN+    S F   + +F QSK    SP
Sbjct  516  VMSKEQPRQQPSIQQNNYLHNQGIILDGNIFGDTNISANHSMFPQGD-RFDQSKV-LTSP  573

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
            FN  + D   F FGSPFNL +  DY+      + D +PKQDV  WY
Sbjct  574  FNAGSNDNFHFMFGSPFNLQS-TDYTEALSGITQDNMPKQDVPVWY  618



>gb|KJB83827.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
 gb|KJB83828.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
Length=594

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 127/232 (55%), Gaps = 30/232 (13%)
 Frame = -3

Query  974  HVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV  795
            +V+ +IYTCE+ QCPYS  Q+GF DRT+R+NHQ+ C +R +SA+  G  NF IN+  P +
Sbjct  373  NVEHRIYTCEFLQCPYSELQLGFLDRTARDNHQLTCPHRNSSAE-FGGSNFNINDVKPVI  431

Query  794  FsapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
            F  P         S +  ++ F     G+PEDGQ+MIS+LMS YD N Q N N + +  N
Sbjct  432  FPPPFAQPKPAAPSITSVSTPFDLSGLGVPEDGQKMISDLMSIYDNNVQANKNVSPIK-N  490

Query  629  AVVE-----DHNLLQLDDDFFKPGAPVGGGAT-FQDTNMPITQSGFSSTETQFGQSKFQ-  471
             V E          Q  D+FF+     G G + F ++N+P         E QF + K   
Sbjct  491  PVTEGQNLLQLKTQQQQDEFFR-----GQGLSFFNESNIPANNQILPQGEAQFDRLKTSN  545

Query  470  --YESPFNGNTCDPGEFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
              +E+ +N N     +  FGSPF+L++  DY+       +D +PKQDVS W+
Sbjct  546  SPFETTYNNNNS--FKLMFGSPFDLSS-FDYNDDLQAVGVDTMPKQDVSIWF  594



>ref|XP_011090234.1| PREDICTED: LOW QUALITY PROTEIN: protein ETHYLENE INSENSITIVE 
3 [Sesamum indicum]
Length=598

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 116/224 (52%), Gaps = 22/224 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCEY +CP+   + GF DRTSR+NHQ +C Y+ +S  R    NF IN   P +F
Sbjct  384  MDQKIYTCEYLRCPHGELRHGFHDRTSRDNHQFSCPYKHSSEFRAS--NFNINEVKPIIF  441

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                         S+  A SF     G+PEDGQRMI+ELMS YD N Q N N      N 
Sbjct  442  PQSFVQPKPDPLPSNPPAPSFDLSGLGVPEDGQRMINELMSLYDNNVQGNSNMG----NG  497

Query  626  VVEDHNLLQLDDDFFKPGAPVGGGA--TFQDTNMPITQSGFSSTETQFGQSKFQYESPFN  453
                   LQ  +  ++P   + G     F+D N+P   S FS  + +F Q K    SPF+
Sbjct  498  TATKEKSLQHRNGQYQPDGYLRGQGMNIFEDNNIPNNPSIFSPPD-RFDQCKV-MNSPFS  555

Query  452  GNTCDPGEFRFGSPFNLAAPIDYSSM------DQLPKQDVSTWY  339
             N  +  +  F SPFN+ + IDY+        D LPKQDV+ WY
Sbjct  556  SNPAENFQLMFSSPFNVPS-IDYTEAFPGVPRDNLPKQDVTIWY  598



>gb|KHG04095.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=469

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 121/229 (53%), Gaps = 31/229 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIY CE+ QCPY+ +++GF DR +R++HQ+ C YR +SA   G  +F +N   P +    
Sbjct  250  KIYKCEFFQCPYNEHRLGFHDRAARDSHQLTCPYRNSSALFSG-SSFNVNEVKPVILPQA  308

Query  782  kpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
               +     + +   +SF     G+PEDGQ+MISELMS YD N Q N N N  N N + E
Sbjct  309  FAQSKPTAPAVTSVPTSFDLSGLGVPEDGQKMISELMSVYDNNIQGNKNMNPSN-NPITE  367

Query  617  DHNLL-----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQ-----SKFQY  468
              N+L     Q  D++F+     G G  F+D++MP     F   E QF +     S F+ 
Sbjct  368  GQNILHPKIQQPQDEYFR-----GQGNFFEDSSMPNNHQMFQQGEGQFDRFKGLNSPFET  422

Query  467  ESPFNGNTCDPGEFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
            E   N N   P    FGSPF+L+   DY        MD +P+QDVS W+
Sbjct  423  EHNNNNNNSFP--LMFGSPFDLST-FDYKEDLQTVGMDTIPRQDVSIWF  468



>gb|AHA93899.1| ethylene insensitive 3 [Coffea arabica]
Length=589

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 134/245 (55%), Gaps = 41/245 (17%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP+S  + GFQDR+SR+NHQ++C +R  ++ + G+ NF +N+  P VF
Sbjct  341  IDHKIYTCEFLQCPHSELRHGFQDRSSRDNHQLSCPFR--NSPQFGVSNFNVNDVKPMVF  398

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     + N  SF     G+PEDGQRMI++LMSFY++N Q N N +S N  A
Sbjct  399  PQSFVQPKSAALPVNANPPSFNLSGIGVPEDGQRMINDLMSFYESNIQGNKNADSGNA-A  457

Query  626  VVEDHNL------LQLDDDFFKPGAPVGG-----------------GATFQDTNMPITQS  516
            V+++ ++       Q D+     G  + G                 G  F+DTN+P ++ 
Sbjct  458  VIKEQSVQQPGMQCQSDNYLHGQGIMMEGNIFEDTNVSSNRSIFQQGDRFEDTNIPASRP  517

Query  515  GFSSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQD  354
             F   + +F Q K    SPFN N+ +  +F FGSPFNL + +D++      S D   KQD
Sbjct  518  MFQHGD-RFDQCKI-TSSPFN-NSNEKFQFMFGSPFNLPS-VDFTXSLPGISRDNASKQD  573

Query  353  VSTWY  339
            +  WY
Sbjct  574  LPIWY  578



>gb|KDO53813.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
 gb|KDO53814.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=388

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 15/145 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY +Y++GF +R+SRNNHQ+NC YR  S+Q  GM NFQ+NND    F
Sbjct  240  MDQKIYTCEFPQCPYGDYRLGFLERSSRNNHQLNCPYRHNSSQGFGMPNFQVNNDQTVAF  299

Query  791  sa--------pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            S              P   + S  N S   LP+DGQ+MI++LMSFYDTN QQN + NS N
Sbjct  300  SRPFGQPTQPKPATPPKNQTQSQFNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGN  359

Query  635  LNAVVEDHN-------LLQLDDDFF  582
            LNA+ + +         LQ+DD F+
Sbjct  360  LNAIGDQNQQQEQRKFQLQMDDSFY  384



>gb|KDO53812.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=381

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 15/145 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY +Y++GF +R+SRNNHQ+NC YR  S+Q  GM NFQ+NND    F
Sbjct  233  MDQKIYTCEFPQCPYGDYRLGFLERSSRNNHQLNCPYRHNSSQGFGMPNFQVNNDQTVAF  292

Query  791  sa--------pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            S              P   + S  N S   LP+DGQ+MI++LMSFYDTN QQN + NS N
Sbjct  293  SRPFGQPTQPKPATPPKNQTQSQFNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGN  352

Query  635  LNAVVEDHN-------LLQLDDDFF  582
            LNA+ + +         LQ+DD F+
Sbjct  353  LNAIGDQNQQQEQRKFQLQMDDSFY  377



>gb|KDO53810.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
 gb|KDO53811.1| hypothetical protein CISIN_1g009144mg [Citrus sinensis]
Length=542

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 15/145 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY +Y++GF +R+SRNNHQ+NC YR  S+Q  GM NFQ+NND    F
Sbjct  394  MDQKIYTCEFPQCPYGDYRLGFLERSSRNNHQLNCPYRHNSSQGFGMPNFQVNNDQTVAF  453

Query  791  sa--------pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
            S              P   + S  N S   LP+DGQ+MI++LMSFYDTN QQN + NS N
Sbjct  454  SRPFGQPTQPKPATPPKNQTQSQFNISGLELPDDGQKMITDLMSFYDTNHQQNKSLNSGN  513

Query  635  LNAVVEDHN-------LLQLDDDFF  582
            LNA+ + +         LQ+DD F+
Sbjct  514  LNAIGDQNQQQEQRKFQLQMDDSFY  538



>emb|CDP19134.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 134/245 (55%), Gaps = 41/245 (17%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP+S  + GFQDR+SR+NHQ++C +R  ++ + G+ NF +N+  P VF
Sbjct  396  IDHKIYTCEFLQCPHSELRHGFQDRSSRDNHQLSCPFR--NSPQFGVSNFNVNDVKPMVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     + N  SF     G+PEDGQRMI++LMSFY++N Q N N +S N  A
Sbjct  454  PQSFVQPKSAALPVNANPPSFNLSGIGVPEDGQRMINDLMSFYESNIQGNKNADSGNA-A  512

Query  626  VVEDHNL------LQLDDDFFKPGAPVGG-----------------GATFQDTNMPITQS  516
            V+++ ++       Q D+     G  + G                 G  F+DTN+P ++ 
Sbjct  513  VIKEQSVQQPGMQCQSDNYLHGQGIMMEGNIFEDTNVSSNRSIFQQGDRFEDTNIPASRP  572

Query  515  GFSSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQD  354
             F   + +F Q K    SPFN N+ +  +F FGSPFNL + +D++      S D   KQD
Sbjct  573  MFQHGD-RFDQCKI-TSSPFN-NSNENFQFMFGSPFNLPS-VDFTEGLPGISRDNASKQD  628

Query  353  VSTWY  339
            +  WY
Sbjct  629  LPIWY  633



>ref|XP_006361129.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361130.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 114/222 (51%), Gaps = 15/222 (7%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTC++ QCP++  + GFQDR+SR+NHQ  C YR  S+ R G+ NFQIN   P VF
Sbjct  399  MDQKIYTCDFLQCPHNELRHGFQDRSSRDNHQFACIYR--SSSRFGVSNFQINEVKPVVF  456

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     +    SF     G+PEDGQRMI+ELM+ YD++ Q +   N  N+  
Sbjct  457  PQQYVQPKSSALPVNQGPPSFDLSGIGVPEDGQRMINELMTIYDSDVQGSKRQNRGNVTL  516

Query  626  VVED-HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNG  450
              E  H   ++  D +     +  G  F++TN+  TQS     +  F QSK    S FN 
Sbjct  517  TKEQPHQQPRVHQDNYLLSQGIMEGNIFKNTNISTTQSMLPQVDP-FDQSK-ALNSAFNA  574

Query  449  NTCDPGEFRFGSPFNLAAP-----IDYSSMDQLPKQDVSTWY  339
             + D   F FGS FN+ +      +     D  PKQD   WY
Sbjct  575  GSNDSFHFMFGSSFNIQSTNYNGNLPSIGYDTTPKQDAPIWY  616



>ref|NP_001234541.1| EIL1 protein [Solanum lycopersicum]
 gb|AAK58857.1|AF328784_1 EIL1 [Solanum lycopersicum]
Length=610

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 113/222 (51%), Gaps = 19/222 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP++  + GFQDR+SR+NHQ  C YR ++    G+ NFQIN   P VF
Sbjct  397  MDQKIYTCEFLQCPHNELRHGFQDRSSRDNHQFACLYRSSTC--FGVSNFQINEVKPVVF  454

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     +    SF     G+PEDGQRMI+ELMS YD++ Q +   N  N+  
Sbjct  455  PQQYVQPKSSALPVNQGPPSFDLSGIGVPEDGQRMINELMSIYDSDVQGSKRQNRGNIAL  514

Query  626  VVED-HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNG  450
              E  H   ++  D +     +  G  F++TN+  TQS     +  F QSK      FN 
Sbjct  515  TKEQPHQQPRVHQDNYLLSQGIMDGNIFKNTNISTTQSMLPQVDP-FDQSKA-----FNA  568

Query  449  NTCDPGEFRFGSPFNLAAP-----IDYSSMDQLPKQDVSTWY  339
             + D   F FGSPFN+ +      +     D  PKQD   WY
Sbjct  569  GSNDNFHFMFGSPFNIQSTNYNGNLPSIGYDTTPKQDAPIWY  610



>gb|KJB20248.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20249.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20250.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
Length=615

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 119/227 (52%), Gaps = 29/227 (13%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            KIY CE+ QCPYS +++GF DR +R+NHQ+ C YR  S+      +F +N   P +    
Sbjct  398  KIYKCEFFQCPYSEHRLGFHDRIARDNHQLTCPYR-NSSALFSSSSFNVNEVKPVILPQA  456

Query  782  kpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
               +     + +  ++ F     G+PEDGQ+MISELMS YD N Q + N N  N N + E
Sbjct  457  FAQSKPTAPAVTSVSTPFDLSGLGVPEDGQKMISELMSVYDNNIQGSKNMNPGN-NPIAE  515

Query  617  DHNLL-----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK---FQYES  462
              N+L     Q  D++F+     G G  F+D++MP     F   E QF + K     +E+
Sbjct  516  GQNILHPKIQQPQDEYFR-----GEGNFFEDSSMPNNHQMFPQGEGQFDRFKGLNSLFET  570

Query  461  PFNGNTCDPGEFRFGSPFNLAAPIDYSS------MDQLPKQDVSTWY  339
              N N   P    FGSPF+L+   DY        MD +P+QDVS W+
Sbjct  571  EHNNNNSFP--LMFGSPFDLST-FDYKEDLQTVGMDTIPRQDVSIWF  614



>ref|XP_006364491.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=614

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 118/226 (52%), Gaps = 22/226 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCP+S  + GF DR+SR+NHQ+ C +R  S  + G+ NF +    P VF
Sbjct  396  MDPKIYTCECLQCPHSELRNGFPDRSSRDNHQLTCLFRNTS--QFGVPNFHVEEVKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          +    SF     G+P DGQR+I+ELMSFY++N Q  GN +S+  N 
Sbjct  454  PQQYAQPKQASLPVNPAPPSFDTSGLGVPADGQRVINELMSFYESNVQ--GNKSSMAGNV  511

Query  626  VVEDHNLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
            V+     LQ      +++ +    V  G+ F DTN+    S F   + +F QSK    SP
Sbjct  512  VMSKEQPLQQPSIQQNNYLQSQGNVLEGSIFGDTNISANNSMFVQGD-RFDQSKV-LTSP  569

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
            FN  + D   F FGSPFNL +  D S      S D + KQD S WY
Sbjct  570  FNAGSNDDFNFMFGSPFNLQS-TDLSECLSGISHDDMTKQDTSVWY  614



>gb|AFI61908.1| ethylene insensitive 3-like 2 protein [Paeonia suffruticosa]
Length=607

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 118/219 (54%), Gaps = 14/219 (6%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+  CPYS+  +GF DR SR+NHQ+ C  R ++  + G+ NFQ+N   P VF
Sbjct  394  MDHKIYTCEFLGCPYSDINLGFHDRISRDNHQLTCPNR-SNLSQFGVSNFQMNEVKPVVF  452

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
              P  A P   +  S +  +  +PE+GQ+ I ELMSFYD NF  NGN N  N+ A+ +D 
Sbjct  453  --PLAAQPVNTAPPSFDLPTLRVPEEGQKSIDELMSFYDLNFHGNGNINPGNM-AMTQDL  509

Query  611  NL------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNG  450
            NL       Q  D F +       G  F D+N+P     F     QF   K       N 
Sbjct  510  NLQHPKIHCQQQDRFLQGRGVTIDGDLFADSNIPNNHQIFPRG-GQFDGCKVSIPPLINH  568

Query  449  NTCDPGEFRFGSPFNLAAPIDYS--SMDQLPKQDVSTWY  339
            +  +     FGSP +LA+ +DY+  +M+ L KQD STWY
Sbjct  569  HDDNTYNMIFGSPVHLAS-VDYAGLAMESLSKQDGSTWY  606



>ref|XP_011043514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Populus euphratica]
Length=632

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 93/248 (38%), Positives = 120/248 (48%), Gaps = 47/248 (19%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD +IYTCE  QCPYS  ++GF DR SR+NHQ+NC +R  S +  G  NF IN   P +F
Sbjct  395  VDQRIYTCEAVQCPYSQIRLGFPDRVSRDNHQLNCPFRSTSLE-FGRSNFHINEVKPVIF  453

Query  791  sapkpaapsvgssssvnasSF---GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
              P   +       + +   F   G+PEDGQ+MISELMS YDTN Q N N N VN N V 
Sbjct  454  PQPSVQSKPAAPLVNPSPPPFDLSGVPEDGQKMISELMSIYDTNIQSNKNTNPVN-NLVT  512

Query  620  EDHNLLQLD-------------------DDFFKPGAPVGGGATFQDTNMPITQSGFSSTE  498
              H++ Q                      + F+    V GG  F++ N+      FS   
Sbjct  513  GGHHVFQPKIQRQQDNHNVFQPKIQHQQGNHFRSQGNVIGGNVFKEYNINSNHQLFSQEG  572

Query  497  TQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL--AAPIDYSS-----------MDQLPK-  360
             QF + K    SPF  +  +       S FNL  ++P+D SS           MD LPK 
Sbjct  573  GQFDRFK-PLNSPFETSQNN-------SSFNLMFSSPLDLSSFEYKEDLQGLGMDSLPKH  624

Query  359  -QDVSTWY  339
             QDVS W+
Sbjct  625  QQDVSIWF  632



>gb|AFK45610.1| unknown [Lotus japonicus]
Length=238

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 121/238 (51%), Gaps = 30/238 (13%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY   ++GFQDRTSR+NHQ+NC YR AS+   G  NF +N   P +F
Sbjct  3    MDQKIYTCEHLQCPYGEVRLGFQDRTSRDNHQLNCPYRGASS-NYGGPNFHVNEAKPVIF  61

Query  791  sapkpaapsvgsss-----svnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S   S      S++ +  G+PEDGQ+MI +LMS YDTN Q + N +S N   
Sbjct  62   PQSFVQPKSTAQSVNLVPPSIDLTGLGVPEDGQKMIGDLMSVYDTNVQGSKNLSSSNRVV  121

Query  626  VVEDHNL-----------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQS  480
              E+ N+            Q    FF+  + +  G  F++ N+      F+  E QF + 
Sbjct  122  AAENPNVPQPSIQQQQGIQQQQGSFFRGHSVIMEGNFFEEANISTNHHMFAREENQFDRF  181

Query  479  KFQYESPFNG---NTCDPGEFRFGSPFNLAAPIDYSS-------MDQLPKQ-DVSTWY  339
            K    SPF     ++ +     FGSP +LA+  D+         M+   KQ D+S WY
Sbjct  182  K-ALNSPFEAPHQSSNNNFHLMFGSPCDLAS-FDFKEDMQQGVGMEAHQKQPDISIWY  237



>gb|AHB18380.1| ethylene insensitive 3 [Momordica charantia]
Length=629

 Score =   120 bits (302),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 91/240 (38%), Positives = 124/240 (52%), Gaps = 33/240 (14%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DR SR+NHQ+ C YR +S       NF +N   P +F
Sbjct  395  MDQKIYTCEFLQCPYSELRLGFNDRNSRDNHQLTCPYRTSS--EFSGSNFHVNEVKPVIF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNG-NFNSVNLN  630
                       +  S   SSF     G+PEDGQ++ISELMS YDTN Q N  N N+VN  
Sbjct  453  PQSFAPPKPAPAPVSSVPSSFDLSSLGVPEDGQKLISELMSIYDTNVQGNKNNVNTVNA-  511

Query  629  AVVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYE  465
            A+ E+ NL QL      D++F+    +  G  F+ +N+  +   F   E QF + K    
Sbjct  512  AIAENQNLPQLKIQPQQDEYFRNQGIMMEGNFFEGSNVSSSHPMFPRDEGQFDRFK-PMN  570

Query  464  SPFN---------GNTCDPGEFRFGSPFNLAAPIDY-------SSMDQLPK-QDVSTWYL  336
            +PF           N  +     FGSPF+L+   DY       +++D L K QD+  WYL
Sbjct  571  TPFENNHHQHNHNHNNNNNFHLMFGSPFDLST-FDYKEEVPGAAAIDTLSKQQDIPLWYL  629



>ref|XP_006470438.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470439.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
Length=621

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 116/230 (50%), Gaps = 22/230 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D  IYTCEY QCPYS+ ++G++DRTSR+NHQ+ C Y+ + A   G  +F +N   P VF
Sbjct  395  MDQHIYTCEYLQCPYSDPRLGYRDRTSRDNHQLTCPYK-SGASEFGGSDFHVNEVKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                  +   G + +    SF     G+PEDGQ+MISELMS YD N Q N N N  N   
Sbjct  454  PQTFAQSKPAGPTFNSVQPSFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAV  513

Query  626  VVEDHNLL----QLDDDFFKPGAPVGGGATFQDTNM-PITQSGFSSTETQFGQSKFQYES  462
            V E  N L    Q   +++     V  G  F+ +NM       F+  E QF + K    S
Sbjct  514  VTEGQNTLQPRAQHQQEYYHGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKI-MNS  572

Query  461  PFN---GNTCDPGEFRFGSPFNLAAPIDY------SSMDQLPKQDVSTWY  339
            PF        +     F SPF+L +  DY      + +D +PK D S W+
Sbjct  573  PFENNSSGNNNNFSLMFESPFDLGS-FDYKEDFQAAGVDTMPKHDTSVWF  621



>ref|XP_009607827.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 ref|XP_009607828.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
Length=600

