BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12266

Length=884
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABR25526.1|  26S protease regulatory subunit 8                       381   2e-130   Oryza sativa Indica Group [Indian rice]
gb|AAF22526.1|AF123395_1  26S proteasome AAA-ATPase subunit RPT6a       386   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520598.1|  PREDICTED: 26S protease regulatory subunit 8...    386   3e-129   Tarenaya hassleriana [spider flower]
ref|XP_002871914.1|  ATSUG1                                             386   4e-129   Arabidopsis lyrata subsp. lyrata
ref|XP_009760357.1|  PREDICTED: 26S protease regulatory subunit 8...    382   4e-129   Nicotiana sylvestris
ref|XP_002871915.1|  ATSUG1                                             386   4e-129   
ref|XP_007202157.1|  hypothetical protein PRUPE_ppa006323mg             386   4e-129   Prunus persica
ref|XP_004287374.1|  PREDICTED: 26S protease regulatory subunit 8...    386   4e-129   Fragaria vesca subsp. vesca
ref|XP_006287833.1|  hypothetical protein CARUB_v10001052mg             386   4e-129   
ref|NP_197500.1|  AAA-type ATPase family protein                        386   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568389.1|  regulatory particle triple-A ATPase 6A                385   5e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454292.1|  PREDICTED: 26S protease regulatory subunit 8...    385   7e-129   Camelina sativa [gold-of-pleasure]
ref|XP_006293475.1|  hypothetical protein CARUB_v10023291mg             385   7e-129   Capsella rubella
ref|XP_011081123.1|  PREDICTED: 26S protease regulatory subunit 8...    385   1e-128   Sesamum indicum [beniseed]
ref|XP_002285273.1|  PREDICTED: 26S protease regulatory subunit 8...    385   1e-128   Vitis vinifera
ref|XP_009590572.1|  PREDICTED: 26S protease regulatory subunit 8...    384   1e-128   Nicotiana tomentosiformis
gb|AGC54441.1|  26S proteasome ATPase regulatory subunit 6              384   2e-128   Capsicum annuum