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 113/221 (51%), Gaps = 26/221 (12%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP+S  + GFQD+++R+NHQ  C +R +S  + G+ NF  N   P VF
Sbjct  396  MDRKIYTCEFQQCPHSELRNGFQDKSARDNHQFACPFRNSS--QFGVSNFNFNEVKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     +    +F     G+PEDGQRMI+ELMSFYD+N Q N + N+ N+ A
Sbjct  454  PQQYVQPKSASLPVNQGPPTFDLSGVGVPEDGQRMINELMSFYDSNIQGNKSQNTGNI-A  512

Query  626  VVEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGN  447
            + ++    Q  D++      +  G  F+D N+  + S               + SPFN  
Sbjct  513  LTKEQPHQQPRDNYLHSQG-IMEGNIFKDANISTSHSMLP------------HGSPFNAG  559

Query  446  TCDPGEFRFGSPFNLAAP-----IDYSSMDQLPKQDVSTWY  339
              D     FGSPFNL +      +     D  PKQD+ TWY
Sbjct  560  PNDNFHCMFGSPFNLQSANYTGNLPCIGYDTTPKQDLPTWY  600



>ref|XP_009798829.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=603

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 117/223 (52%), Gaps = 27/223 (12%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP+S  + GFQ +++R+NHQ  C +R +S  + G+ NF  N   P VF
Sbjct  396  MDQKIYTCEFQQCPHSELRNGFQGKSARDNHQFACPFRNSS--QFGVSNFNFNEVKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     +    +F     G+PEDGQRMI+ELMSFYD+N Q N + N+ N+  
Sbjct  454  PQQYVQPKSASLPVNQGPPTFDLSGVGVPEDGQRMITELMSFYDSNIQGNKSQNTGNVAL  513

Query  626  VVED-HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNG  450
              E  H   +++ D +     +  G  F+D N+       S++ +   Q+     SPFN 
Sbjct  514  TKEQPHQQPRVNQDNYLHSQGIMEGNIFKDANI-------STSHSMLPQA-----SPFNA  561

Query  449  NTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
               D   F FGSPFNL +  +Y+        D  PKQ++ TWY
Sbjct  562  GPNDNFHFMFGSPFNLQS-ANYTGNLPGIGYDTTPKQNLPTWY  603



>ref|XP_008451093.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis melo]
Length=625

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 119/234 (51%), Gaps = 27/234 (12%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DRTSR+NHQ+ C YR +S       +F +N   P +F
Sbjct  395  MDQKIYTCEFLQCPYSELRLGFNDRTSRDNHQLTCPYRTSS--EFSGSSFHVNEVKPVIF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     S   SSF     G+PEDGQ++ISELMS YDTN Q N N  +   +A
Sbjct  453  PQSFAPPKSNAPPVSSVPSSFDLSTLGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSA  512

Query  626  VVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
              E+ NL QL      DD+F+    +  G  F  +N+  +   F+  E QF + K    S
Sbjct  513  TTENQNLPQLKIQPQQDDYFRNQGLMMEGNFFDGSNVSSSHQMFTRDEGQFDRFK-PMNS  571

Query  461  PFNGNTCDPG-----EFRFGSPFNLAAPIDY-------SSMDQLPK-QDVSTWY  339
            PF  N             F SPF+L+   DY       +++D L K QD+  WY
Sbjct  572  PFENNHHHHNNNNNFHLMFSSPFDLST-FDYKEEVPGVAAIDTLSKQQDIPLWY  624



>gb|AAP04000.1| EIL4 [Nicotiana tabacum]
Length=603

 Score =   119 bits (298),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 117/223 (52%), Gaps = 27/223 (12%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP+S  + GFQ +++R+NHQ  C +R +S  + G+ NF  N   P VF
Sbjct  396  MDQKIYTCEFQQCPHSELRNGFQGKSARDNHQFACPFRNSS--QFGVSNFNFNEVKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     +    +F     G+PEDGQRMI+ELMSFYD+N Q N + N+ N+  
Sbjct  454  PQQYVQPKSASLPVNQGPPTFDLSGVGVPEDGQRMITELMSFYDSNIQGNKSQNTGNVAL  513

Query  626  VVED-HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNG  450
              E  H   +++ D +     +  G  F+D N+       S++ +   Q+     SPFN 
Sbjct  514  TKEQPHQQPRVNQDNYLHSQGIMEGNIFKDANI-------STSHSMLPQA-----SPFNA  561

Query  449  NTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
               D   F FGSPFNL +  +Y+        D  PKQ++ TWY
Sbjct  562  GPNDNFHFMFGSPFNLQS-ANYTGNLPGIGYDTTPKQNLPTWY  603



>gb|KHN38437.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=469

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 123/234 (53%), Gaps = 37/234 (16%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DR++R+NHQ+NC YR +SA   G  NF    D P +F
Sbjct  249  MDQKIYTCEHPQCPYSEVRLGFHDRSARDNHQLNCAYRNSSADYGGGPNFHATEDKPVIF  308

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   S+S+ A SF     G+PEDGQ+MIS+LM+ YDTN   N N +S N  A
Sbjct  309  PQSFVQPNTTTQSASLVAPSFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSSNCVA  368

Query  626  VVEDHNL----LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK----FQ  471
             VE+HNL    LQ  + +F PG             M +  + F+  E QF + K      
Sbjct  369  -VENHNLSQASLQQQESYF-PGQ-----------GMVLEGNFFAREEGQFDRFKATMNMN  415

Query  470  YESPFNGNTCDPG--EFRFGSPFNLAAPIDYSS-------MDQLPK-QDVSTWY  339
              +PF+ N  +       F SP +L++  D+         MD L K Q+VS WY
Sbjct  416  THTPFDTNHSNNNNIHLMFNSPCDLSS-FDFKEDIQGGVGMDPLHKQQEVSIWY  468



>gb|AGK07288.1| EIN3-3 [Rosa hybrid cultivar]
Length=618

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 116/224 (52%), Gaps = 16/224 (7%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD KIYTCE+ QCPYS ++ GF DRTSR+NHQ++C +   S++  G  NF +N   P +F
Sbjct  397  VDQKIYTCEFVQCPYSEFRHGFHDRTSRDNHQLSCPFSNRSSE-FGASNFLVNEIKPVIF  455

Query  791  sapkpaapsvgssssvnasSF----GLPEDGQRMISELMSFYDTNFQ--QNGNFNSVNLN  630
                    +   S+     SF    G+PEDGQ+MISELMSFYD+N Q  +N N NS   N
Sbjct  456  PQSFVQTKAAAPSAKPVPPSFDLSGGVPEDGQKMISELMSFYDSNVQGDKNANPNSSATN  515

Query  629  AV-VEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFN  453
                    +    D++F+       G  F+++N+      F   E QF Q K    SPF 
Sbjct  516  GQNFSQPKVAHQQDEYFRGQGVRLDGNFFEESNISSNHHLFPREEGQFEQFKV-VSSPFE  574

Query  452  GNTCDPGEFRFGSPFNLAAPIDYSSMDQ---LPKQ---DVSTWY  339
             N        FGSPF+LA+  DY    Q   LP +   + S W+
Sbjct  575  TNHNSNFPMMFGSPFDLAS-FDYKEDLQGLALPMEKQSETSIWF  617



>gb|KDO66378.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66379.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66380.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=621

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 117/230 (51%), Gaps = 22/230 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D  IYTCEY QCPYS+ ++G++DRTSR+NHQ+ C Y+ + A   G  +F +N   P VF
Sbjct  395  MDQHIYTCEYLQCPYSDPRLGYRDRTSRDNHQLTCPYK-SGASEFGGSDFHVNEVKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                  +   G + +    SF     G+PEDGQ+MISELMS YD N Q N N N  N   
Sbjct  454  PQTFAQSKPAGPTFNSVQPSFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAV  513

Query  626  VVEDHNLL----QLDDDFFKPGAPVGGGATFQDTNM-PITQSGFSSTETQFGQSKFQYES  462
            V E  N L    Q   +++     V  G  F+ +NM       F+  E QF + K    S
Sbjct  514  VTEGQNTLQPRAQHQQEYYHGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKI-MNS  572

Query  461  PFN---GNTCDPGEFRFGSPFNLAAPIDY------SSMDQLPKQDVSTWY  339
            PF      + +     F SPF+L +  DY      + +D +PK D S W+
Sbjct  573  PFENNSSGSNNNFSLMFESPFDLGS-FDYKEDFQAAGVDTMPKHDSSVWF  621



>gb|AID55343.1| EIN3-like protein EIL1 [Actinidia chinensis]
Length=620

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 114/230 (50%), Gaps = 22/230 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D +IYTCE  QCP+S  + GF DR+SR+NHQ+ C YR  S++  G+ NF  N   P VF
Sbjct  394  MDPQIYTCEVLQCPHSELRCGFHDRSSRDNHQLTCPYRSNSSE-FGLTNFHNNEVKPIVF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
            + P         S      SF     G+PEDGQ+MISELMSFYD N Q N   N +N++ 
Sbjct  453  TQPFVQPHPAAPSVDSIQRSFDISGLGVPEDGQKMISELMSFYDANIQGNRQSNPMNISG  512

Query  626  VVEDH--------NLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQ  471
             ++          N+    D+ +  G     G   ++ N+PI  S FS  E +F Q K  
Sbjct  513  SLDRALSQSLPQPNIQCQQDNNYIHGQGFVEGHVHEEANLPINLSMFSQQENRFDQRKV-  571

Query  470  YESPFNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
              S F  +  D     FGSP  L   +DY       + D L K D S W+
Sbjct  572  LSSQFEADPNDNFPLMFGSPLYLPC-MDYPEHLPAVARDTLSKPDGSIWF  620



>ref|XP_011032978.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=662

 Score =   119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD K+Y CEY QCPY++ ++GF D T+RNNHQ+NC YR  ++Q  GM NFQIN+D PAVF
Sbjct  395  VDQKVYRCEYPQCPYNDSRIGFLDVTARNNHQMNCSYRTNTSQGFGMSNFQINSDKPAVF  454

Query  791  sapkpaapsvgssssvn--asSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
            S P P   +   + + +   S  GLPEDG++ IS+LMSFYDTN Q++ N N  + N V
Sbjct  455  SLPFPQTKAAAPNQTPSFNVSGLGLPEDGKKSISDLMSFYDTNLQRDKNMNPGSANVV  512


 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = -3

Query  599  LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTCD-PGEFR  423
            +DD F+  GA +G   T + T+MP+  S F STE +F   K  ++S F+ N  D   +FR
Sbjct  578  VDDSFYGQGAIMGNNIT-EVTSMPVNNSAFPSTEIEFDHCK-AFDSAFDANVNDNVVDFR  635

Query  422  FGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            FGSPF +  P++Y SMD +PKQD   WY+
Sbjct  636  FGSPFTM-PPVEY-SMDPMPKQDAGMWYV  662



>ref|XP_003545483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=610

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 119/229 (52%), Gaps = 31/229 (14%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DR++R+NHQ+NC YR +SA   G  NF      P +F
Sbjct  394  MDQKIYTCEHPQCPYSEVRLGFHDRSARDNHQLNCAYRNSSADYGGGPNFHATEVKPVIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   S+S+ A SF     G+PEDGQ+MIS+LM+ YDTN   N N +S N   
Sbjct  454  PQSFVQPNTTAQSASLVAPSFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSTNC-V  512

Query  626  VVEDHNL----LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK--FQYE  465
              E+HNL    LQ  D FF PG             M +  + F+  E QF + K      
Sbjct  513  TAENHNLSQASLQRQDSFF-PG-----------QGMVLEGNLFAREEGQFDRFKATMNMN  560

Query  464  SPFNGNTCDPG-EFRFGSPFNLAA-----PIDYSSMDQLPK-QDVSTWY  339
            +PF+ N  +      F SP +L++      I    MD L K Q+VS WY
Sbjct  561  TPFDTNHNNNNIHLMFNSPCDLSSFDFKEDIQGVGMDSLQKQQEVSIWY  609



>ref|XP_009798827.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798828.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=615

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 114/228 (50%), Gaps = 25/228 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS    GFQDR++R+NHQ+ C +R  S  +LG+ NF +N   P VF
Sbjct  396  MDQKIYTCEFLQCPYSELCHGFQDRSARDNHQLACPFRKTS--QLGISNFHVNEVKPTVF  453

Query  791  sapkpaapsvgssssvnasS-------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
                  + S   S +             G+PEDGQRMI ELMSFYD+    N + N+ N+
Sbjct  454  PQQYVQSKSAALSVNPGPGPPSFDLFGVGVPEDGQRMIDELMSFYDSKIHGNKSQNTGNV  513

Query  632  NAVVED-HNLLQLDDDFFKPGAPVGGGATFQDTNM----PITQSGFSSTETQFGQSKFQY  468
                E  H   +L+ D +     +     F+DTN+    PI   G  + + +   S F  
Sbjct  514  ALTKEQPHQQPRLNQDNYLHSQGMMERNIFKDTNISASHPILPQGNLADQCKVLNSSFDT  573

Query  467  ESPFNGNTCDPGEFRFGSPFNLAAPIDYSSM-----DQLPKQDVSTWY  339
             S  N N      F FGSPFNL +     S+     D  PKQD+  WY
Sbjct  574  GSSDNFN------FMFGSPFNLQSTNYTGSLPGIGCDNTPKQDIPIWY  615



>gb|ABY28269.1| EIN3-like protein EIL1 [Actinidia deliciosa]
Length=570

 Score =   117 bits (294),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 114/230 (50%), Gaps = 22/230 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D +IYTCE  QCP+S  + GF DR+SR+NHQ+ C YR  S++  G+ NF  N   P VF
Sbjct  344  MDPQIYTCEVLQCPHSELRCGFHDRSSRDNHQLTCPYRSNSSE-FGLTNFHNNEVKPIVF  402

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
            + P         S      SF     G+PEDGQ+MISELMSFYD N Q N   N +N++ 
Sbjct  403  TQPFVQPHPAAPSVDSIQRSFDISWLGVPEDGQKMISELMSFYDANIQGNRQSNPMNISG  462

Query  626  VVEDH--------NLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQ  471
             ++          N+    D+ +  G     G   ++ N+PI  S FS  E +F Q K  
Sbjct  463  SLDRALSQSLPQPNIQCQQDNNYIHGQGFVEGHVHEEANLPINFSMFSQQENRFDQRKV-  521

Query  470  YESPFNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
              S F  +  D     FGSP  L   +DY       + D L K D S W+
Sbjct  522  LSSQFEADPNDNFPLMFGSPLYLPC-MDYPEHLPAVARDTLSKPDGSIWF  570



>ref|XP_003519487.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=614

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 123/234 (53%), Gaps = 37/234 (16%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DR++R+NHQ+NC YR +SA   G  NF    D P +F
Sbjct  394  MDQKIYTCEHPQCPYSEVRLGFHDRSARDNHQLNCAYRNSSADYGGGPNFHATEDKPVIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   S+S+ A SF     G+PEDGQ+MIS+LM+ YDTN   N N +S N  A
Sbjct  454  PQSFVQPNTTTQSASLVAPSFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSSNCVA  513

Query  626  VVEDHNL----LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK----FQ  471
             VE+HNL    LQ  + +F PG             M +  + F+  E QF + K      
Sbjct  514  -VENHNLSQASLQQQESYF-PG-----------QGMVLEGNFFAREEGQFDRFKATMNMN  560

Query  470  YESPFNGNTCDPG--EFRFGSPFNLAAPIDYSS-------MDQLPK-QDVSTWY  339
              +PF+ N  +       F SP +L++  D+         MD L K Q+VS WY
Sbjct  561  THTPFDTNHSNNNNIHLMFNSPCDLSS-FDFKEDIQGGVGMDPLHKQQEVSIWY  613



>gb|AFH56407.1| EIN3-like protein EIL1, partial [Diospyros kaki]
Length=594

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 117/228 (51%), Gaps = 32/228 (14%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASA--QRLGMQNFQINNDGPA  798
            +D KIYTCE+ QCP+S  ++GF DR+SR+NHQ+ C  R  ++   R  +Q        PA
Sbjct  382  MDHKIYTCEFLQCPHSEPRLGFPDRSSRDNHQLACPQRGQTSCIPRPFLQ------PKPA  435

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL-----  633
                    +       S + S  G+PEDGQ+MISELMSFYD N Q N   +S+N+     
Sbjct  436  A-------SSVNSVQPSFDLSGLGVPEDGQKMISELMSFYDANVQGNKLSHSINIPITKD  488

Query  632  ----NAVVEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYE  465
                 A+ + +   Q ++++      V G   F++ NM   +S FS    QF Q K    
Sbjct  489  QTPQQALSQPNLHCQQENNYIHGQGVVMGVNIFEEANMSSNRSMFSRQGDQFDQCK-ALN  547

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
            SPF  N  D     FGSPFNL  P+DY+      + D L K DVS WY
Sbjct  548  SPFEANPNDNFHLMFGSPFNL-PPVDYTEGIPGVARDMLSKPDVSIWY  594



>ref|XP_002312841.2| EIN3-like family protein [Populus trichocarpa]
 gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa]
Length=625

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 120/248 (48%), Gaps = 47/248 (19%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD +IYTCE  QCPYS  ++GF DR SR+NHQ+NC +R ++    G  NF IN   P +F
Sbjct  388  VDQRIYTCEAVQCPYSQIRLGFPDRVSRDNHQLNCPFR-STLLEFGRSNFHINEVKPVIF  446

Query  791  sapkpaapsvgssssvnasSF---GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
              P   +       +    SF   G+PEDGQ+MISELMS YDTN Q N N N VN N V 
Sbjct  447  PQPSVQSKPAAPLVNPAPPSFDLSGVPEDGQKMISELMSNYDTNIQGNKNTNPVN-NLVT  505

Query  620  EDHNLLQLD-------------------DDFFKPGAPVGGGATFQDTNMPITQSGFSSTE  498
              H++ Q                      + F+    V  G  F+++N+      FS   
Sbjct  506  GGHHVFQPKIQHQQDNHNVFQPKIQHQQGNHFRSQGNVIDGNVFKESNINSNHQLFSQEG  565

Query  497  TQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL--AAPIDYSS-----------MDQLPK-  360
             QF + K    SPF  +       +  S FNL  ++P+D SS           MD LPK 
Sbjct  566  GQFDRFK-PLNSPFETS-------QNNSSFNLMFSSPLDLSSFEYKEDLQGLGMDSLPKH  617

Query  359  -QDVSTWY  339
             QDVS W+
Sbjct  618  QQDVSIWF  625



>gb|KHN26027.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=614

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 119/233 (51%), Gaps = 35/233 (15%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DR++R+NHQ+NC YR +SA   G  NF      P +F
Sbjct  394  MDQKIYTCEHPQCPYSEVRLGFHDRSARDNHQLNCAYRNSSADYGGGPNFHATEVKPVIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   S+S+ A SF     G+PEDGQ+MIS+LM+ YDTN   N N +S N   
Sbjct  454  PQSFVQPNTTAQSASLVAPSFDLTGLGVPEDGQKMISDLMTIYDTNVVGNKNLSSTNC-V  512

Query  626  VVEDHNL----LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK------  477
              E+HNL    LQ  D FF PG             M +  + F+  E QF + K      
Sbjct  513  TAENHNLSQASLQRQDSFF-PG-----------QGMVLEGNLFAREEGQFDRFKATMNMN  560

Query  476  FQYESPFNGNTCDPG-EFRFGSPFNLAA-----PIDYSSMDQLPK-QDVSTWY  339
                +PF+ N  +      F SP +L++      I    MD L K Q+VS WY
Sbjct  561  MNMNTPFDTNHNNNNIHLMFNSPCDLSSFDFKEDIQGVGMDSLQKQQEVSIWY  613



>ref|XP_004144109.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis sativus]
 gb|KGN66413.1| EIN3-like protein [Cucumis sativus]
Length=630

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 119/239 (50%), Gaps = 32/239 (13%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DRTSR+NHQ+ C YR +S       +F +N   P +F
Sbjct  395  MDQKIYTCEFLQCPYSELRLGFNDRTSRDNHQLTCPYRTSS--EFSGSSFHVNEVKPVIF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     S   SSF     G+PEDGQ++ISELMS YDTN Q N N  +   +A
Sbjct  453  PQSFAPPKSNPPPVSSVPSSFDLSTLGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSA  512

Query  626  VVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
              E+ NL QL      DD+F+    +  G  F  +N+  +   F+  E QF + K    +
Sbjct  513  TTENQNLPQLKIQPQQDDYFRNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFK-PMNT  571

Query  461  PFNGNTCDPG----------EFRFGSPFNLAAPIDY-------SSMDQLPK-QDVSTWY  339
            PF  N                  F SPF+L+   DY       +++D L K QD+  WY
Sbjct  572  PFENNHHHHNNNNNNNNNNFHLMFSSPFDLST-FDYKEEVSGVAAIDTLSKQQDIPLWY  629



>ref|XP_011046481.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011046482.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score =   115 bits (289),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 2/118 (2%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD K+Y CE+ QCPY++  +GF D T+RNNHQ+NC YR  ++Q LG+ NFQIN+D PAVF
Sbjct  394  VDQKVYRCEHPQCPYNDSGLGFLDITARNNHQMNCLYRTNASQGLGLSNFQINSDKPAVF  453

Query  791  sapkpaapsvgssssvn--asSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
            S P P   +   + + +   S  GLPEDG++ IS+LMSFYDTN Q++ N N  + N +
Sbjct  454  SLPFPQTKAAAPNQTPSFNVSGLGLPEDGKKSISDLMSFYDTNLQRDKNMNPGSANVI  511


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = -3

Query  599  LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTCD-PGEFR  423
            LDD F+  GA  G   T + T+MP+  + FSSTE QF   K  ++S F+ N  D   +FR
Sbjct  574  LDDSFYGQGAMAGNNIT-EATSMPVNNAVFSSTENQFDHCK-AFDSAFDTNVSDNITDFR  631

Query  422  FGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            FGSPF  + P+DY SMD +PKQDV  WY+
Sbjct  632  FGSPFP-SPPVDY-SMDLIPKQDVGMWYV  658



>ref|NP_001234721.1| EIL2 protein [Solanum lycopersicum]
 gb|AAK58858.1|AF328785_1 EIL2 [Solanum lycopersicum]
Length=614

 Score =   115 bits (288),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 117/226 (52%), Gaps = 22/226 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K YTCE   CP+S  + GF DR+SR+NHQ+ C +R  S  +  + NF +    P VF
Sbjct  396  MDPKTYTCECLHCPHSELRNGFPDRSSRDNHQLTCLFRNTS--QFVVPNFHMEEVKPVVF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          +    SF     G+P DGQR+I+ELMSFY++N Q  GN +S+  N+
Sbjct  454  PQQYAEPKRASLPVNPAPPSFDTSGLGVPADGQRVINELMSFYESNVQ--GNKSSMAGNS  511

Query  626  VVEDHNLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
            V+     LQ      +++ +    V  G+ F DTN+    S F   + +F QSK    SP
Sbjct  512  VMSKEQPLQQPSIQQNNYLQSQGNVLEGSIFGDTNISANNSMFVQGD-RFDQSKV-LTSP  569

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
            FN ++ D   F FGSPFN+ +  D S      S D + KQD S WY
Sbjct  570  FNASSTDDFNFMFGSPFNMQS-TDLSECLSGISHDDVTKQDASVWY  614



>ref|XP_009607986.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
 ref|XP_009607987.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=615

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 114/229 (50%), Gaps = 27/229 (12%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS    GFQDR++R+NHQ+ C +R  S  +LG+ NF +N   P VF
Sbjct  396  MDQKIYTCEFLQCPYSELHHGFQDRSARDNHQLACPFRKTS--QLGVSNFHVNEVKPTVF  453

Query  791  sapkpaapsvgssssvnasS-------FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
                  + S     +             G+PEDGQRMI ELMSFYD+N Q N   N+ N+
Sbjct  454  PQQYVQSKSPVLPVNPGPGPPSFGLFGVGVPEDGQRMIDELMSFYDSNIQGNKIQNTGNV  513

Query  632  NAVV-EDHNLLQLDDDFFKPGAPVGGGATFQDTNM----PITQSGFSSTETQFGQSKFQY  468
                 + H   +L+ D +     +  G  F+DT++    PI   G  + + +        
Sbjct  514  ALTKGQPHQQPRLNQDNYLHSQGMMEGNIFKDTSISAIHPILPQGNLTDQCKV------L  567

Query  467  ESPFNGNTCDPGEFRFGSPFNLAAPIDYS------SMDQLPKQDVSTWY  339
             S FN  + D   F  GS F+L +  +YS        D  PKQD+  WY
Sbjct  568  NSSFNAGSSDNFNFMLGSLFDLQS-TNYSGSLPGIGCDNTPKQDIPIWY  615



>ref|XP_006446380.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446381.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59620.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59621.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=596

 Score =   115 bits (287),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 116/230 (50%), Gaps = 22/230 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D  IYTCEY QCPYS+ ++G+ DRTSR+NHQ+ C Y+  +++  G  +F +N   P +F
Sbjct  370  MDQHIYTCEYLQCPYSDPRLGYCDRTSRDNHQLTCPYKSGASEFAG-SDFHVNEVKPVIF  428

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                  +   G + +    SF     G+PEDGQ+MISELMS YD N Q N N N  N   
Sbjct  429  PQTFAQSKPAGPTFNSVQPSFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPSNNAV  488

Query  626  VVEDHNLL----QLDDDFFKPGAPVGGGATFQDTNMPI-TQSGFSSTETQFGQSKFQYES  462
            V E  N L    Q   +++     V  G  F+ +NM       F   E QF + K    S
Sbjct  489  VTEGQNTLQPRAQHQQEYYHGQGAVMDGNLFEGSNMHDNNHLMFPREENQFDRFKI-MNS  547

Query  461  PFN---GNTCDPGEFRFGSPFNLAAPIDY------SSMDQLPKQDVSTWY  339
            PF      + +     F SPF+L +  DY      + +D +PK D S W+
Sbjct  548  PFENNSSGSNNNFSLMFESPFDLGS-FDYKEDFQAAGVDTMPKHDSSVWF  596



>ref|XP_004288382.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Fragaria vesca subsp. 
vesca]
Length=618

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 117/224 (52%), Gaps = 16/224 (7%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD KIYTCE+ QCPYS +  GF DRTSR+NHQ++C +   S++  G  N  +N   P +F
Sbjct  397  VDQKIYTCEFVQCPYSEFHHGFHDRTSRDNHQLSCPFSNRSSE-FGAPNLLVNEIKPIIF  455

Query  791  sapkpaapsvgssssvnasSF----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
                    +  SS+     SF    G+PEDGQ+MIS+LMSFYD N Q + N N  +L   
Sbjct  456  PHSFVQNKAATSSTKPVPPSFDLSAGVPEDGQKMISDLMSFYDCNVQGDKNANPNSLVTN  515

Query  623  VED---HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFN  453
            V++    N+    D++F+       G  F+++N+      F+  E QF Q K    SPF 
Sbjct  516  VKNFSQPNVAHQQDEYFRGQGVRLDGNFFEESNISSNHHVFTREEGQFDQFKV-TSSPFE  574

Query  452  GNTCDPGEFRFGSPFNLAAPIDYSSMDQ---LPKQ---DVSTWY  339
             N        FGS F+LA+  DY    Q   LP +   + S W+
Sbjct  575  TNHNSNFPMMFGSSFDLAS-FDYKEDLQGLALPMEKPVETSIWF  617



>ref|XP_006446382.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446383.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59622.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59623.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=621

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 116/230 (50%), Gaps = 22/230 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D  IYTCEY QCPYS+ ++G+ DRTSR+NHQ+ C Y+  +++  G  +F +N   P +F
Sbjct  395  MDQHIYTCEYLQCPYSDPRLGYCDRTSRDNHQLTCPYKSGASEFAG-SDFHVNEVKPVIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                  +   G + +    SF     G+PEDGQ+MISELMS YD N Q N N N  N   
Sbjct  454  PQTFAQSKPAGPTFNSVQPSFDISGLGVPEDGQKMISELMSIYDNNIQGNRNVNPSNNAV  513

Query  626  VVEDHNLL----QLDDDFFKPGAPVGGGATFQDTNMPI-TQSGFSSTETQFGQSKFQYES  462
            V E  N L    Q   +++     V  G  F+ +NM       F   E QF + K    S
Sbjct  514  VTEGQNTLQPRAQHQQEYYHGQGAVMDGNLFEGSNMHDNNHLMFPREENQFDRFKI-MNS  572

Query  461  PFN---GNTCDPGEFRFGSPFNLAAPIDY------SSMDQLPKQDVSTWY  339
            PF      + +     F SPF+L +  DY      + +D +PK D S W+
Sbjct  573  PFENNSSGSNNNFSLMFESPFDLGS-FDYKEDFQAAGVDTMPKHDSSVWF  621



>ref|XP_003555660.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN46383.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=624

 Score =   114 bits (285),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 117/235 (50%), Gaps = 26/235 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCPYS    GF DR SR+NH+++C YR +++   G  NF +N   P +F
Sbjct  391  MDQKIYTCEQPQCPYSEIHHGFADRNSRDNHRLSCPYRGSASTDYGGSNFHVNEAKPVIF  450

Query  791  --------sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN  636
                          +      S ++ +  G+PEDG++MI++LMS YDTN Q N N +S N
Sbjct  451  PQQSFVQPKPTTTPSVVNLVPSVIDLTGLGVPEDGKKMITDLMSIYDTNVQSNKNLSSSN  510

Query  635  LNAVVEDHNLLQL-----DDDFFKPGAPVGGGATFQDTNMP-ITQSGFSSTETQFGQSKF  474
             +   E+ NL Q       D+FF+       G  F++ NM       F+  E QF + K 
Sbjct  511  -HVSAENPNLPQPGIQQQHDNFFRSQGISMEGNFFEEANMSNNNHHMFAREEGQFDRFKA  569

Query  473  QYESPFNGNTCDPG-EFRFGSPFNLAAPIDYSS--------MDQLPKQ-DVSTWY  339
                PF  N  +      FGSP +LA+  D+          MD L KQ D+S WY
Sbjct  570  LNAPPFETNHNNNNFHLMFGSPCDLAS-FDFKEDMQGGVVGMDALQKQPDISIWY  623



>ref|XP_002275284.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
 ref|XP_010651613.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
Length=610

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 119/226 (53%), Gaps = 24/226 (11%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCP+S  Q GF DR SR+NHQ+ C YR  S++  GM N  +N   P  F
Sbjct  394  MDHKIYTCEFLQCPHSEPQFGFHDRISRDNHQLTCSYRSNSSE-FGMLNLHVNEVKPVAF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
              P         +++  ++SF     G+PEDGQ+MI +LMSFYDTN Q +   N  ++ A
Sbjct  453  PLPFGQPKPAAPAANSASASFDLSGLGVPEDGQKMIGDLMSFYDTNIQGSKVSNPRSI-A  511

Query  626  VVEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKF---QYESPF  456
            V  D NL        +  +  G     Q++NM      F   E+QF +SK    ++E+  
Sbjct  512  VTNDQNLQHPKRQHHQNNSFHG---FLQESNMTHNHHMFPREESQFDRSKLLNSRFETSP  568

Query  455  NGNTCDPGEFRFGSPFNLAAPIDY-------SSMDQLPKQDVSTWY  339
            N N     +F +G  F+L++ IDY       ++ D   KQD S WY
Sbjct  569  NENAF---QFIYGPAFDLSS-IDYVEDIPATTATDISSKQDASIWY  610



>gb|AFK80347.1| ethylene-insensitive 3 [Cucumis sativus]
Length=635

 Score =   113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 119/244 (49%), Gaps = 37/244 (15%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DRTSR+NHQ+ C YR +S       +F +N   P +F
Sbjct  395  MDQKIYTCEFLQCPYSELRLGFNDRTSRDNHQLTCPYRTSS--EFSGSSFHVNEVKPVIF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     S   SSF     G+PEDGQ++ISELMS YDTN Q N N  +   +A
Sbjct  453  PQSFAPPKSNPPPVSSVPSSFDLSTLGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSA  512

Query  626  VVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
              E+ NL QL      DD+F+    +  G  F  +N+  +   F+  E QF + K    +
Sbjct  513  TTENQNLPQLKIQPQQDDYFRNQGLMIEGNFFDGSNVSSSHQMFTRDEGQFDRFK-PMNT  571

Query  461  PFNGNTCDPG---------------EFRFGSPFNLAAPIDY-------SSMDQLPK-QDV  351
            PF  N                       F SPF+L+   DY       +++D L K QD+
Sbjct  572  PFENNHHHHNNNNNNNNNNNNNNNFHLMFSSPFDLST-FDYKEEVSGVAAIDTLSKQQDI  630

Query  350  STWY  339
              WY
Sbjct  631  PLWY  634



>emb|CAB95830.1| hypothetical protein [Cicer arietinum]
Length=354

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 115/231 (50%), Gaps = 35/231 (15%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K+YTCE+ QCPYS  ++ FQDR+SR+NHQ+NC YR + A   G  NF      P +F
Sbjct  138  IDQKLYTCEHPQCPYSEVRLAFQDRSSRDNHQLNCPYRNSPAD-YGGSNFHATEVKPIIF  196

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S    + +   SF     G+PEDGQ+MI+ELMS YDTN   N N +S N  A
Sbjct  197  PQSFVQPNSTAQPAGLVPPSFDLTGLGVPEDGQKMITELMSIYDTNVIGNKNASSTNCVA  256

Query  626  VVEDHNLL-----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
             VE+ NL      Q  D+FF     V   A F           F+  E+QF + K    S
Sbjct  257  -VENQNLSQPCIQQQQDNFFSSQGMVMEAANF-----------FTRDESQFDRFK-PINS  303

Query  461  PFNGNTCDPG-EFRFGSPFNLAAPIDYSS--------MDQLPKQ-DVSTWY  339
            PF  N  +      FGSP +LA+  D+          +D   KQ D+S WY
Sbjct  304  PFETNHNNNNIHLMFGSPCDLAS-FDFKEDIQLQGVGIDTFHKQPDMSIWY  353



>ref|XP_006361131.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=605

 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 113/222 (51%), Gaps = 24/222 (11%)
 Frame = -3

Query  965  VKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsa  786
             +IYTCE  QCPYS  + GFQDR++R+NHQ+ C +R  S  + G+  F +N   P VF  
Sbjct  395  AQIYTCEILQCPYSELRHGFQDRSARDNHQLACPFRNTS--QFGVSKFPMNEVKPVVFPQ  452

Query  785  pkpaapsvgssssvnasSFGL-----PEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
                + SV    + +   FGL     PEDGQRMI +LMSFYD N Q N + N+ N+ AV 
Sbjct  453  QYVPSSSVALPVNPSPPPFGLFGVGVPEDGQRMIDDLMSFYDCNIQGNKSQNTGNV-AVT  511

Query  620  EDHNLLQ---LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNG  450
            ++  L Q   +D   +     +  G  F+D N+  +QS    +     Q K         
Sbjct  512  KEQQLHQQPRVDQVNYLHSRGMMEGNIFKDINVSASQSMHPQSNP-VDQCKIL-------  563

Query  449  NTCDPGEFRFGSPFNLAA---PIDYSSM--DQLPKQDVSTWY  339
            N+ D   F FG PFNL +   P   S +  D  PKQD+  WY
Sbjct  564  NSSDNLHFMFGPPFNLQSTNYPGSLSGIGCDATPKQDIPIWY  605



>gb|ACJ70675.1| EIN3-like protein EIL2 [Actinidia deliciosa]
Length=618

 Score =   112 bits (280),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 116/229 (51%), Gaps = 22/229 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE  QCP+S  + GF DR+SR+NHQ++C YR  S + + + +F+ N   P VF
Sbjct  394  MDHKIYTCEVPQCPHSELRCGFHDRSSRDNHQLSCPYRSNSTEFV-LPSFRNNEIKPIVF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
              P         S +    SF     G+PEDGQ+MI+ELMSFYD+N Q N   N +++ +
Sbjct  453  PQPFVQPKPAAQSVNSIQHSFDLSGLGVPEDGQKMINELMSFYDSNIQGNKQSNPMSI-S  511

Query  626  VVEDHNLLQ------LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYE  465
            V  +  L Q      +D+++      V      ++ N+P+  S FS  E +F   K    
Sbjct  512  VSSNQTLSQALPQPNIDNNYIHGQGFVMERNICEEANLPVNLSMFSQQENRFDHRKV-LN  570

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYSSM-------DQLPKQDVSTWY  339
            S F  N  D     F SPF L + +DY          D L K D S W+
Sbjct  571  SQFEANPNDNVPLMFASPFYLPS-VDYPEHLPGLPRGDTLSKPDGSVWF  618



>dbj|BAB64344.1| EIN3-like protein [Cucumis melo]
Length=693

 Score =   112 bits (280),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 117/224 (52%), Gaps = 22/224 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DRTSR+NHQ+ C YR +S       +F +N   P +F
Sbjct  395  MDQKIYTCEFLQCPYSELRLGFNDRTSRDNHQLTCPYRTSS--EFSGSSFHVNEVKPVIF  452

Query  791  sapkpaapsvgssssv----nasSFGLPEDGQRMISELMSFYDTNFQQNG-NFNSVNLNA  627
                    S+   S+       S+ G+PEDGQ++ SELMS YDTN Q N  N N+VN +A
Sbjct  453  PQSFAPPKSMHPPSAQFRHFRLSTLGVPEDGQKLTSELMSIYDTNIQGNKNNLNTVN-SA  511

Query  626  VVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
              E+ NL QL      DD+F+    +  G  F  +N+  +   F+  E QF + K    S
Sbjct  512  TTENQNLPQLKIQPQQDDYFRNQGLMMEGNFFDGSNVSSSHQMFTRDEGQFDRFK-PMNS  570

Query  461  PFNGNTCDPG-----EFRFGSPFNLAAPIDYSSMDQLPKQDVST  345
            PF  N             F SPF+L+   DY   +++P    ST
Sbjct  571  PFENNHHHHNNNNNFHLMFSSPFDLST-FDYK--EEVPSVQPST  611



>gb|AID55344.1| EIN3-like protein EIL2 [Actinidia chinensis]
Length=618

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 115/229 (50%), Gaps = 22/229 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
             D KIYTCE  QCP+S  + GF DR+SR+NHQ++C YR  S + + + +F+ N   P VF
Sbjct  394  TDHKIYTCEVPQCPHSELRCGFHDRSSRDNHQLSCPYRSNSTEFV-LPSFRNNEIKPIVF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
              P         S +    SF     G+PEDGQ+MI+ELMSFYD+N Q N   N +++ +
Sbjct  453  PQPFVQPKPAAQSVNSIQHSFDLSGLGVPEDGQKMINELMSFYDSNIQGNKQSNPMSI-S  511

Query  626  VVEDHNLLQ------LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYE  465
            V  +  L Q      +D+++      V      ++ N+P+  S FS  E +F   K    
Sbjct  512  VSSNQTLSQALPQPNIDNNYIHGQGFVMERNICEEANLPVNLSMFSQQENRFDHRKV-LN  570

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYSSM-------DQLPKQDVSTWY  339
            S F  N  D     F SPF L + +DY          D L K D S W+
Sbjct  571  SQFEANPNDNVPLMFASPFYLPS-VDYPEHLPGLPRGDTLSKPDGSVWF  618



>ref|XP_004501972.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004501973.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=624

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 117/238 (49%), Gaps = 40/238 (17%)
 Frame = -3

Query  974  HVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV  795
             +D KI+TCE+S CPYS  ++GFQDR SR+NHQ+NC YR +S+   G  ++ +N   P +
Sbjct  400  RMDQKIFTCEHSHCPYSEVRLGFQDRISRDNHQLNCPYRASSSDYAG-PSYHVNEVKPVI  458

Query  794  F-----sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
            F      +   A        S++ +  G+PEDGQ+MI +LM+ YDTN Q N      N  
Sbjct  459  FPQSFVQSKPTAQSVNMVPPSIDLTGLGVPEDGQKMIGDLMTGYDTNVQGN------NRV  512

Query  629  AVVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYE  465
            A VE+ NL Q +       F++    V GG  FQ+T+M      F+  E QF + K    
Sbjct  513  AAVENPNLPQPNIQPQQGSFYRSQGIVMGGNLFQETSMSNNHHMFARDEGQFDRFK-ALN  571

Query  464  SPFN---------------GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQ-DVSTWY  339
            SPF                G+ CD   F F    +         +D L KQ D+S WY
Sbjct  572  SPFENHHNHNHNNNYHLMFGSHCDLTSFDFKDDMHGVG------VDGLQKQPDISIWY  623



>ref|XP_011012998.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011012999.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013000.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
 ref|XP_011013001.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Populus euphratica]
Length=658

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 2/118 (2%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD K+Y CE+ QCPY++  +GF D T+RNNHQ+NC YR  ++Q LG+ NFQIN+D PAVF
Sbjct  394  VDQKVYRCEHPQCPYNDSGLGFLDITARNNHQMNCLYRTNASQGLGLSNFQINSDKPAVF  453

Query  791  sapkpaapsvgssssvnasSFG--LPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
            S P P   +   + + + +  G  L EDGQ+ IS+LMSFYDTN Q++ N N  + N +
Sbjct  454  SLPFPQTKAAAPNQTPSFNVSGLRLSEDGQKTISDLMSFYDTNLQRDKNMNPGSANVI  511


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = -3

Query  599  LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTCD-PGEFR  423
            LDD F+  GA  G   T + T+MP+  + FSSTE QF   K  ++S F+ N  D   +FR
Sbjct  574  LDDSFYGQGAMAGNNIT-EATSMPVNNAVFSSTENQFDHCK-AFDSAFDTNVSDNITDFR  631

Query  422  FGSPFNLAAPIDYSSMDQLPKQDVSTWYL  336
            FGSPF  + P+DY SMD +PKQDV  WY+
Sbjct  632  FGSPFP-SPPVDY-SMDLIPKQDVGMWYV  658



>ref|XP_004491182.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004491183.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=611

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 115/231 (50%), Gaps = 35/231 (15%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K+YTCE+ QCPYS  ++ FQDR+SR+NHQ+NC YR + A   G  NF      P +F
Sbjct  395  IDQKLYTCEHPQCPYSEVRLAFQDRSSRDNHQLNCPYRNSPAD-YGGSNFHATEVKPIIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S    + +   SF     G+PEDGQ+MI+ELMS YDTN   N N +S N  A
Sbjct  454  PQSFVQPNSTAQPAGLVPPSFDLTGLGVPEDGQKMITELMSIYDTNVIGNKNASSTNCVA  513

Query  626  VVEDHNL-----LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
             VE+ NL      Q  D+FF     V   A F           F+  E+QF + K    S
Sbjct  514  -VENQNLSQPCIQQQQDNFFSSQGMVMEAANF-----------FTRDESQFDRFK-PINS  560

Query  461  PFNGNTCDPG-EFRFGSPFNLAAPIDYSS--------MDQLPKQ-DVSTWY  339
            PF  N  +      FGSP +LA+  D+          +D   KQ D+S WY
Sbjct  561  PFETNHNNNNIHLMFGSPCDLAS-FDFKEDIQLQGVGIDTFHKQPDMSIWY  610



>ref|XP_004306440.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Fragaria vesca 
subsp. vesca]
Length=604

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 121/228 (53%), Gaps = 28/228 (12%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMG-FQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsa  786
            K+YTCE+ QC +S+ + G F D TSRNNHQ++C YR   +   GM N  +NND P  F  
Sbjct  386  KVYTCEFLQCSHSDSRFGGFSDITSRNNHQMSCPYRNNCSPVFGMPNL-LNNDKPVGFPL  444

Query  785  pkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQN---GNFNSVNLN  630
            P   A           S F     GL +DGQ+MISELMS YD N +Q    GNF      
Sbjct  445  PVAQAKPAIIQQVNPTSPFNVSGLGLADDGQKMISELMSSYDGNTRQTSNPGNF------  498

Query  629  AVVEDHNLLQLD------DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY  468
            +VV+D N  Q++      D+F+  G  +      +   MP+ Q    S E QF Q K  +
Sbjct  499  SVVQDPNHQQVNYQFEVGDNFYSQGMVMDRSNVPEPAPMPMHQQVLPSPEVQFDQCKV-F  557

Query  467  ESPFNGNTCDP-GEFRF--GSPFNLAAPIDYSSMDQLPKQDVST-WYL  336
            +S F  N+ D   + RF  GS F+LA  +DY++ + L KQD S+ WY+
Sbjct  558  DSSFGNNSNDAIADLRFGTGSQFSLAH-LDYTAGNSLLKQDASSIWYI  604



>gb|AAP70005.1|AF498235_1 EIL [Solanum lycopersicum]
Length=359

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 115/221 (52%), Gaps = 20/221 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K YTCE   CP+S  + GF DR+SR+NHQ+ C +R  S  +  + NF +    P VF
Sbjct  138  MDPKTYTCECLHCPHSELRNGFPDRSSRDNHQLTCLFRNTS--QFVVPNFHMEEVKPVVF  195

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          +    SF     G+P DGQR+I+ELMSFY++N Q  GN +S+  N+
Sbjct  196  PQQYVEPKRASLPVNPAPPSFDTSGLGVPADGQRVINELMSFYESNVQ--GNKSSMAGNS  253

Query  626  VVEDHNLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
            V+     LQ      +++ +    V  G+ F DTN+  + S F   + +F QSK    SP
Sbjct  254  VMSKEQPLQQPSIQQNNYLQSQGNVLEGSIFGDTNISASNSMFVQGD-RFDQSKV-LTSP  311

Query  458  FNGNTCDPGEFRFGSPFN-----LAAPIDYSSMDQLPKQDV  351
            FN ++ D   F FGSPFN     L+  +   S D + +QDV
Sbjct  312  FNASSTDDFNFMFGSPFNMQSTDLSECLSGISHDDVKQQDV  352



>ref|NP_001233931.1| EIN3-like protein [Solanum lycopersicum]
 dbj|BAC99307.1| EIN3-like protein [Solanum lycopersicum]
Length=605

 Score =   108 bits (271),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 108/221 (49%), Gaps = 22/221 (10%)
 Frame = -3

Query  965  VKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsa  786
             +IYTCE  QCPYS  + GFQDR++R+NHQ+ C YR  S  + G+  F +N   P V   
Sbjct  395  AQIYTCEILQCPYSELRHGFQDRSARDNHQLVCPYRNTS--QFGVSKFPMNEVKPVVLPQ  452

Query  785  pkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
                + SV    + +   F     G+PEDGQRMI +LMSFYD N Q N + N+ N+    
Sbjct  453  QYIPSTSVALPVNPSPPPFDLFGVGVPEDGQRMIDDLMSFYDCNIQGNKSQNTGNVAVTK  512

Query  620  ED--HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGN  447
            E   H   ++D   +     +  G  F+D N+  +QS          Q K         N
Sbjct  513  EQQPHQQPRVDQVNYLHSRGMMEGNIFKDINVSASQS-MQPQGNLVDQCKIL-------N  564

Query  446  TCDPGEFRFGSPFNLAAPIDYSSM-----DQLPKQDVSTWY  339
            + D  +F FG PFNL +     S+     D  PKQD+  WY
Sbjct  565  SSDNLQFMFGPPFNLQSTNYPGSLPGIGCDTTPKQDIPIWY  605



>gb|AHC70432.1| ethylene insensitive 3-like protein [Cucurbita pepo subsp. pepo]
Length=599

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 111/226 (49%), Gaps = 39/226 (17%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DRTSR+NHQ+ C YR +S       NF +N   P +F
Sbjct  397  MDQKIYTCEFLQCPYSELRLGFNDRTSRDNHQLTCPYRTSS--EFSGSNFHVNEVKPVIF  454

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                          S   SSF     G+PEDGQ+ ISELMS Y+TN Q N N    N+  
Sbjct  455  PQSFAPPKPAPPPVSSVPSSFDLLSLGVPEDGQKHISELMSIYNTNIQGNKN----NVIT  510

Query  626  VVEDHNL-LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNG  450
            + E+ N  + +D +FF+       G++   ++   T+   SS E     +          
Sbjct  511  ITENQNQGIMIDANFFE-------GSSLSSSHQMFTRPMNSSFENNHQNNNNNNNF----  559

Query  449  NTCDPGEFRFGSPFNLAAPIDY--------SSMDQLPK-QDVSTWY  339
                     FGSPF+L+   DY        +++D LPK QD+  WY
Sbjct  560  ------HLMFGSPFDLST-FDYKEEVHGGAAAIDTLPKHQDIPLWY  598



>gb|AHC70433.1| ethylene insensitive 3 protein [Cucurbita pepo subsp. pepo]
Length=618

 Score =   106 bits (264),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 87/240 (36%), Positives = 121/240 (50%), Gaps = 47/240 (20%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DRTSR+NHQ++C YR +S       +F +N   P +F
Sbjct  396  MDQKIYTCEFLQCPYSELRLGFNDRTSRDNHQLSCPYRTSS--EFNGSSFHVNEVKPVIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQN-GNFNSVNLN  630
                    S     S   SSF     G+PED Q+MI ELMS YDTN Q N  N N+ N +
Sbjct  454  PQSFAPPKSAPPPVSSVPSSFDLSTLGVPEDDQKMIRELMSIYDTNIQGNQSNVNTGN-S  512

Query  629  AVVEDHNLLQLD-----DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYE  465
            A+ E+ NL QL      D++F+    +  G  F+ +N+         + +QF Q K    
Sbjct  513  AITENQNLPQLKIQPQQDEYFRNQGIMMDGNFFEGSNV---------SSSQFNQFK----  559

Query  464  SPFNG----------NTCDPGEFRFGSPFNLAAPIDY-------SSMDQLPK-QDVSTWY  339
             P N           N  +     FGSPF+L+   D+       +++D L K QD+  WY
Sbjct  560  -PMNSPFENNHHEHNNNNNNFHMMFGSPFDLST-FDFKEELPGAAAIDTLSKQQDIPLWY  617



>gb|ACP56697.1| EIN3-like protein [Lithospermum erythrorhizon]
Length=635

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 122/246 (50%), Gaps = 41/246 (17%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K+YTCE+ QCP+S    GFQDR+SR+NHQ++C YR  +    G+ +FQ+N   P  F
Sbjct  396  MDHKVYTCEFLQCPHSQLCHGFQDRSSRDNHQLSCPYR--APVEFGVSDFQLNKVKPVSF  453

Query  791  sapkpaapsvgssssvna----sSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL---  633
                     V  + S  A    S  G+PEDGQRMI+ LMSFYDTN Q N N  + N+   
Sbjct  454  PRSFVQPNPVSIAVSPPAPFDLSGLGVPEDGQRMINGLMSFYDTNIQGNKNLPASNITFN  513

Query  632  --------NAVVEDHNLLQ-------------LDDDFFKPGAPVGGGATFQDTNMPITQS  516
                    N   +  N L              L +++   G  + G   FQD+N+    S
Sbjct  514  GEQSVHQPNIHCQQVNYLPTQGATHQQTGTQGLSNNYQGQGLMIEGN-MFQDSNINANPS  572

Query  515  GFSSTETQFGQSKFQYESPFNGNTCDPG-EFRFGSPFNLAAPIDY------SSMDQLPKQ  357
             +   +  F Q K    SPF+ N  +   +  FGSPFN+A+  DY      ++ D + KQ
Sbjct  573  PYPQGD-HFDQRKV-LSSPFDNNHNNENFQLMFGSPFNMAS-GDYTEGFPGATRDNMSKQ  629

Query  356  DVSTWY  339
            D S W+
Sbjct  630  DESIWF  635



>gb|KDO66375.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66376.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66377.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=582

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 105/225 (47%), Gaps = 51/225 (23%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D  IYTCEY QCPYS+ ++G++DRTSR+NHQ+ C Y+ + A   G+             
Sbjct  395  MDQHIYTCEYLQCPYSDPRLGYRDRTSRDNHQLTCPYK-SGASEFGL-------------  440

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
                                 G+PEDGQ+MISELMS YD N Q N N N  N   V E  
Sbjct  441  ---------------------GVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQ  479

Query  611  NLL----QLDDDFFKPGAPVGGGATFQDTNM-PITQSGFSSTETQFGQSKFQYESPFN--  453
            N L    Q   +++     V  G  F+ +NM       F+  E QF + K    SPF   
Sbjct  480  NTLQPRAQHQQEYYHGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKI-MNSPFENN  538

Query  452  -GNTCDPGEFRFGSPFNLAAPIDY------SSMDQLPKQDVSTWY  339
               + +     F SPF+L +  DY      + +D +PK D S W+
Sbjct  539  SSGSNNNFSLMFESPFDLGS-FDYKEDFQAAGVDTMPKHDSSVWF  582



>ref|XP_007146083.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
 gb|ESW18077.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
Length=619

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 107/235 (46%), Gaps = 33/235 (14%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D+KIYTCE  QCPYS  ++GF DR SR+NHQ+ C YR  S    G  NF +N   P ++
Sbjct  394  MDMKIYTCEQPQCPYSQVRLGFPDRISRDNHQLICAYRGPSD--FGGPNFHVNEVKPIIY  451

Query  791  sapkpaapsvgssssvnasSFGL-----PEDGQRMISELMSFYDTNFQQNGNFNSVNL--  633
                    S   S+++      L      EDGQ+MIS+LM+ Y+TN Q N N +S N   
Sbjct  452  PQSFVQPKSTAQSANMVPPVIDLTGLEVSEDGQKMISDLMTNYETNVQGNKNISSCNRIM  511

Query  632  ---NAVVEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
               N+ +  H + Q  D+F +       G  F + NM      F+  E Q  + K    +
Sbjct  512  AAENSCLRQHGMQQPHDNFIRGQGITMEGNIFDEPNMSNNHHIFAREEGQIERFK-AMNA  570

Query  461  PFN-------------GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQ-DVSTWY  339
            PF              G+ CD   F F      A       MD + KQ D S WY
Sbjct  571  PFETNHNNNNNFNSMFGSFCDLASFDFKEDMQGA------EMDGIQKQPDFSIWY  619



>ref|XP_003543154.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN33830.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=618

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 105/233 (45%), Gaps = 31/233 (13%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D+KIYTCE+ QCPYS  ++GF DR SR+NHQ+ C YR  S    G  +F +N   P V 
Sbjct  394  MDLKIYTCEHPQCPYSQVRLGFPDRISRDNHQLICAYRGTSD--FGGPSFPVNEIKPVVH  451

Query  791  sapkpaapsvgssssvnasSFGL-----PEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S     S+      L      ++GQ+MI++LM+ YDTN + N   +S N  A
Sbjct  452  PPSFVQPKSTAQPGSMVPPVIDLTGLEVSDNGQKMITDLMTNYDTNVRGNKKTSSCNHLA  511

Query  626  V----VEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESP  459
                 +  H + Q  D+F +       G  F + NMP     F+  E QF + K    +P
Sbjct  512  AENFDLPQHAMQQQQDNFIRGQGITAEGNIFDEANMPNNHHMFAREEGQFDRFK-ALNAP  570

Query  458  FN------------GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQ-DVSTWY  339
            F             G+ CD   F F              MD L KQ D+S WY
Sbjct  571  FETNHNNNNFHSMFGSLCDLASFDFKEDMQGVG------MDTLQKQPDISIWY  617



>gb|EYU35998.1| hypothetical protein MIMGU_mgv1a003505mg [Erythranthe guttata]
Length=581

 Score = 99.8 bits (247),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 96/214 (45%), Gaps = 48/214 (22%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D +IYTCE+  CP+S  + GF+DR SR+NHQ++C +    +    + NF +N   P VF
Sbjct  413  MDHQIYTCEFLHCPHSELRHGFRDRISRDNHQLSCPFSKQLSPNFRVSNFAVNEAKPVVF  472

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
            + P  +        +      G+PEDGQRMI++LMSFYD+N Q                 
Sbjct  473  TQPAVSPAQNSFDLTG----LGVPEDGQRMINDLMSFYDSNVQ-----------------  511

Query  611  NLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTET---QFGQSKFQYESPFNGNTC  441
                              G  F++ N     +  +S       F   K   ++PFN    
Sbjct  512  ------------------GIVFEENNNNNNSNMHNSGSIFGGPFDHRKAAADAPFNAGPA  553

Query  440  DPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            +     F SPF      D  SMD LPKQDVS W+
Sbjct  554  ENFPLMFSSPF------DMPSMDNLPKQDVSIWF  581



>gb|EYU26910.1| hypothetical protein MIMGU_mgv1a026901mg [Erythranthe guttata]
Length=561

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 105/217 (48%), Gaps = 60/217 (28%)
 Frame = -3

Query  959  IYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapk  780
            +YTCE+  CP+S+++MGF DRT RNNHQ NCQ+RF SA          N++ PA      
Sbjct  396  VYTCEFVPCPHSDFRMGFSDRTWRNNHQNNCQFRFNSAP--------TNSNLPA------  441

Query  779  paapsvgssssvnasSFGLPEDGQRMISELMSFYD-----TNFQQNGNFNSVNLNAVVED  615
                       V+ S  GLPEDG+RMI+ELMSFYD      N      F+S N NA+V+ 
Sbjct  442  ----------RVDVSELGLPEDGERMINELMSFYDNNNNNNNNTNTSRFDSGNFNALVDQ  491

Query  614  HNLLQL---DDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNT  444
            +   Q    D +F + G   GG   FQ       +S F STE                  
Sbjct  492  NRPPQQIGHDGNFGEQGGLFGGRGPFQ-------ESAFPSTEI-----------------  527

Query  443  CDPGEFRFGSPFNLA-APIDYSSMDQLPKQDVSTWYL  336
               G F F SPFN   A    SSMD   +Q+VS WYL
Sbjct  528  ---GGFGFDSPFNFTQADYSSSSMDPSSRQEVSLWYL  561



>ref|XP_010694878.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Beta vulgaris 
subsp. vulgaris]
Length=705

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 126/305 (41%), Gaps = 101/305 (33%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFA-SAQRLGMQNFQINNDGPAV  795
            +D KI+ CEY QCPYS+ ++GF DR SRNNHQ+NC YRF+ S   +G  NFQ N+   A 
Sbjct  409  MDQKIFVCEYPQCPYSDSRLGFLDRNSRNNHQLNCAYRFSPSTHGVGATNFQGNSIEAAN  468

Query  794  Fsa------pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFN----  645
            F                 SS++ + S  GLPEDGQ++I+ LMS YD    QN N N    
Sbjct  469  FPTSFAQPEKLSLQSENQSSTTFSTSGLGLPEDGQKLITNLMSVYDNTLHQNKNVNLGSG  528

Query  644  --------------------------SVNLNAVVEDHN-------LLQLDDDFFKPGAPV  564
                                       +N+N  ++DHN         QLD+ F   G P+
Sbjct  529  NFAENNQIGGGFACQQGALFGNSASQGMNIN-TMKDHNQAQPKVSQFQLDNGFLGQGMPM  587

Query  563  G-------------GGATFQDTNM-------------------------PITQ------S  516
                          G + FQ TNM                          +TQ      S
Sbjct  588  NVNNNPQQKLQFQMGSSVFQGTNMNPPEQKVQLAMDTSFNGQRTVSGANVVTQGTNMSGS  647

Query  515  GFSSTETQFGQSKFQYESPF----NGNTCDPGEFRFGS-PFNLAAPIDYSSMDQLPKQDV  351
             F S   Q    +    S F    N N  D   F FG  PFNL+  ID+   DQL +QD 
Sbjct  648  VFQSNAIQLDHGRAFDSSSFGMTLNDNMSD---FGFGGVPFNLST-IDF---DQLSRQDN  700

Query  350  STWYL  336
            S W L
Sbjct  701  SIWNL  705



>ref|XP_007218956.1| hypothetical protein PRUPE_ppa003550mg [Prunus persica]
 gb|EMJ20155.1| hypothetical protein PRUPE_ppa003550mg [Prunus persica]
Length=566

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/226 (35%), Positives = 99/226 (44%), Gaps = 76/226 (34%)
 Frame = -3

Query  959  IYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapk  780
            IYTCEY QCPY +Y+  F D T+RNNHQ+NC YR  S Q                     
Sbjct  397  IYTCEYPQCPYHDYRRAFLDITARNNHQLNCAYRNNSLQ---------------------  435

Query  779  paapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLLQ  600
                            FG+                 N QQN N +  NLN VVE HN  Q
Sbjct  436  ---------------VFGI-----------------NIQQNKNSSPGNLN-VVEGHNQQQ  462

Query  599  ------LDDDFF-----------KPGA-PVGGGATFQDTN-MPITQSGFSSTETQFGQSK  477
                  ++D+FF           +P   PV  G    +T  MP+ +  F STE QF Q  
Sbjct  463  AEFRFAMNDNFFGQRVDMGRNMSEPTPMPVDMGCNISETTPMPMHRQAFPSTEVQFDQCT  522

Query  476  FQYESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
              ++SPF  N  D  + RF SP +L AP DY+ +D  PKQD S W+
Sbjct  523  I-FDSPFGDNPNDTVDLRFDSPLHL-APADYNVLDP-PKQDASFWF  565



>gb|AAL76272.1|AF467784_1 transcription factor EIL1 [Vigna radiata]
Length=609

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 6/129 (5%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY+  ++GF DR++R+NHQ+NC YR +S+   G  NF  +   P +F
Sbjct  394  MDPKIYTCEHPQCPYNEPRLGFPDRSARDNHQLNCPYRNSSSDYGGGSNFHDSEVKPVIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   +++V   SF     G+PEDGQ+MI++LM+ YDTN   N N +S N  A
Sbjct  454  PQSFVQPNTTSQAANVVQPSFAVSGLGVPEDGQKMINDLMTIYDTNIIGNNNLSSNNFVA  513

Query  626  VVEDHNLLQ  600
              E+ N  Q
Sbjct  514  -AENQNFSQ  521



>gb|AAL76271.1|AF467783_1 transcription factor EIL2 [Vigna radiata]
Length=622

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 113/230 (49%), Gaps = 23/230 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D+KIYTCE  QCPYS  Q+GF DR SR+NH++ C +R  S    G  NF +N   P ++
Sbjct  396  MDLKIYTCEQPQCPYSQVQLGFPDRISRDNHRLICAFRGPSD--FGGPNFHVNEVKPVIY  453

Query  791  sapkpaapsvgssssvnasSFGL-----PEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
            +       S   S+++  S   L      EDG++ IS+LM+ YDTN Q N N +S N  A
Sbjct  454  TQSFVPPKSTAQSANIAPSVIDLTGLEVSEDGKKRISDLMTNYDTNVQGNKNMSSCNRVA  513

Query  626  --VVE--DHNLLQLDDDFFKPGAPVG-GGATFQDTNMPITQSGFSSTETQFGQSKFQYES  462
              V+    H + Q   D F  G  +   G  F +  M      F+  E QF + K    S
Sbjct  514  GEVLNFPQHGMQQHQQDNFIRGRGITMEGNVFDEATMSNNHHTFARDECQFDRFK-ALNS  572

Query  461  PFNGNTCDPGEFR--FGSPFNLAAPIDYSS------MDQLPKQ-DVSTWY  339
            PF  N  +   F   FGS  +LA+  D+        MD L KQ D S WY
Sbjct  573  PFETNHNNNNNFHSMFGSFCDLAS-FDFKEDMQGVGMDALQKQTDFSVWY  621



>gb|ABG89103.1| ethylene insensitive-like protein 4 [Musa acuminata]
Length=635

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 112/226 (50%), Gaps = 27/226 (12%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGM--QNFQINNDGPAVFs  789
            ++YTC+ ++CP+ +++ GF DR +RN HQ  C+Y+    Q L M   NFQ+N   P V  
Sbjct  418  RVYTCDNAKCPHHDFRQGFTDRNARNRHQYLCKYQNTFPQSLTMLSDNFQVNESKPPVVP  477

Query  788  apkpaapsvgssssv----nasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
                A P+     S     + S  G+P DGQ+ I+ELM FYD N   N N  ++   +V+
Sbjct  478  MSSNAQPNATRLGSSLNPVHVSDLGIPSDGQKSINELMGFYDNNVNGNKNL-TLGSVSVL  536

Query  620  EDHNLL----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQ--FGQSKFQYESP  459
            E  N L    Q++D+FF+      GG+ F+     + Q  F   E    FGQ      + 
Sbjct  537  EGSNSLQSRIQMEDNFFRQETGT-GGSLFEQVGSLVQQPQFFLREDMMPFGQQISNQPNE  595

Query  458  FNGNTCDPGEFRFGSPFNLAAPIDYSSMDQ------LPKQDVSTWY  339
             +G       FRF S  N+ A +DYS + Q      L K D S+W+
Sbjct  596  LSGG------FRFRSGLNIPA-MDYSDVSQRGMGGSLQKHDGSSWF  634



>ref|XP_007141570.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
 gb|ESW13564.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
Length=611

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 75/129 (58%), Gaps = 6/129 (5%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY+  ++GF DR++R+NHQ+NC  R  +A   G  NF      P +F
Sbjct  394  MDPKIYTCEHPQCPYNEPRLGFTDRSARDNHQLNCACRNRAADYGGGSNFHDAEVKPVIF  453

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   ++SV   SF     G+PEDGQ+MI++LM+ YDTN   N N +S N   
Sbjct  454  PHSFVQPSTTSQAASVVQPSFSVSGLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNNF-V  512

Query  626  VVEDHNLLQ  600
              E+HN  Q
Sbjct  513  PAENHNFSQ  521



>ref|XP_009404687.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=635

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 117/228 (51%), Gaps = 31/228 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGM--QNFQINNDGPAVFs  789
            ++YTC+ ++CP+ +++ GF DR +RN HQ  C+Y+    Q L M   NFQ+N   P V  
Sbjct  418  RVYTCDNAKCPHHDFRQGFTDRNARNRHQYLCKYQNTFPQSLTMLSDNFQVNESKPPVVP  477

Query  788  apkpaapsvgssssv----nasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN--A  627
                A P+     S     + S  G+P DGQ+ I+ELM FYD N   NGN  S+ L   +
Sbjct  478  MSSNAQPNATRLGSSLNPVHVSDLGIPSDGQKSINELMGFYDNNV--NGN-KSLTLGSVS  534

Query  626  VVEDHNLL----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQ--FGQSKFQYE  465
            V+E  N L    Q++D+FF+      GG+ F+     + Q  F   E    FGQ   Q+ 
Sbjct  535  VLEGSNSLQSRIQMEDNFFRQETGT-GGSLFEQVGSLVQQPQFFLREDMMPFGQ---QFS  590

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQ------LPKQDVSTWY  339
            +  N  +   G FRF S  N+ A +DYS + Q      L K D S+W+
Sbjct  591  NQPNELS---GGFRFRSGLNIPA-MDYSDVSQRGMGGSLQKHDGSSWF  634



>ref|XP_010544311.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010544312.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=632

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 79/243 (33%), Positives = 124/243 (51%), Gaps = 42/243 (17%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF---  792
            +I+TC+  QCP+S   +GFQDR +R+NHQ+ C YR  S    G   FQ+    PAV    
Sbjct  397  RIFTCQSPQCPHSAINLGFQDRGTRDNHQLVCPYR-DSCLAYGASKFQVGEVKPAVALQP  455

Query  791  --sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
               +   A P   ++  ++ +  G+PEDGQ+MI+ELM  YD N Q N        +++VE
Sbjct  456  CTQSRPVAMPMNSAAQPIDLTGLGVPEDGQKMITELMDMYDRNVQNN------QASSMVE  509

Query  617  DHNLL--------QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQF--GQSKFQY  468
            + +++        Q  + F      +  G+ F+D N P + +  +S+   +  G S+F++
Sbjct  510  NESMMLQPKAQNHQEQNQFGNRDGNMVEGSFFEDLNFPNSCNNNNSSSQMYMQGNSEFKF  569

Query  467  -ESPF---------NGNTCDPGEFRFGS-PFNLAAPIDYSSMDQL------PK---QDVS  348
              SPF         NG++  P EF F S PF+LA+  D + M  +      PK   +DVS
Sbjct  570  MSSPFAATQNSDDNNGSSNSPLEFVFDSTPFDLASFDDRNDMQAVGMEGMPPKRQERDVS  629

Query  347  TWY  339
             W+
Sbjct  630  IWF  632



>ref|XP_007146084.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
 gb|ESW18078.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
Length=624

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 105/236 (44%), Gaps = 33/236 (14%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D+K YTCE  QCPYS  Q+GF DR SR+NH++ C +R  S    G  NF +N   P ++
Sbjct  396  MDLKNYTCEQPQCPYSQVQLGFPDRISRDNHRLICAFRGPSD--FGGPNFHVNEVKPVIY  453

Query  791  sap------kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
                       A  +      ++ +   + EDG++ IS+LMS YDTN Q N    S + N
Sbjct  454  PHSFVQPKPTTAQSANMVPPVIDLTGLEVSEDGKKRISDLMSNYDTNVQGNSKNISSSCN  513

Query  629  AVVED------HNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY  468
             V  +      H + Q  D+F +       G  F +  M      F+  E QF + K   
Sbjct  514  RVAAEVLNLTQHGMQQQHDNFIRSRGNTMEGNVFDEATMSNNHHTFARDECQFDRFK-AL  572

Query  467  ESPFN------------GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQ-DVSTWY  339
             +PF             G+ CD   F F    ++   I    MD + KQ D S WY
Sbjct  573  NTPFETNHNNSNFHSMFGSFCDLASFDFKE--DMQGVI---GMDVVQKQPDFSVWY  623



>ref|XP_008375510.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Malus domestica]
Length=581

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 85/145 (59%), Gaps = 13/145 (9%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG-----PA  798
            +IYTCEY  CPY +Y++GF D T+RNNHQ+ C +R  S+Q  GM NF  N+       PA
Sbjct  362  QIYTCEYLHCPYHDYRLGFLDITARNNHQLTCSHRNNSSQVFGMSNFNCNSXKLGGSLPA  421

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
                       V  +S +NAS  G+  DGQ+MI E +SFYD+N QQ+ N +  +LN  +E
Sbjct  422  S-QPIPAIQQXVNQTSCLNASGHGVAGDGQKMIXEHVSFYDSNIQQSKNSDPGSLNG-IE  479

Query  617  DHNLLQ------LDDDFFKPGAPVG  561
            D+N  Q      ++D+FF  G  +G
Sbjct  480  DNNQHQVNYQFPMNDNFFDQGVVMG  504



>ref|XP_003617086.1| Ethylene insensitive 3-like protein [Medicago truncatula]
 gb|AET00045.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=615

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 110/236 (47%), Gaps = 43/236 (18%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRL-GMQNFQINNDGPAV  795
            ++ K+YTCE+ QC YS  ++ FQDR SR+NHQ+NC +R  +   + G  NF      P +
Sbjct  395  MEPKMYTCEHPQCAYSEARLAFQDRPSRDNHQLNCPHRNRNNPAVYGDPNFHATEVKPVI  454

Query  794  Fsapkpaapsvgssssvn-----asSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
            F        S    +S+       + FG+ EDGQ+MIS+LMS YDT+   N N +S N  
Sbjct  455  FPQSFVQPNSTVQPASLVPPSFDLTGFGVSEDGQKMISDLMSGYDTHVIGNNNASSTNC-  513

Query  629  AVVEDHNL------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY  468
             V+E+ NL       Q  D+F            F +  M +  + F+  E QF + K   
Sbjct  514  VVIENQNLSQPIIQQQQQDNF------------FLNQGMVMEANFFTREENQFDRFK-AM  560

Query  467  ESPFN-------------GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQ-DVSTW  342
             SPF              G++CD   F F     L   +    MD L KQ DVS W
Sbjct  561  NSPFEANLNNNNNMHPMYGSSCDLASFDFKEDLQLQGGV---GMDALYKQPDVSIW  613



>gb|ACJ85584.1| unknown [Medicago truncatula]
 gb|AFK35026.1| unknown [Medicago truncatula]
Length=615

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 110/236 (47%), Gaps = 43/236 (18%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRL-GMQNFQINNDGPAV  795
            ++ K+YTCE+ QC YS  ++ FQDR SR+NHQ+NC +R  +   + G  NF      P +
Sbjct  395  MEPKMYTCEHPQCAYSEARLAFQDRPSRDNHQLNCPHRNRNNPAVYGDPNFHATEVKPVI  454

Query  794  Fsapkpaapsvgssssvn-----asSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
            F        S    +S+       + FG+ EDGQ+MIS+LMS YDT+   N N +S N  
Sbjct  455  FPQSFVQPNSTVQPASLVPPSFDLTGFGVSEDGQKMISDLMSGYDTHVIGNNNASSTNC-  513

Query  629  AVVEDHNL------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY  468
             V+E+ NL       Q  D+F            F +  M +  + F+  E QF + K   
Sbjct  514  VVIENQNLSQPIIQQQQQDNF------------FLNQGMVMEANFFTREENQFDRFK-AM  560

Query  467  ESPFN-------------GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQ-DVSTW  342
             SPF              G++CD   F F     L   +    MD L KQ DVS W
Sbjct  561  NSPFEANLNNNNNMHPMYGSSCDLASFDFKEDLQLQGGV---GMDALYKQPDVSIW  613



>ref|XP_009339243.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009339252.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X1 [Pyrus 
x bretschneideri]
Length=923

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 7/131 (5%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG-----PA  798
            +IYTC+Y  CPY +Y++GF D T+RNNHQ+ C +R  S+Q  GM +F  N+D      PA
Sbjct  386  QIYTCKYQHCPYHDYRLGFLDITARNNHQLTCSHRNNSSQVFGMSHFNWNSDKLGGSLPA  445

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
                       V  +S +NAS  G+  DGQ+MISE +SFYD+N QQ+ N +  +LN  +E
Sbjct  446  S-QPIPAIQQPVNQTSCLNASGHGVAGDGQKMISEHVSFYDSNIQQSKNSDPGSLNG-IE  503

Query  617  DHNLLQLDDDF  585
            D+N  Q++  F
Sbjct  504  DNNQHQVNYQF  514



>ref|XP_009339244.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009339253.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X2 [Pyrus 
x bretschneideri]
Length=892

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 7/131 (5%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG-----PA  798
            +IYTC+Y  CPY +Y++GF D T+RNNHQ+ C +R  S+Q  GM +F  N+D      PA
Sbjct  386  QIYTCKYQHCPYHDYRLGFLDITARNNHQLTCSHRNNSSQVFGMSHFNWNSDKLGGSLPA  445

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
                       V  +S +NAS  G+  DGQ+MISE +SFYD+N QQ+ N +  +LN  +E
Sbjct  446  S-QPIPAIQQPVNQTSCLNASGHGVAGDGQKMISEHVSFYDSNIQQSKNSDPGSLNG-IE  503

Query  617  DHNLLQLDDDF  585
            D+N  Q++  F
Sbjct  504  DNNQHQVNYQF  514



>gb|ACD87815.1| putative ethylene insensitive transcription factor [Vicia faba]
Length=638

 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 113/259 (44%), Gaps = 63/259 (24%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS+ ++ FQDR SR+NHQ+NC +R  SA   G  NF      P +F
Sbjct  394  MDHKIYTCEHPQCPYSDVRLAFQDRPSRDNHQLNCPHRIGSAD-YGGPNFHATEVKPVIF  452

Query  791  sapkpaapsvgssssvna--------------------sSFGLPEDGQRMISELMSFYDT  672
                    S    +S+ +                    +  G+ ED Q+MIS+LMS YDT
Sbjct  453  PQSFVQPNSAAQPASLQSFVQPNSAAQPTSLVPPSFDLTGLGVSEDSQKMISDLMSVYDT  512

Query  671  NFQQNGNFNSVNLNAVVEDHNL--------------LQLDDDFFKPGAPVGGGATFQDTN  534
            N   N N +S N  A V + NL               Q  ++FF     V   A F    
Sbjct  513  NIIGNKNASSTNC-ATVGNQNLSQHNIQQQQQHTIQQQQQENFFSSQGMVMEAANF----  567

Query  533  MPITQSGFSSTETQFGQSKFQYESPFNGN---TCDPGEFRFGSPFNLAAPIDYSS-----  378
                   F+  E+QF + K    +PF  N     +   F  GSP +LA+  D+       
Sbjct  568  -------FTREESQFDRFK-AVTTPFETNHPNNNNNLHFMIGSPCDLAS-FDFREDIQQL  618

Query  377  -----MDQLPKQ-DVSTWY  339
                 M+ L KQ D  TWY
Sbjct  619  QGVVGMENLHKQPDGPTWY  637



>gb|ABG89102.1| ethylene insensitive-like protein 3 [Musa acuminata]
Length=517

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 116/227 (51%), Gaps = 29/227 (13%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLG---MQNFQINNDGPAVF  792
            +IYTC+ ++CP+ ++  GF DR +RN+HQ  C+Y+    Q +G    +NF +N + P V 
Sbjct  300  RIYTCDNAKCPHHDFCHGFTDRNARNSHQYLCKYQNTFPQSIGALSAENFPVNENKPPVL  359

Query  791  sapkpaapsvgssssv----nasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
            S    A P+  S        + S  G+P DGQ+ I+ELM FYD N   + +  ++   +V
Sbjct  360  SMSSTAQPTPTSLGPSLNPISVSDLGIPSDGQKSINELMGFYDNNISGDKSL-TLGSASV  418

Query  623  VEDHN----LLQLDDDFFKPGAPVG-GGATFQDTNMPITQSGFSSTE--TQFGQSKFQYE  465
            +E  N     +Q++D FF  G   G GG+ F++    + Q  F   E    FGQ   Q+ 
Sbjct  419  LEGSNSFQSRIQMEDTFF--GQETGMGGSLFEEVGSLVQQPQFFVREDMMPFGQ---QFS  473

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQ-----LPKQDVSTWY  339
            +  N ++   G FRF S  N+ A +DYS+          K D S W+
Sbjct  474  NQPNESS---GGFRFTSGLNIPA-VDYSNAASQRGMLQKKHDGSNWF  516



>ref|XP_009341360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=659

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 12/138 (9%)
 Frame = -3

Query  731  FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGA  570
             G+ EDGQ+MISELMSFYD N QQN N N  NLN  V+D N  Q      ++D+ +  G 
Sbjct  526  LGIAEDGQKMISELMSFYDGNIQQNKNCNPGNLND-VDDRNQQQANFQFPMNDNLYGQGP  584

Query  569  PVGGGATFQD-TNMPITQSGFSSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAP  393
             +G      + + MP+    FSS E QF Q    ++SPF  N+ +  + RFGSP +L AP
Sbjct  585  DIGHNMNMSEQSPMPMLHPDFSSPEIQFDQL-MAFDSPFGNNSNEDVDIRFGSPLHL-AP  642

Query  392  IDYSSMDQLPKQDVSTWY  339
            + Y+ MD    QD   W+
Sbjct  643  VGYNVMDPPLSQD--PWF  658


 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K YTCEY QCPY +Y++GF D T+RNNHQ+NC YR  S+Q LGM +FQI+N+ P  F
Sbjct  389  LDQKYYTCEYLQCPYHDYRLGFLDITARNNHQLNCPYRNNSSQVLGMSSFQIHNEKPVGF  448



>ref|XP_009420955.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=637

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 116/227 (51%), Gaps = 29/227 (13%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLG---MQNFQINNDGPAVF  792
            +IYTC+ ++CP+ ++  GF DR +RN+HQ  C+Y+    Q +G    +NF +N + P V 
Sbjct  420  RIYTCDNAKCPHHDFCHGFTDRNARNSHQYLCKYQNTFPQSIGALSAENFPVNENKPPVL  479

Query  791  sapkpaapsvgssssv----nasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
            S    A P+  S        + S  G+P DGQ+ I+ELM FYD N   + +  ++   +V
Sbjct  480  SMSSTAQPTPTSLGPSLNPISVSDLGIPSDGQKSINELMGFYDNNISGDKSL-TLGSASV  538

Query  623  VEDHN----LLQLDDDFFKPGAPVG-GGATFQDTNMPITQSGFSSTETQ--FGQSKFQYE  465
            +E  N     +Q++D FF  G   G GG+ F++    + Q  F   E    FGQ   Q+ 
Sbjct  539  LEGSNSFQSRIQMEDTFF--GQETGMGGSLFEEVGSLVQQPQFFVREDMMPFGQ---QFS  593

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQ-----LPKQDVSTWY  339
            +  N ++   G FRF S  N+ A +DYS+          K D S W+
Sbjct  594  NQPNESS---GGFRFTSGLNIPA-VDYSNAASQRGMLQKKHDGSNWF  636



>gb|AGV54673.1| ethylene insensitive protein 3 [Phaseolus vulgaris]
Length=609

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY+  ++GF DR++R+NHQ+NC  R  +A   G  NF      P +F
Sbjct  393  MDPKIYTCEHPQCPYNEPRLGFTDRSARDNHQLNCACRNRAADYGGGSNFHDAEVKPVIF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   ++SV   SF     G+PEDGQ+MI++LM+ YDTN   N N +S +   
Sbjct  453  PHSFVQPSTTSQAASVVQPSFSVSGLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNSNFV  512

Query  626  VVEDHNLLQ  600
              E+HN  Q
Sbjct  513  PAENHNFSQ  521



>gb|AGV54306.1| transcription factor EIL1 [Phaseolus vulgaris]
Length=610

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPY+  ++GF DR++R+NHQ+NC  R  +A   G  NF      P +F
Sbjct  393  MDPKIYTCEHPQCPYNEPRLGFTDRSARDNHQLNCACRNRAADYGGGSNFHDAEVKPVIF  452

Query  791  sapkpaapsvgssssvnasSF-----GLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    +   ++SV   SF     G+PEDGQ+MI++LM+ YDTN   N N +S +   
Sbjct  453  PHSFVQPSTTSQAASVVQPSFSVSGLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNSNFV  512

Query  626  VVEDHNLLQ  600
              E+HN  Q
Sbjct  513  PAENHNFSQ  521



>gb|AAK67355.1|AF387795_1 transcription factor [Cucumis melo]
Length=621

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 112/235 (48%), Gaps = 35/235 (15%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KIYTCE+ QCPYS  ++GF DRTSR+NHQ+ C YR +S       +F +N   P +F
Sbjct  394  MDQKIYTCEFLQCPYSELRLGFNDRTSRDNHQLTCPYRTSS--EFSGSSFHVNEVKPVIF  451

Query  791  sapkpaapsvgssssvnasSFGL-----PEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
                    S      +++  F       PEDGQ++ISEL+  YDTN Q N N  +   +A
Sbjct  452  PQSFAPPKSNAPPGQLSSVIFPTLFHLSPEDGQKLISELI--YDTNIQGNKNNLNTGNSA  509

Query  626  VVEDH--------NLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQ  471
              E+         NL ++ D  F+    +  G  F  +N+  +   F+  E Q  + K  
Sbjct  510  TTENQKSPSIKRSNLNKMID--FRDQGLMMEGNFFDGSNVSSSHQMFTRDEGQSDRFK-P  566

Query  470  YESPFNGNTCDPG------EFRFGSPFNLAAPIDY-------SSMDQLPK-QDVS  348
              SPF  N              F SPF+L+   DY       +++D L K QDVS
Sbjct  567  MNSPFENNHHHHNNNNNNFHLMFSSPFDLST-FDYKEEVPGVAAIDTLSKQQDVS  620



>ref|XP_010557480.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=609

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 117/229 (51%), Gaps = 30/229 (13%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV-  795
            +D +I+ CE  QCP+S   + FQDRTSR+NHQ+ C YR  S+   G   F +    P V 
Sbjct  393  LDRRIFICENLQCPHSQNNLAFQDRTSRDNHQLVCPYR-GSSIAYGASKFHVGEAKPVVA  451

Query  794  ---FsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSV----N  636
               F+ P+PA P+V S    + S FG+PEDGQ+MISELMS YD N Q +    S+    N
Sbjct  452  TQPFTQPRPAVPAVNSVRPYDLSGFGVPEDGQKMISELMSMYDRNVQSSNQTASMVDNEN  511

Query  635  LNAVVEDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPF  456
            +N  ++  N  Q        G  +  G+ F+D ++P       +T    G++ F      
Sbjct  512  INFQLKPQNHHQQQHFNHGEGRTI-EGSFFEDLHIP----NKDNTSNNNGKNMF-----L  561

Query  455  NGNTCDPG-EFRFGS-PFNLAAPIDYS--------SMDQLPKQDVSTWY  339
             GN+   G +  F S PF+LA+  DY          M +  +Q+VS W+
Sbjct  562  QGNSNSGGVKLVFESMPFDLAS-FDYRDDLQAGIDGMRKQQQQEVSIWF  609



>gb|AGI41323.1| EIN3-like protein [Malus domestica]
Length=659

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 12/138 (9%)
 Frame = -3

Query  731  FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGA  570
             G+ EDGQ+MISELMSFYD+N QQN N N  NLN  V+D N  Q      ++D+ +  G 
Sbjct  526  LGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLND-VDDCNQQQANFQFPMNDNLYGQGL  584

Query  569  PVGGGATFQDTN-MPITQSGFSSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAP  393
             +G      + + MP+    FSS E QF Q    ++SPF  N+ +  + RFGSP +L +P
Sbjct  585  DIGRNMNMSEQSPMPMLHPDFSSPEVQFDQL-MAFDSPFGNNSNEDVDIRFGSPLHL-SP  642

Query  392  IDYSSMDQLPKQDVSTWY  339
            + Y+ MD    QD   W+
Sbjct  643  VGYNVMDPPLNQD--PWF  658


 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            ++ K YTCEY QCPY +Y++GF D T+RNNHQ+NC YR  S+Q LGM +FQ++N+ P  F
Sbjct  389  LEQKYYTCEYLQCPYHDYRLGFLDITARNNHQLNCPYRNNSSQVLGMSSFQLHNEKPVDF  448



>gb|ADE41153.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=659

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 12/138 (9%)
 Frame = -3

Query  731  FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGA  570
             G+ EDGQ+MISELMSFYD+N QQN N N  NLN  V+D N  Q      ++D+ +  G 
Sbjct  526  LGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLND-VDDCNQQQANFQFPMNDNLYGQGL  584

Query  569  PVGGGATFQDTN-MPITQSGFSSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAP  393
             +G      + + MP+    FSS E QF Q    ++SPF  N+ +  + RFGSP +L +P
Sbjct  585  DIGRNMNMSEQSPMPMLHPDFSSPEVQFDQL-MAFDSPFGNNSNEDVDIRFGSPLHL-SP  642

Query  392  IDYSSMDQLPKQDVSTWY  339
            + Y+ MD    QD   W+
Sbjct  643  VGYNVMDPPLNQD--PWF  658


 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K Y CEY QCPY +Y++GF D T+RNNHQ+NC YR  S+Q LGM +FQ++N+ P  F
Sbjct  389  LDQKYYACEYLQCPYHDYRLGFLDITARNNHQLNCPYRNNSSQVLGMSSFQLHNEKPVDF  448



>ref|XP_010544313.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=615

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 5/109 (5%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV-  795
            +D +I+ CE  QCP+S   M F DRTSR+NHQ+ C +R +S    G   F ++   P V 
Sbjct  394  LDRRIFNCENRQCPHSQMNMAFHDRTSRDNHQLVCPFRDSSIS-YGASEFHVSEVKPVVI  452

Query  794  ---FsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN  657
               F+ P+PAAP++      + S FG+PEDGQ+MI+ELMS YD NFQ N
Sbjct  453  PQHFTHPRPAAPAMNPVQPFDLSGFGVPEDGQKMITELMSMYDRNFQGN  501



>gb|AEB37086.1| EIN3, partial [Helianthus tuberosus]
Length=310

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 95/221 (43%), Gaps = 69/221 (31%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  125  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  184

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  185  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  212

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  213  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  264

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS  381
            T  QF  +K  Y  PF+ +      F   SPFNL   +D+S
Sbjct  265  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNLGG-VDFS  303



>gb|AEB37127.1| EIN3, partial [Helianthus annuus]
 gb|AEB37128.1| EIN3, partial [Helianthus annuus]
Length=310

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 95/221 (43%), Gaps = 69/221 (31%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  125  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  184

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  185  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIT  212

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  213  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  264

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS  381
            T  QF  +K  Y  PF+ +      F   SPFNL   +D+S
Sbjct  265  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNLGG-VDFS  303



>ref|XP_002467935.1| hypothetical protein SORBIDRAFT_01g036740 [Sorghum bicolor]
 gb|EER94933.1| hypothetical protein SORBIDRAFT_01g036740 [Sorghum bicolor]
Length=643

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 106/218 (49%), Gaps = 23/218 (11%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y     Q         N   PA   + 
Sbjct  438  RVYTCNNVQCPHSDYSYGFLDRNTRNSHQYTCKYNEPIPQSTE------NKPPPAPPQSQ  491

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNL-  606
                     + S+N   F LP DGQR I+ELM+ YD NF  N N +S ++  +   + + 
Sbjct  492  AFQPAFNQPNQSLNNLDFSLPMDGQRSIAELMNMYDNNFMTNKNMSSDSVTIMERPNAMP  551

Query  605  --LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY----ESPF---N  453
              +Q+D+ FF       G   F D N  + Q   +  + Q  Q + Q+    ++PF    
Sbjct  552  QRIQMDEGFFG-----QGNGVFDDVNSMMQQQQQAPVQQQQQQQQQQFFIRDDTPFVSQM  606

Query  452  GNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            G+     EFRFGS FN+++ +DY    Q  K D + W+
Sbjct  607  GDITSTSEFRFGSGFNMSSTVDYPGAAQ--KNDGTNWF  642



>gb|AEB37094.1| EIN3, partial [Helianthus annuus]
 gb|AEB37095.1| EIN3, partial [Helianthus annuus]
Length=307

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 95/221 (43%), Gaps = 69/221 (31%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  126  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  185

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  186  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  213

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  214  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  265

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS  381
            T  QF  +K  Y  PF+ +      F   SPFNL   +D+S
Sbjct  266  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNLGG-VDFS  304



>gb|AEB37161.1| EIN3, partial [Helianthus annuus]
Length=306

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 95/221 (43%), Gaps = 69/221 (31%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  121  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  180

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  181  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  208

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  209  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  260

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS  381
            T  QF  +K  Y  PF+ +      F   SPFNL   +D+S
Sbjct  261  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNLGG-VDFS  299



>gb|AEB37114.1| EIN3, partial [Helianthus annuus]
 gb|AEB37116.1| EIN3, partial [Helianthus annuus]
 gb|AEB37117.1| EIN3, partial [Helianthus annuus]
 gb|AEB37122.1| EIN3, partial [Helianthus annuus]
 gb|AEB37123.1| EIN3, partial [Helianthus annuus]
 gb|AEB37129.1| EIN3, partial [Helianthus annuus]
 gb|AEB37130.1| EIN3, partial [Helianthus annuus]
 gb|AEB37142.1| EIN3, partial [Helianthus annuus]
 gb|AEB37143.1| EIN3, partial [Helianthus annuus]
 gb|AEB37144.1| EIN3, partial [Helianthus annuus]
 gb|AEB37145.1| EIN3, partial [Helianthus annuus]
Length=310

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 95/221 (43%), Gaps = 69/221 (31%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  125  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  184

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  185  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  212

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  213  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  264

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS  381
            T  QF  +K  Y  PF+ +      F   SPFNL   +D+S
Sbjct  265  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNLGG-VDFS  303



>gb|AEB37115.1| EIN3, partial [Helianthus annuus]
Length=310

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 98/224 (44%), Gaps = 75/224 (33%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  125  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  184

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  185  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  212

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  213  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  264

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS--PFNLAAPIDYS  381
            T  QF  +K  Y  PF+  N  D   FRF S  PFNL   +D+S
Sbjct  265  TGFQFD-NKAPYTPPFDAHNNLD---FRFVSQFPFNLGG-VDFS  303



>ref|XP_006650014.1| PREDICTED: LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 1 
protein-like [Oryza brachyantha]
Length=639

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 102/224 (46%), Gaps = 35/224 (16%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y          Q+ +     PA+F   
Sbjct  434  RVYTCNNVQCPHSDYGYGFLDRNARNSHQYTCKYNDPL-----QQSTENKPSPPAIF---  485

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNL-  606
               A     + ++N   FGLP DGQR I+ELM+ YD+NF  N +  S +   ++E  N  
Sbjct  486  --PATYNTPNQALNNLDFGLPVDGQRSITELMNMYDSNFVANKSL-SNDSATIMERPNAA  542

Query  605  ---LQLDDDFF--KPGAPVGGGATFQDTNMPITQSG---------FSSTETQFGQSKFQY  468
               +Q+DD FF          G  F D N  + Q           F   +T FG      
Sbjct  543  NPRMQMDDGFFGQGSAIGGSSGGVFDDVNGMMQQQQQTTPVQQQFFIRDDTAFGNQM---  599

Query  467  ESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQ-LPKQDVSTWY  339
                 G      EFRFGS FN++  +DY    Q   K D S WY
Sbjct  600  -----GEISGASEFRFGSGFNMSGAVDYPGAVQGQQKNDGSNWY  638



>gb|AEB37153.1| EIN3, partial [Helianthus annuus]
Length=310

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 95/221 (43%), Gaps = 69/221 (31%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  125  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  184

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  185  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIX  212

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  213  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  264

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS  381
            T  QF  +K  Y  PF+ +      F   SPFNL   +D+S
Sbjct  265  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNLGG-VDFS  303



>gb|AEB37087.1| EIN3, partial [Helianthus tuberosus]
Length=287

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  286



>gb|AEB37162.1| EIN3, partial [Helianthus annuus]
Length=291

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVIXDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AEB37085.1| EIN3, partial [Helianthus tuberosus]
Length=293

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  118  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  177

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  178  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  205

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  206  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  257

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  258  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  290



>gb|AEB37150.1| EIN3, partial [Helianthus annuus]
Length=289

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AEB37159.1| EIN3, partial [Helianthus annuus]
 gb|AEB37166.1| EIN3, partial [Helianthus annuus]
Length=291

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>dbj|BAF44108.1| ethylene signal transcription factor [Musa acuminata AAA Group]
Length=637

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 115/227 (51%), Gaps = 29/227 (13%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLG---MQNFQINNDGPAVF  792
            +IYTC+ ++CP+ ++  GF DR +RN+HQ  C+Y+    Q +G    +NF +N + P   
Sbjct  420  RIYTCDNAKCPHHDFCHGFTDRNARNSHQYLCKYQDTFPQSIGALSAENFPVNENKPXFL  479

Query  791  sapkpaapsvgssssv----nasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAV  624
            S    A P+  S        + S  G+P DGQ+ I+ELM FYD N   + +  ++   +V
Sbjct  480  SMSSTAQPTPTSLGPSLNPISVSDLGIPSDGQKSINELMGFYDNNISGDKSL-TLGSASV  538

Query  623  VEDHN----LLQLDDDFFKPGAPVG-GGATFQDTNMPITQSGFSSTETQ--FGQSKFQYE  465
            +E  N     +Q++D FF  G   G GG+ F++    + Q  F   E    FGQ   Q+ 
Sbjct  539  LEGSNSFQSRIQMEDTFF--GQETGMGGSLFEEVGSLVQQPQFFVREDMMPFGQ---QFS  593

Query  464  SPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQ-----LPKQDVSTWY  339
            +  N ++   G FRF S  N+ A +DYS+          K D S W+
Sbjct  594  NQPNESS---GGFRFTSGLNIPA-VDYSNAASQRGMLQKKHDGSNWF  636



>gb|AEB37063.1| EIN3, partial [Helianthus petiolaris]
Length=288

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  286



>gb|AEB37106.1| EIN3, partial [Helianthus annuus]
 gb|AEB37107.1| EIN3, partial [Helianthus annuus]
 gb|AEB37124.1| EIN3, partial [Helianthus annuus]
 gb|AEB37133.1| EIN3, partial [Helianthus annuus]
 gb|AEB37134.1| EIN3, partial [Helianthus annuus]
 gb|AEB37141.1| EIN3, partial [Helianthus annuus]
Length=287

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  286



>ref|XP_010521603.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Tarenaya 
hassleriana]
Length=665

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = -3

Query  974  HVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV  795
             +D +++ CE   CP+S   + F DRTSR+NHQ+ C YR +S     M  F +    P  
Sbjct  415  RLDRRVFNCENRHCPHSQINLAFLDRTSRDNHQLVCPYRESSIAYGAMAKFHVGEVKPQP  474

Query  794  FsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVED  615
                   A    +    + S  G+PEDGQ+MI+ELMS YD N Q N    S     +VE+
Sbjct  475  SQPRPAVATVNSAVRPFDLSGVGVPEDGQKMITELMSIYDRNVQSNHQTAS-----MVEN  529

Query  614  HNLLQL  597
             N+  L
Sbjct  530  QNITTL  535



>gb|AEB37151.1| EIN3, partial [Helianthus annuus]
Length=291

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  117  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  176

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  177  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  204

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  205  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  256

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  257  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  289



>gb|AEB37158.1| EIN3, partial [Helianthus annuus]
Length=294

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  119  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  178

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  179  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  206

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  207  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  258

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  259  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  291



>gb|AEB37082.1| EIN3, partial [Helianthus exilis]
Length=293

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  117  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  176

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  177  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  204

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  205  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  256

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  257  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  289



>gb|AEB37125.1| EIN3, partial [Helianthus annuus]
Length=289

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AEB37108.1| EIN3, partial [Helianthus annuus]
 gb|AEB37109.1| EIN3, partial [Helianthus annuus]
 gb|AEB37110.1| EIN3, partial [Helianthus annuus]
 gb|AEB37111.1| EIN3, partial [Helianthus annuus]
 gb|AEB37120.1| EIN3, partial [Helianthus annuus]
 gb|AEB37121.1| EIN3, partial [Helianthus annuus]
 gb|AEB37148.1| EIN3, partial [Helianthus annuus]
 gb|AEB37149.1| EIN3, partial [Helianthus annuus]
 gb|AEB37163.1| EIN3, partial [Helianthus annuus]
Length=291

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AEB37077.1| EIN3, partial [Helianthus exilis]
 gb|AEB37078.1| EIN3, partial [Helianthus exilis]
Length=296

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  119  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  178

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  179  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  206

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  207  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  258

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  259  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  291



>gb|AEB37084.1| EIN3, partial [Helianthus tuberosus]
Length=289

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 90/214 (42%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFN 
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNJ  287



>gb|AEB37060.1| EIN3, partial [Helianthus petiolaris]
Length=291

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AEB37131.1| EIN3, partial [Helianthus annuus]
 gb|AEB37132.1| EIN3, partial [Helianthus annuus]
Length=288

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  287



>gb|AEB37152.1| EIN3, partial [Helianthus annuus]
Length=300

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  125  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  184

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  185  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  212

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  213  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  264

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  265  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  297



>ref|XP_010521602.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Tarenaya 
hassleriana]
Length=692

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = -3

Query  974  HVDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV  795
             +D +++ CE   CP+S   + F DRTSR+NHQ+ C YR +S     M  F +    P  
Sbjct  442  RLDRRVFNCENRHCPHSQINLAFLDRTSRDNHQLVCPYRESSIAYGAMAKFHVGEVKPQP  501

Query  794  FsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVED  615
                   A    +    + S  G+PEDGQ+MI+ELMS YD N Q N    S     +VE+
Sbjct  502  SQPRPAVATVNSAVRPFDLSGVGVPEDGQKMITELMSIYDRNVQSNHQTAS-----MVEN  556

Query  614  HNLLQL  597
             N+  L
Sbjct  557  QNITTL  562



>gb|AEB37118.1| EIN3, partial [Helianthus annuus]
 gb|AEB37119.1| EIN3, partial [Helianthus annuus]
Length=295

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  118  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  177

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  178  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  205

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  206  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  257

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  258  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  290



>gb|AEB37164.1| EIN3, partial [Helianthus annuus]
Length=294

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  117  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  176

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  177  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  204

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  205  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  256

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  257  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  289



>gb|AEB37064.1| EIN3, partial [Helianthus petiolaris]
Length=289

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIT  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  287



>gb|AEB37137.1| EIN3, partial [Helianthus annuus]
 gb|AEB37138.1| EIN3, partial [Helianthus annuus]
Length=290

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  117  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  176

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  177  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  204

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  205  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  256

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  257  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  289



>ref|XP_008368189.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=659

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (57%), Gaps = 12/138 (9%)
 Frame = -3

Query  731  FGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLLQ------LDDDFFKPGA  570
             G+ EDGQ+MISELMSFYD+N QQN N N  NLN  V+D N  Q      ++D+    G 
Sbjct  526  LGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLND-VDDCNQQQANFQFPMNDNLXGQGL  584

Query  569  PVGGGATFQDTN-MPITQSGFSSTETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAP  393
             +G      + + MP+    FSS E QF Q    ++SPF  N+ +  + RFGSP +L +P
Sbjct  585  DIGRNMNMSEQSPMPMLHPDFSSPEVQFDQL-MAFDSPFGNNSNEDVDIRFGSPLHL-SP  642

Query  392  IDYSSMDQLPKQDVSTWY  339
            + Y+ MD    QD   W+
Sbjct  643  VGYNVMDPPLNQD--PWF  658


 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D K Y CEY QCPY +Y++GF D T+RNNHQ+NC YR  S+Q LGM +FQ++N+ P  F
Sbjct  389  LDQKYYACEYLQCPYHDYRLGFLDITARNNHQLNCPYRNNSSQVLGMSSFQLHNEKPVDF  448



>gb|AEB37100.1| EIN3, partial [Helianthus annuus]
 gb|AEB37101.1| EIN3, partial [Helianthus annuus]
Length=292

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AEB37112.1| EIN3, partial [Helianthus annuus]
 gb|AEB37113.1| EIN3, partial [Helianthus annuus]
Length=296

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  122  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  181

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  182  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  209

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  210  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  261

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  262  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  294



>gb|AEB37102.1| EIN3, partial [Helianthus annuus]
 gb|AEB37103.1| EIN3, partial [Helianthus annuus]
Length=296

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  121  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  180

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  181  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIT  208

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  209  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  260

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  261  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  293



>gb|AEB37104.1| EIN3, partial [Helianthus annuus]
 gb|AEB37105.1| EIN3, partial [Helianthus annuus]
Length=290

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>ref|XP_004984528.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Setaria italica]
Length=647

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 98/220 (45%), Gaps = 23/220 (10%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+++Y  GF DR +RN+HQ  C+Y     Q    +           F   
Sbjct  438  RVYTCNNVQCPHNDYGYGFLDRNARNSHQYTCKYNDPLPQSTENKPPPPQPPQSQAFQGG  497

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLL  603
                    ++       F LP DGQR I+ELM+ YD NF  N N +S +++ +    N L
Sbjct  498  FNQPNQALNNLD-----FSLPMDGQRSIAELMNMYDNNFMTNKNMSSDSVSIMEGRPNAL  552

Query  602  ----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSK-----FQYESPF--  456
                Q+DD FF       G   F D N  + Q   +  + Q           + ++PF  
Sbjct  553  PQRMQMDDGFFG-----QGNGVFDDVNSMMQQPQQAPVQQQQQPQPQQQFFIRDDTPFVS  607

Query  455  -NGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
              G+     EFRFGS FN+++ +DY    Q  K D   WY
Sbjct  608  QMGDISGTSEFRFGSSFNMSSTVDYPGAAQQ-KNDGPNWY  646



>gb|AEB37135.1| EIN3, partial [Helianthus annuus]
 gb|AEB37136.1| EIN3, partial [Helianthus annuus]
Length=291

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  117  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  176

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  177  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  204

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  205  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  256

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  257  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  289



>gb|AEB37079.1| EIN3, partial [Helianthus exilis]
Length=288

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 90/214 (42%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+   QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSXQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  286



>gb|AEB37096.1| EIN3, partial [Helianthus annuus]
 gb|AEB37097.1| EIN3, partial [Helianthus annuus]
Length=293

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  119  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  178

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  179  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  206

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  207  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  258

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  259  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  291



>gb|AEB37160.1| EIN3, partial [Helianthus annuus]
Length=292

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIX  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AEB37066.1| EIN3, partial [Helianthus paradoxus]
 gb|AEB37073.1| EIN3, partial [Helianthus paradoxus]
 gb|AEB37074.1| EIN3, partial [Helianthus paradoxus]
Length=288

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------IPSFYDTNHQNTNRNLNTSNLDVIA  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLDFRFVTQSPFNL  287



>gb|AEB37076.1| EIN3, partial [Helianthus paradoxus]
Length=287

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------IPSFYDTNHQNTNRNLNTSNLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVTQSPFNL  286



>gb|AEB37075.1| EIN3, partial [Helianthus paradoxus]
Length=287

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------IPSFYDTNHQNTNRNLNTSNLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVTQSPFNL  286



>gb|AEB37068.1| EIN3, partial [Helianthus paradoxus]
Length=289

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------IPSFYDTNHQNTNRNLNTSNLDVIA  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLDFRFVTQSPFNL  287



>gb|AEB37067.1| EIN3, partial [Helianthus paradoxus]
Length=288

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------IPSFYDTNHQNTNRNLNTSNLDVIA  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLDFRFVTQSPFNL  287



>gb|AEB37069.1| EIN3, partial [Helianthus paradoxus]
 gb|AEB37070.1| EIN3, partial [Helianthus paradoxus]
Length=290

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------IPSFYDTNHQNTNRNLNTSNLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVTQSPFNL  288



>gb|AEB37080.1| EIN3, partial [Helianthus exilis]
Length=293

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 89/214 (42%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  117  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYXPSPNPNHNPPRSSTLSFQMKEPQPP  176

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  177  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  204

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDD FF  G          ++N+   QS F S
Sbjct  205  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDXFFSQGV--------VESNISSXQSTFLS  256

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  257  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  289



>gb|AEB37091.1| EIN3, partial [Helianthus argophyllus]
Length=310

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 94/221 (43%), Gaps = 69/221 (31%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  125  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  184

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N   N+ NL+ + 
Sbjct  185  VFT--------------------------------MPSFYDTNHQNTNRXLNTANLDVIA  212

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  213  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  264

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNLAAPIDYS  381
            T  QF  +K  Y  PF+ +      F   SPFNL   +D+S
Sbjct  265  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNLGG-VDFS  303



>gb|AEB37154.1| EIN3, partial [Helianthus annuus]
Length=284

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 68/213 (32%), Positives = 90/213 (42%), Gaps = 68/213 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  113  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  172

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  173  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  200

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  201  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  252

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFN  405
            T  QF  +K  Y  PF+ +      F   SPFN
Sbjct  253  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFN  284



>ref|XP_008354838.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Malus domestica]
Length=610

 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 108/224 (48%), Gaps = 36/224 (16%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDG---------  804
            YTCEY  CPY +Y +GF++ T+RNNHQ+ C YR  S+Q +GM +   N+D          
Sbjct  394  YTCEYLDCPYHDYHLGFRNITARNNHQLTCSYRNNSSQ-VGMSSVHPNSDKLVGSLSSPQ  452

Query  803  --PAVFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLN  630
              PA+          V  +SS NAS   L  D Q MISE MSF D N QQN N +  +L+
Sbjct  453  PNPAI-------QQPVNQTSSFNASGLELAGDEQNMISEFMSFCDGNIQQNKNSDPGSLD  505

Query  629  AVVEDHNLLQLD------DDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQ-  471
             VVE+HN  Q++      D+FF     +G   +             +        ++FQ 
Sbjct  506  -VVENHNQHQVNYQFPXGDNFFDZRLVIGSNMSQASXMPMPMLPPATPAPPSLPSTEFQF  564

Query  470  -----YESPFNGNTCDPGEFRFGSPFNLAAPIDYSSMDQLPKQD  354
                 ++SPF  +  +     FG+  NL  P D  S+D + +QD
Sbjct  565  DPCTLFDSPFGNHPNNTDNLGFGT--NL--PRDDYSLDSMLEQD  604



>gb|AEB37061.1| EIN3, partial [Helianthus petiolaris]
Length=289

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 90/214 (42%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIX  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N   +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNXSSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  287



>ref|XP_010689360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Beta vulgaris 
subsp. vulgaris]
Length=619

 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 106/228 (46%), Gaps = 31/228 (14%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            +IY C   +CP++  ++GF DR SR+NHQ+ C Y+ +S    G+ N+Q+N   P+ F   
Sbjct  398  QIYVCGLVECPHNQLELGFYDRISRDNHQLTCPYQ-SSNLPYGIPNYQVNEVKPSAFQRQ  456

Query  782  kpaapsvgssssvnasSFGL-----PEDGQRMISELMSFYDTNFQQNGN-FNSVNLNAVV  621
                      S+     F L     PEDGQ+MISELMS+YD+N       ++ +   A  
Sbjct  457  ALQDEHAALPSNSAQPVFDLSGLEVPEDGQKMISELMSYYDSNILATKTPYHEIISPA--  514

Query  620  EDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTC  441
             DHN++Q   D+ +    +   ++  + N+P         +       +Q E+ F+G  C
Sbjct  515  -DHNVMQRSMDYNQNDL-ILRPSSITELNLP----DQYDIQVHHQMLNWQEENKFSG--C  566

Query  440  DPGEFRFG-----SPFNLAAPIDYSS-MDQLP--------KQDVSTWY  339
            +  E         S   +   + Y+  M+ LP        KQD STWY
Sbjct  567  EQLEHDLSVNGLDSILKVQLDLPYTDFMEDLPSGTSTACLKQDPSTWY  614



>ref|NP_001146219.1| uncharacterized protein LOC100279789 [Zea mays]
 gb|ACL53490.1| unknown [Zea mays]
 gb|AFW88507.1| hypothetical protein ZEAMMB73_148027 [Zea mays]
Length=642

 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 104/218 (48%), Gaps = 24/218 (11%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP S+Y  GF DR +RN+HQ  C+++  + Q         N    A     
Sbjct  438  RLYTCNNVQCPRSDYSYGFLDRNARNSHQYTCKHKDPTPQSTE------NKPPSAPPQPQ  491

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLL  603
                     + ++N+  F LP DGQR I+ELM+ YD NF  N N +S ++ AV+E  N +
Sbjct  492  AFQPAFSQPNQALNSLDFSLPMDGQRSIAELMNMYDNNFVPNKNPSSDSV-AVMERPNAM  550

Query  602  -----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKF-QYESPFNGNTC  441
                 Q+D+ FF     V G   F D N  + Q        Q  Q  F + ++PF     
Sbjct  551  PQQRIQMDEGFF-----VQGNGAFDDVNNSMMQQQQQQAPVQQQQQFFIRDDTPFVSQMG  605

Query  440  DPG----EFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
            D      EFRFG  FN+++ +DY    Q  + D + W+
Sbjct  606  DIAASAPEFRFGPGFNMSSGVDYPGAAQ--RNDGTNWF  641



>gb|AGY30671.1| ethylene insensitive 3, partial [Saccharum hybrid cultivar]
Length=639

 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 103/221 (47%), Gaps = 26/221 (12%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y     Q         N   PA     
Sbjct  431  RVYTCNNVQCPHSDYSYGFLDRNARNSHQYTCKYNDPITQSAE------NKPLPAPPQPQ  484

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLL  603
                    ++ +VN   F LP DGQR I+ELM+ YDTNF  +   +S +   ++E  N +
Sbjct  485  AFQPAFSQANQAVNNLDFSLPMDGQRSIAELMNMYDTNFMTSKTMSSSDSVTIMERPNAM  544

Query  602  ----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY----ESPF---  456
                Q+D+ FF       G   F D N  + Q    +      Q + Q+    ++PF   
Sbjct  545  PQRIQMDEGFFG-----QGNGVFDDVNSMMQQQQQQAPPVVQQQQQQQFFIRDDTPFMSQ  599

Query  455  NGNTCDPGEFRFGSPFNLA--APIDYSSMDQLPKQDVSTWY  339
             G+     EFRFGS FN++  A  DY    Q  K D + W+
Sbjct  600  MGDITSTAEFRFGSGFNMSSTAAADYPGAAQ--KNDGANWF  638



>ref|NP_001152035.1| ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
 gb|ACG45492.1| ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
Length=646

 Score = 82.0 bits (201),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 103/221 (47%), Gaps = 26/221 (12%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y     Q         N   PA     
Sbjct  438  RVYTCNNVQCPHSDYSYGFLDRNARNSHQYTCKYNDPITQSAE------NKPLPAPPQPQ  491

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLL  603
                    ++ +VN   F LP DGQR I+ELM+ YDTNF  +   +S +   ++E  N +
Sbjct  492  AFQPAFSQANQAVNNLDFSLPMDGQRSIAELMNMYDTNFMTSKTMSSSDSVTIMERPNAM  551

Query  602  ----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY----ESPF---  456
                Q+D+ FF       G   F D N  + Q    +      Q + Q+    ++PF   
Sbjct  552  PQRIQMDEGFFG-----QGNGVFDDVNSMMQQQQQQAPPVVQQQQQQQFFIRDDTPFMSQ  606

Query  455  NGNTCDPGEFRFGSPFNLA--APIDYSSMDQLPKQDVSTWY  339
             G+     EFRFGS FN++  A  DY    Q  K D + W+
Sbjct  607  MGDITSTAEFRFGSGFNMSSTAAADYPGAAQ--KNDGANWF  645



>gb|AEB37062.1| EIN3, partial [Helianthus petiolaris]
Length=288

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 91/214 (43%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQ--------------  660
            VF+                                + SFYDTN Q               
Sbjct  174  VFT--------------------------------MPSFYDTNHQNTNRNLNTXNLDVIA  201

Query  659  -----NGNFNSVNLNAVVEDHNL---LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
                 N N N+ NL+ + +       +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  286



>gb|AEB37088.1| EIN3, partial [Helianthus argophyllus]
Length=289

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 90/214 (42%), Gaps = 68/214 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N   N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRXLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPFNL  402
            T  QF  +K  Y  PF+ +      F   SPFNL
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPFNL  288



>gb|AAV68142.1| ethylene insensitive 3-like 4 [Dianthus caryophyllus]
Length=704

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 75/126 (60%), Gaps = 6/126 (5%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNF-----QINNDGPA  798
            K++ CE S+CPYS  ++GF DR SR+NHQ+NC +R  S +R+ +  F     ++ +   +
Sbjct  397  KVFICENSRCPYSGSRLGFPDRISRHNHQLNCPFRVNSTRRVDIGTFLNTIEKLPSLESS  456

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVE  618
              ++         S+S+++AS  G+PE GQ+ I+ L+S YD+N Q N NFN +      E
Sbjct  457  NLTSSVAPQSETPSTSTISASGLGIPEYGQKFIANLISVYDSNLQPNENFN-LGTGIASE  515

Query  617  DHNLLQ  600
              +L+Q
Sbjct  516  TSDLMQ  521



>gb|AEB37081.1| EIN3, partial [Helianthus exilis]
Length=275

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  108  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  167

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  168  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  195

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  196  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  247

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  248  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  274



>gb|AEB37156.1| EIN3, partial [Helianthus annuus]
Length=280

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  113  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  172

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  173  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  200

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  201  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  252

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  253  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  279



>ref|XP_009417872.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417873.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=622

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 106/221 (48%), Gaps = 28/221 (13%)
 Frame = -3

Query  959  IYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapk  780
            IYTC+  QCP+ + + GF DR +RN+H+  C+Y+      +   +F +  +    FS   
Sbjct  415  IYTCDNVQCPHHDPRHGFLDRNARNSHRYVCKYQGTG---VAFNSFPVKENKLLSFSMSY  471

Query  779  paapsvgssss----vnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
               P+  S  S     N S  G+P DGQR I ELMS YD N   N +FNS  +  + E  
Sbjct  472  DTQPNPTSLESGPIPANTSDLGIPSDGQRSIDELMSLYDKNLNANKSFNSRGI-GMSEGR  530

Query  611  NLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFN---  453
              LQ    ++D+FF  G    GG   + +N+   Q  F   E            PF    
Sbjct  531  TPLQPRTRVEDNFFPQGTKAIGGMLEEVSNLVQQQQQFPVRENVM---------PFQQQF  581

Query  452  GNTCD--PGEFRFGSPFNLAAPIDYS-SMDQLPKQDVSTWY  339
            GN  D   G+  +GS F++ + +DYS ++ +L K + + W+
Sbjct  582  GNPSDEMSGDLCYGSAFSMPS-MDYSDALHRLQKAEAANWF  621



>gb|AEB37126.1| EIN3, partial [Helianthus annuus]
Length=281

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  280



>gb|AEB37098.1| EIN3, partial [Helianthus annuus]
 gb|AEB37099.1| EIN3, partial [Helianthus annuus]
Length=283

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  116  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  175

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  176  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  203

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  204  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  255

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  256  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  282



>gb|AEB37165.1| EIN3, partial [Helianthus annuus]
Length=284

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 89/212 (42%), Gaps = 68/212 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  114  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  173

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  174  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  201

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  202  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  253

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPF  408
            T  QF  +K  Y  PF+ +      F   SPF
Sbjct  254  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPF  284



>gb|AEB37139.1| EIN3, partial [Helianthus annuus]
 gb|AEB37140.1| EIN3, partial [Helianthus annuus]
Length=281

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 89/212 (42%), Gaps = 68/212 (32%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  111  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  170

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  171  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  198

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  199  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  250

Query  503  TETQFGQSKFQYESPFNGNTCDPGEFRFGSPF  408
            T  QF  +K  Y  PF+ +      F   SPF
Sbjct  251  TGFQFD-NKAPYTPPFDAHNNLDFRFVSQSPF  281



>gb|AEB37155.1| EIN3, partial [Helianthus annuus]
Length=282

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  115  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  174

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  175  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIX  202

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  203  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFSQGV--------VESNISSSQSTFLS  254

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  255  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  281



>gb|AEB37083.1| EIN3, partial [Helianthus tuberosus]
Length=278

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  111  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  170

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  171  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  198

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  199  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  250

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  251  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  277



>gb|AEB37089.1| EIN3, partial [Helianthus argophyllus]
 gb|AEB37090.1| EIN3, partial [Helianthus argophyllus]
Length=277

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  109  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  168

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  169  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  196

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  197  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  248

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  249  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  275



>gb|AEB37092.1| EIN3, partial [Helianthus argophyllus]
 gb|AEB37093.1| EIN3, partial [Helianthus argophyllus]
Length=275

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 90/211 (43%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  108  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  167

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  168  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  195

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  196  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  247

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  248  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  274



>gb|ABF95697.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG95963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=641

 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 107/219 (49%), Gaps = 25/219 (11%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y          Q+ +     PA+F   
Sbjct  436  RVYTCHNVQCPHSDYGYGFLDRNARNSHQYTCKYNDPL-----QQSTENKPSPPAIF---  487

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNL-  606
               A     + ++N   FGLP DGQR I+ELM+ YD NF  N N ++ N   ++E  N  
Sbjct  488  --PATYNTPNQALNNLDFGLPMDGQRSITELMNMYDNNFVANKNLSNDNA-TIMERPNAV  544

Query  605  ---LQLDD--DFFKPGAPVGGGATFQDTN-MPITQSGFSSTETQFGQSKFQYESPFN---  453
               +Q+++       G     G  F+D N M       +  + QF     + ++PF    
Sbjct  545  NPRIQIEEGFFGQGSGIGGSNGGVFEDVNGMMQQPQQTTPAQQQF---FIRDDTPFGNQM  601

Query  452  GNTCDPGEFRFGSPFNLAAPIDY-SSMDQLPKQDVSTWY  339
            G+     EFRFGS FN++  ++Y  +M    K D S WY
Sbjct  602  GDINGASEFRFGSGFNMSGAVEYPGAMQGQQKNDGSNWY  640



>gb|AAZ78349.1| EIN3-like protein 1 [Oryza sativa Japonica Group]
 gb|EAZ26760.1| hypothetical protein OsJ_10672 [Oryza sativa Japonica Group]
Length=640

 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 107/219 (49%), Gaps = 25/219 (11%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y          Q+ +     PA+F   
Sbjct  435  RVYTCHNVQCPHSDYGYGFLDRNARNSHQYTCKYNDPL-----QQSTENKPSPPAIF---  486

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNL-  606
               A     + ++N   FGLP DGQR I+ELM+ YD NF  N N ++ N   ++E  N  
Sbjct  487  --PATYNTPNQALNNLDFGLPMDGQRSITELMNMYDNNFVANKNLSNDNA-TIMERPNAV  543

Query  605  ---LQLDD--DFFKPGAPVGGGATFQDTN-MPITQSGFSSTETQFGQSKFQYESPFN---  453
               +Q+++       G     G  F+D N M       +  + QF     + ++PF    
Sbjct  544  NPRIQIEEGFFGQGSGIGGSNGGVFEDVNGMMQQPQQTTPAQQQF---FIRDDTPFGNQM  600

Query  452  GNTCDPGEFRFGSPFNLAAPIDY-SSMDQLPKQDVSTWY  339
            G+     EFRFGS FN++  ++Y  +M    K D S WY
Sbjct  601  GDINGASEFRFGSGFNMSGAVEYPGAMQGQQKNDGSNWY  639



>gb|AEB37146.1| EIN3, partial [Helianthus annuus]
 gb|AEB37147.1| EIN3, partial [Helianthus annuus]
Length=270

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 89/209 (43%), Gaps = 72/209 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  105  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  164

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  165  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  192

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  193  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  244

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRF  420
            T  QF  +K  Y  PF+  N  D   FRF
Sbjct  245  TGFQFD-NKAPYTPPFDAHNNLD---FRF  269



>gb|ACN27664.1| unknown [Zea mays]
 gb|ACN28151.1| unknown [Zea mays]
 gb|ADX60075.1| EIL transcription factor [Zea mays]
 tpg|DAA45119.1| TPA: ETHYLENE-INSENSITIVE3-like 1 protein [Zea mays]
Length=647

 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 94/200 (47%), Gaps = 22/200 (11%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y     Q         N   PA     
Sbjct  438  RVYTCNNVQCPHSDYSYGFLDRNARNSHQYTCKYNDPITQSAE------NKPLPAPPQPQ  491

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLL  603
                    ++ + N   F LP DGQR I+ELM+ YDTNF  +   +S +   ++E  N +
Sbjct  492  AFQPAFSQANQAANNLDFSLPMDGQRSIAELMNMYDTNFMTSKTMSSSDSVTIMERPNAM  551

Query  602  ----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY----ESPF---  456
                Q+D+ FF       G   F D N  + Q    +      Q + Q+    ++PF   
Sbjct  552  PQRIQMDEGFFG-----QGNGVFDDVNSMMQQQQQQAPPVVQQQQQQQFFIRDDTPFMSQ  606

Query  455  NGNTCDPGEFRFGSPFNLAA  396
             G+     EFRFGS FN+++
Sbjct  607  MGDITSTAEFRFGSGFNMSS  626



>gb|ACJ85709.1| unknown [Medicago truncatula]
 gb|AFK45814.1| unknown [Medicago truncatula]
Length=284

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 16/183 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KI+TC++S CPYS   +GF DR SR+ HQ++C YR +S+   G  +F  N   P ++
Sbjct  51   MDPKIFTCQHSTCPYSQAHIGFPDRASRDTHQLSCPYRGSSSSDFGGPSFHANEVKPVIY  110

Query  791  -------sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
                     P  A        S++ +  G+ EDG++ I  LM+ YD+     GN  +   
Sbjct  111  PPQSFVQPKPMMAQSVNMVPPSIDITGLGVSEDGEKSIGGLMTVYDS-----GNHLAATE  165

Query  632  NAVVEDHNLLQ--LDDDFFKPGAPVGGGATFQDTNMPIT--QSGFSSTETQFGQSKFQYE  465
            N ++   + +Q     ++F+    V  G  F+ TNM        F+  E QF Q      
Sbjct  166  NHILPQASSIQQLQQQNYFRGQGMVMEGNMFEATNMSNNNHHHMFARDEGQFDQRFKALN  225

Query  464  SPF  456
            SPF
Sbjct  226  SPF  228



>gb|AEB37071.1| EIN3, partial [Helianthus paradoxus]
 gb|AEB37072.1| EIN3, partial [Helianthus paradoxus]
Length=279

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 89/209 (43%), Gaps = 72/209 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K+YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  110  KVYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  169

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  170  VFT--------------------------------IPSFYDTNHQNTNRNLNTSNLDVIA  197

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  198  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFNQGV--------VESNISSSQSTFLS  249

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRF  420
            T  QF  +K  Y  PF+  N  D   FRF
Sbjct  250  TGFQFD-NKAPYTPPFDAHNNLD---FRF  274



>ref|XP_006293460.1| hypothetical protein CARUB_v10022879mg [Capsella rubella]
 gb|EOA26358.1| hypothetical protein CARUB_v10022879mg [Capsella rubella]
Length=587

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 56/100 (56%), Gaps = 10/100 (10%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapkp  777
            YTCE  QCP+S   MGFQDR+SR+NHQ+ C YR  +    G   F +    P        
Sbjct  406  YTCENGQCPHSKMNMGFQDRSSRDNHQMVCPYR-NNHLAYGATKFHMGEMKPVAL-----  459

Query  776  aapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN  657
                     +++ S FG+PE+GQ+MI+ELM+ YD N Q N
Sbjct  460  ----QQPVQAIDLSGFGVPENGQKMITELMAMYDRNVQSN  495



>gb|AEB37157.1| EIN3, partial [Helianthus annuus]
Length=278

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 89/211 (42%), Gaps = 72/211 (34%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQY-----RFASAQRLGMQNFQINNDGPA  798
            K YTCE+SQCPYS+ ++GF DR SRNNHQ+NC Y        +  R    +FQ+    P 
Sbjct  111  KXYTCEFSQCPYSDIRVGFADRLSRNNHQMNCPYRPSPNPNHNPPRSSTLSFQMKEPQPP  170

Query  797  VFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ-QNGNFNSVNLNAVV  621
            VF+                                + SFYDTN Q  N N N+ NL+ + 
Sbjct  171  VFT--------------------------------MPSFYDTNHQNTNRNLNTANLDVIA  198

Query  620  EDHNL---------------------LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSS  504
               N                      +QLDDDFF  G          ++N+  +QS F S
Sbjct  199  NHQNTNRNLNAANLDVITDLQKQKFPMQLDDDFFXQGV--------VESNISSSQSTFLS  250

Query  503  TETQFGQSKFQYESPFNG-NTCDPGEFRFGS  414
            T  QF  +K  Y  PF+  N  D   FRF S
Sbjct  251  TGFQFD-NKAPYTPPFDAHNNLD---FRFVS  277



>ref|XP_003638449.1| Ethylene insensitive 3-like protein [Medicago truncatula]
Length=654

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 16/183 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KI+TC++S CPYS   +GF DR SR+ HQ++C YR +S+   G  +F  N   P ++
Sbjct  396  MDPKIFTCQHSTCPYSQAHIGFPDRASRDTHQLSCPYRGSSSSDFGGPSFHANEVKPVIY  455

Query  791  -------sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
                     P  A        S++ +  G+ EDG++ I  LM+ YD+     GN  +   
Sbjct  456  PPQSFVQPKPMMAQSVNMVPPSIDITGLGVSEDGEKSIGGLMTVYDS-----GNHLAATE  510

Query  632  NAVVEDHNLLQ--LDDDFFKPGAPVGGGATFQDTNMPIT--QSGFSSTETQFGQSKFQYE  465
            N ++   + +Q     ++F+    V  G  F+ TNM        F+  E QF Q      
Sbjct  511  NHILPQASSIQQLQQQNYFRGQGMVMEGNMFEATNMSNNNHHHMFARDEGQFDQRFKALN  570

Query  464  SPF  456
            SPF
Sbjct  571  SPF  573



>gb|EAY89823.1| hypothetical protein OsI_11369 [Oryza sativa Indica Group]
Length=640

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 107/216 (50%), Gaps = 19/216 (9%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y          Q+ +     PA+F   
Sbjct  435  RVYTCNNVQCPHSDYGYGFLDRNARNSHQYTCKYNDPL-----QQSTENKPSPPAIF---  486

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNL-  606
               A     + ++N   FGLP DGQR I+ELM+ YD NF  N N ++ N   ++E  N  
Sbjct  487  --PATYNTPNQALNNLDFGLPMDGQRSITELMNMYDNNFVANKNLSNDNA-TIMERPNAV  543

Query  605  ---LQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFN---GNT  444
               +Q+++ FF  G+ VGG       ++         T     Q   + ++PF    G+ 
Sbjct  544  NPRIQIEEGFFGQGSGVGGSNGGVFEDVNGMMQQPQQTTPAQQQFFIRDDTPFGNQMGDI  603

Query  443  CDPGEFRFGSPFNLAAPIDY-SSMDQLPKQDVSTWY  339
                EFRFGS FN++  ++Y  +M    K D S WY
Sbjct  604  NGASEFRFGSGFNMSGAVEYPGAMQGQQKNDGSNWY  639



>gb|ACN31333.1| unknown [Zea mays]
Length=647

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 93/200 (47%), Gaps = 22/200 (11%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y   F DR +RN+HQ  C+Y     Q         N   PA     
Sbjct  438  RVYTCNNVQCPHSDYSYAFLDRNARNSHQYTCKYNDPITQSAE------NKPLPAPPQPQ  491

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLL  603
                    ++ +VN   F LP DGQR I+ELM+ YDTNF  +   +S +   ++E  N +
Sbjct  492  AFQPAFSQANQAVNNLDFSLPMDGQRSIAELMNMYDTNFMTSKTMSSSDSVTIMERPNAM  551

Query  602  ----QLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY----ESPF---  456
                Q+D+ FF       G   F D N  + Q           Q + Q+    ++PF   
Sbjct  552  PQRIQMDEGFFG-----QGNGVFDDVNSMMQQQQQQQAPPVVQQQQQQFFIRDDTPFMSQ  606

Query  455  NGNTCDPGEFRFGSPFNLAA  396
             G+     EFRFGS FN+++
Sbjct  607  MGDITSTAEFRFGSGFNMSS  626



>ref|XP_009406830.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=615

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 97/224 (43%), Gaps = 46/224 (21%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQN--FQINNDGPAVFs  789
            ++YTC+   CP++N + GF DR +RN+HQ  C+Y+      +GM N  FQ+  + P VF 
Sbjct  421  RVYTCDNVVCPHNNVRHGFLDRNARNSHQYFCKYQTTHPPGIGMTNNSFQVTENKPLVFP  480

Query  788  a----pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
                     +    S + VN S   +P DGQ+ I ELM+FYD N   + N N        
Sbjct  481  LPLNCQPNPSSIGSSLNPVNISDLDIPSDGQKSIDELMNFYDNNIDGSKNMN--------  532

Query  620  EDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTC  441
                              +GG    ++      + G    ++Q+GQ       PF     
Sbjct  533  ------------------LGGATMLEEVGDLFEEVGSLVEQSQYGQESM---VPFEQELT  571

Query  440  D-----PGEFRFGSPFNLAAPIDYS-----SMDQLPKQDVSTWY  339
            D      G+FR GS F++   +DY+      ++   KQD   W+
Sbjct  572  DQPIEVSGDFRIGSGFDMPG-MDYTDAMHERIEDSQKQDRFNWF  614



>gb|ACX54782.1| ethylene insensitive-like protein 1 [Medicago truncatula]
 gb|KEH35106.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=629

 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 16/183 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D KI+TC++S CPYS   +GF DR SR+ HQ++C YR +S+   G  +F  N   P ++
Sbjct  396  MDPKIFTCQHSTCPYSQAHIGFPDRASRDTHQLSCPYRGSSSSDFGGPSFHANEVKPVIY  455

Query  791  -------sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNL  633
                     P  A        S++ +  G+ EDG++ I  LM+ YD+     GN  +   
Sbjct  456  PPQSFVQPKPMMAQSVNMVPPSIDITGLGVSEDGEKSIGGLMTVYDS-----GNHLAATE  510

Query  632  NAVVEDHNLLQ--LDDDFFKPGAPVGGGATFQDTNMPIT--QSGFSSTETQFGQSKFQYE  465
            N ++   + +Q     ++F+    V  G  F+ TNM        F+  E QF Q      
Sbjct  511  NHILPQASSIQQLQQQNYFRGQGMVMEGNMFEATNMSNNNHHHMFARDEGQFDQRFKALN  570

Query  464  SPF  456
            SPF
Sbjct  571  SPF  573



>dbj|BAF44110.1| ethylene signal transcription factor [Musa acuminata AAA Group]
Length=622

 Score = 75.9 bits (185),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 106/219 (48%), Gaps = 24/219 (11%)
 Frame = -3

Query  959  IYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapk  780
            IYTC+  QCP+ + + GF DR +RN+H+  C Y+      +   +F +  +    FS P 
Sbjct  415  IYTCDNVQCPHHDPRHGFLDRNARNSHRYVCLYQGTG---VAFNSFPVKENKLLSFSVPY  471

Query  779  paapsvgssss----vnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
               P+  +  S     N S   +P DGQR I ELMS YD N   N +FNS  +  + E  
Sbjct  472  DTQPNPTTLESGPIPANTSDLSIPSDGQRSIDELMSLYDKNLNANKSFNSRGI-GMSEGR  530

Query  611  NLLQ----LDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFG-QSKFQYESPFNGN  447
              LQ    ++D+FF  G    GG   + +N+   Q  F   E     Q +F       GN
Sbjct  531  TPLQPRTRVEDNFFPQGTKAIGGMLEEVSNLVQQQQQFPVRENVMPFQQQF-------GN  583

Query  446  TCD--PGEFRFGSPFNLAAPIDYS-SMDQLPKQDVSTWY  339
              D   G+  +GS F++ + +DYS ++ +L K + + W+
Sbjct  584  PSDEMSGDLCYGSAFSMPS-MDYSDTLHRLQKAEAANWF  621



>ref|XP_002879041.1| hypothetical protein ARALYDRAFT_481586 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55300.1| hypothetical protein ARALYDRAFT_481586 [Arabidopsis lyrata subsp. 
lyrata]
Length=579

 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 10/100 (10%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapkp  777
            YTCE  QCP+S   +GFQDR+SR+NHQ+ C YR  +    G   F +    P V      
Sbjct  404  YTCENGQCPHSKMNLGFQDRSSRDNHQMVCPYR-DNHLAYGASKFHMGGMKPVV------  456

Query  776  aapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN  657
                  +   ++ SSFG+PE+GQ+MI++LM+ YD N Q N
Sbjct  457  ---PQQAVQPIDLSSFGVPENGQKMITDLMAMYDRNVQSN  493



>gb|ABG89100.1| ethylene insensitive-like protein 1, partial [Musa acuminata]
Length=495

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 96/224 (43%), Gaps = 46/224 (21%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQN--FQINNDGPAVFs  789
            + YTC+   CP++N + GF DR +RN+HQ  C+Y+      +GM N  FQ+  + P VF 
Sbjct  301  RAYTCDNVVCPHNNVRHGFLDRNARNSHQYFCKYQTTHPPGIGMTNNSFQVTENKPLVFP  360

Query  788  a----pkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVV  621
                     +    S + VN S   +P DGQ+ I ELM+FYD N   + N N        
Sbjct  361  LPLNCQPNPSSIGSSLNPVNISDLDIPSDGQKSIDELMNFYDNNIDGSKNMN--------  412

Query  620  EDHNLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQYESPFNGNTC  441
                              +GG    ++      + G    ++Q+GQ       PF     
Sbjct  413  ------------------LGGATMLEEVGDLFEEVGSLVEQSQYGQESM---VPFEQELA  451

Query  440  D-----PGEFRFGSPFNLAAPIDYS-----SMDQLPKQDVSTWY  339
            D      G+FR GS F++   +DY+      ++   KQD   W+
Sbjct  452  DQPIEVSGDFRIGSGFDMPG-MDYTDAMHERIEDSQKQDRFNWF  494



>ref|XP_009355062.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Pyrus x bretschneideri]
Length=614

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 78/143 (55%), Gaps = 14/143 (10%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapkp  777
            YTCEY  CPY +Y +GF++ T+RNNHQ+ C YR  S+Q +GM +   N D   V S P P
Sbjct  394  YTCEYLDCPYHDYHLGFRNITARNNHQLTCSYRNNSSQ-VGMSSAHPNGDK-LVGSLPSP  451

Query  776  aapsvgssssvnasSF---GLPEDG--QRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
                         SSF   GL   G  Q MISE MSF D N QQN N +  +L+ VVE+H
Sbjct  452  QPNPAIQQPVNQTSSFNASGLEPAGDEQNMISEFMSFCDGNTQQNKNSDPGSLD-VVENH  510

Query  611  NLLQLD------DDFFKPGAPVG  561
            N  Q++      D+FF     VG
Sbjct  511  NQHQVNYQFPMGDNFFDQRLVVG  533



>ref|XP_010557481.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010557482.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010557483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=570

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 5/106 (5%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAV----  795
            +I+ CE S CP+    +GFQDR+ R+NH++ C YR  S    G   F ++   PAV    
Sbjct  389  RIFACENSLCPHFEIHLGFQDRSLRDNHRLVCPYR-DSCLGYGASEFHVSEIKPAVLPRP  447

Query  794  FsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN  657
            F+ P PA   V S    + + FG+PEDGQ+ I+ELM+ YD + Q N
Sbjct  448  FTQPHPAVRPVNSFQPTDLTGFGVPEDGQKTITELMAMYDRSVQSN  493



>ref|XP_006408669.1| hypothetical protein EUTSA_v10001938mg [Eutrema salsugineum]
 dbj|BAJ33951.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50122.1| hypothetical protein EUTSA_v10001938mg [Eutrema salsugineum]
Length=581

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 72/130 (55%), Gaps = 13/130 (10%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYR-----FASAQRLGMQNFQINND  807
            +D   +TCE  QCP+S   MGFQDR+SR+NHQ+ C YR     + +A +       I   
Sbjct  398  MDRPSFTCENGQCPHSKINMGFQDRSSRDNHQMVCSYRDNRLAYGAASKF----HHIGEV  453

Query  806  GPAVFsapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNA  627
             P      + + P   S   ++ S +G+PE+GQ+MI+ELM+ YD N Q N +  S++  A
Sbjct  454  KPVAV--SQQSQPFPQSVQPIDLSGYGVPENGQKMITELMAMYDRNLQPNQSM-SIDAKA  510

Query  626  VVEDHNLLQL  597
              ++H   QL
Sbjct  511  -AQNHQEQQL  519



>ref|XP_009145590.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Brassica 
rapa]
Length=614

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 108/240 (45%), Gaps = 38/240 (16%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D  I+TCE + C + +   GF DR SR+NHQ  C +R +         F ++   P V 
Sbjct  384  MDRTIFTCENTGCAHGDVSRGFLDRNSRDNHQFVCPHRDSGLPYGAPSRFHVSEVKPVV-  442

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN-----LNA  627
                   P    S  ++ +  G+PEDGQ+MISELMS YD N Q N N  S+      L  
Sbjct  443  -GFSQPRPVNSVSQPIDLTGIGVPEDGQKMISELMSMYDRNVQSNQNQTSMVMETQLLQP  501

Query  626  VVEDH-NLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQFGQSKFQY------  468
             V++H   LQ   +  +       G+ F+D N+P   +     +     S F+Y      
Sbjct  502  TVQNHQEHLQFQGNMVE-------GSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDAAHTN  554

Query  467  -----ESPFNGNTCDPGEFRFGS-PFNLAA---------PIDYSSMD--QLPKQDVSTWY  339
                 E+  N ++ +  +  F S PF++A+         P    +MD  Q  +QDVS W+
Sbjct  555  NNNNFEAAHNNSSSNRFQLVFDSPPFDMASFDYRDDMPMPGVVGTMDGMQQKQQDVSIWF  614



>dbj|BAB78462.2| ethylene-insensitive-3-like protein [Oryza sativa Japonica Group]
 gb|ABF95695.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF95696.1| ETHYLENE-INSENSITIVE3-like 1 protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=644

 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 100/203 (49%), Gaps = 24/203 (12%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++YTC   QCP+S+Y  GF DR +RN+HQ  C+Y          Q+ +     PA+F   
Sbjct  436  RVYTCHNVQCPHSDYGYGFLDRNARNSHQYTCKYNDPL-----QQSTENKPSPPAIF---  487

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNL-  606
               A     + ++N   FGLP DGQR I+ELM+ YD NF  N N ++ N   ++E  N  
Sbjct  488  --PATYNTPNQALNNLDFGLPMDGQRSITELMNMYDNNFVANKNLSNDNA-TIMERPNAV  544

Query  605  ---LQLDD--DFFKPGAPVGGGATFQDTN-MPITQSGFSSTETQFGQSKFQYESPFN---  453
               +Q+++       G     G  F+D N M       +  + QF     + ++PF    
Sbjct  545  NPRIQIEEGFFGQGSGIGGSNGGVFEDVNGMMQQPQQTTPAQQQFF---IRDDTPFGNQM  601

Query  452  GNTCDPGEFRFGSPFNLAAPIDY  384
            G+     EFRFGS FN++  ++Y
Sbjct  602  GDINGASEFRFGSGFNMSGAVEY  624



>ref|XP_009145591.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Brassica 
rapa]
Length=613

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 105/241 (44%), Gaps = 41/241 (17%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            +D  I+TCE + C + +   GF DR SR+NHQ  C +R +         F ++   P V 
Sbjct  384  MDRTIFTCENTGCAHGDVSRGFLDRNSRDNHQFVCPHRDSGLPYGAPSRFHVSEVKPVV-  442

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVN-----LNA  627
                   P    S  ++ +  G+PEDGQ+MISELMS YD N Q N N  S+      L  
Sbjct  443  -GFSQPRPVNSVSQPIDLTGIGVPEDGQKMISELMSMYDRNVQSNQNQTSMVMETQLLQP  501

Query  626  VVEDH-NLLQLDDDFFKPGAPVGGGATFQDTNMPIT------------QSGFSSTETQFG  486
             V++H   LQ   +  +       G+ F+D N+P               SGF        
Sbjct  502  TVQNHQEHLQFQGNMVE-------GSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDAAHTN  554

Query  485  QSKFQYESPFNGNTCDPGEFRFGS-PFNLAA---------PIDYSSMD--QLPKQDVSTW  342
             + F  E+  N  + +  +  F S PF++A+         P    +MD  Q  +QDVS W
Sbjct  555  NNNF--EAAHNNGSSNRFQLVFDSPPFDMASFDYRDDMPMPGVVGTMDGMQQKQQDVSIW  612

Query  341  Y  339
             
Sbjct  613  L  613



>ref|XP_009135708.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
 ref|XP_009135709.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=581

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 105/224 (47%), Gaps = 20/224 (9%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVF  792
            VD   +TCE   C + +   GF DR SR+NHQ+ C +R +  Q      F ++   P V 
Sbjct  365  VDRAAFTCENPGCVHGDISRGFLDRNSRDNHQLVCPHRDSCLQ----SRFHVSEVKPVV-  419

Query  791  sapkpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDH  612
               +P  P    +  ++ +  G+PEDGQ+MISELMS YD N   N     +   +V    
Sbjct  420  GYSQPRQPVNSVAQPIDLTGIGVPEDGQKMISELMSMYDRNVHSNQTSMVMENQSVSLLQ  479

Query  611  NLLQLDDDFFKPGAPVGGGATFQDTNMPITQSGFSSTETQF-GQSKFQYESPFNGNTCDP  435
              +Q   +  +    V   + F+D N+P      +S +T F G +   +E+  N  + + 
Sbjct  480  PTVQNHQEHLQFQGNVVESSFFEDLNIP--NRANNSNQTFFQGSNSNSFEAAVNNGSSNR  537

Query  434  GEFRFGS-PFNLAA---------PIDYSSMD--QLPKQDVSTWY  339
             +  F S PF++A+         P    +MD  Q  +QDVS W+
Sbjct  538  FQLVFDSPPFDMASFDYRDDMSMPGVVGTMDGMQQKQQDVSIWF  581



>ref|XP_010417849.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X1 [Camelina 
sativa]
Length=590

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 16/98 (16%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapkp  777
            YTCE  QCP+    +GFQDR+SR+NHQ+ C YR  +    G   F++    P        
Sbjct  420  YTCENGQCPHGKMNLGFQDRSSRDNHQMVCPYR-DNGVAYGASKFRVGEMRP--------  470

Query  776  aapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ  663
                     S++ S FG+PE+GQ+MI+ELM+ YD N Q
Sbjct  471  -------QQSIDLSGFGVPENGQKMITELMAMYDRNVQ  501



>ref|XP_010417850.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein isoform X2 [Camelina 
sativa]
Length=575

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 16/98 (16%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapkp  777
            YTCE  QCP+    +GFQDR+SR+NHQ+ C YR  +    G   F++    P        
Sbjct  405  YTCENGQCPHGKMNLGFQDRSSRDNHQMVCPYR-DNGVAYGASKFRVGEMRP--------  455

Query  776  aapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ  663
                     S++ S FG+PE+GQ+MI+ELM+ YD N Q
Sbjct  456  -------QQSIDLSGFGVPENGQKMITELMAMYDRNVQ  486



>ref|XP_010473094.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
Length=578

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 53/98 (54%), Gaps = 16/98 (16%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapkp  777
            YTCE  QCP+    +GFQDR+SR+NHQ+ C YR       G   F +    P        
Sbjct  406  YTCENGQCPHGKMNLGFQDRSSRDNHQMVCPYRDNRVA-YGASKFHVGEMRP--------  456

Query  776  aapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ  663
                     S++ S FG+PE+GQ+MI+ELM+ YD N Q
Sbjct  457  -------QQSIDLSVFGVPENGQKMITELMAMYDRNVQ  487



>ref|XP_010510821.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
 ref|XP_010510822.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Camelina sativa]
Length=580

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 53/98 (54%), Gaps = 13/98 (13%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsapkp  777
            YTCE  QCP+    +GFQDR+SR+NHQ+ C YR       G   F +    P        
Sbjct  404  YTCENGQCPHGKMNLGFQDRSSRDNHQMVCPYRDNRVA-YGASKFHVGEMRP--------  454

Query  776  aapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQ  663
                  S   ++ S FG+PE+GQ+MI+ELM+ YD N Q
Sbjct  455  ----QHSVQPIDLSGFGVPENGQKMITELMAMYDRNVQ  488



>dbj|BAJ95094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 107/223 (48%), Gaps = 27/223 (12%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            ++Y C   QCP+S+Y  GF DR +RN+HQ  C+Y  A      +     N   P      
Sbjct  440  RVYICNNVQCPHSDYGYGFLDRNARNSHQYTCKYNDA------LPPSAENKAAPPAPPQV  493

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQNGNFNSVNLNAVVEDHNLL  603
             PAA     +  +N   FGLP DGQR I+ELM+ YDT F  N N  + ++  ++E  N L
Sbjct  494  FPAAAYNQQNHGLNNLDFGLPMDGQRSIAELMNMYDTAFPANKNMGNDDVT-IIERPNSL  552

Query  602  ----QLDDDFFKPGAPVGGG--ATFQD-TNMPITQSGFSSTETQFGQSKFQY----ESPF  456
                Q+D+ FF  G  +GG   + F D +NM   Q      + Q   ++ Q+    E+P 
Sbjct  553  TPGTQMDEGFFGQGNGIGGNGDSMFSDVSNMMQQQQQQQPQQQQQAPAQQQFFIRDETPQ  612

Query  455  NGN----TCDPGEFRFGSPFNLAAPIDYSSMDQLPKQDVSTWY  339
             GN         +FRFGS FN++  +DY       K D   WY
Sbjct  613  FGNQMGGISGASDFRFGSGFNMSGAVDYPQ-----KNDGPNWY  650



>ref|XP_010521598.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521599.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010521601.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=608

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 3/102 (3%)
 Frame = -3

Query  962  KIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINNDGPAVFsap  783
            + + CE  +CP+S   +GF DRTSR+NHQ+ C YR  S        F ++   PA    P
Sbjct  388  RTFVCENPRCPHSETNLGFLDRTSRDNHQLVCPYR-DSCLPYRSSKFHVSEIKPAAV--P  444

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN  657
            +P          ++ + FG+ EDG+RMISELM+ YD N Q N
Sbjct  445  QPFTQPKPVVQPIDLTGFGVSEDGERMISELMAMYDRNVQSN  486



>gb|AFU90136.4| ethylene-insensitive 3 [Paeonia lactiflora]
Length=653

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINND  807
            ++ KI+TCE+ QCPY++ ++GF DR++RN+HQ+ CQYR  S+Q   +Q+FQI++D
Sbjct  398  MEPKIFTCEHPQCPYNDCRLGFLDRSTRNSHQLTCQYRGNSSQVFPVQSFQIDHD  452



>gb|AFI61909.1| ethylene insensitive 3-like 3 protein [Paeonia suffruticosa]
Length=652

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  971  VDVKIYTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRLGMQNFQINND  807
            ++ KI+TCE+ QCPY++ ++GF DR++RN+HQ+ CQYR  S+Q   +Q+FQI++D
Sbjct  399  MEPKIFTCEHPQCPYNDCRLGFLDRSTRNSHQLTCQYRGNSSQVFPVQSFQIDHD  453



>ref|NP_180273.1| ethylene insensitive 3-like 1 protein [Arabidopsis thaliana]
 sp|Q9SLH0.1|EIL1_ARATH RecName: Full=ETHYLENE INSENSITIVE 3-like 1 protein [Arabidopsis 
thaliana]
 gb|AAC77863.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AAL38367.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AAO29962.1| ethylene-insensitive3-like1 (EIL1) [Arabidopsis thaliana]
 gb|AEC07930.1| ethylene insensitive 3-like 1 protein [Arabidopsis thaliana]
Length=584

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRL--GMQNFQINNDGPAVFsap  783
            YTCE  QCP+S   +GFQDR+SR+NHQ+ C YR     RL  G   F +      V    
Sbjct  404  YTCENGQCPHSKMNLGFQDRSSRDNHQMVCPYR---DNRLAYGASKFHMGGMKLVV----  456

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN  657
                        ++ S  G+PE+GQ+MI+ELM+ YD N Q N
Sbjct  457  -----PQQPVQPIDLSGVGVPENGQKMITELMAMYDRNVQSN  493



>gb|AAC49746.1| ethylene-insensitive3-like1 [Arabidopsis thaliana]
Length=584

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = -3

Query  956  YTCEYSQCPYSNYQMGFQDRTSRNNHQINCQYRFASAQRL--GMQNFQINNDGPAVFsap  783
            YTCE  QCP+S   +GFQDR+SR+NHQ+ C YR     RL  G   F +      V    
Sbjct  404  YTCENGQCPHSKMNLGFQDRSSRDNHQMVCPYR---DNRLAYGASKFHMGGMKLVV----  456

Query  782  kpaapsvgssssvnasSFGLPEDGQRMISELMSFYDTNFQQN  657
                        ++ S  G+PE+GQ+MI+ELM+ YD N Q N
Sbjct  457  -----PQQPVQPIDLSGVGVPENGQKMITELMAMYDRNVQSN  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2393765068816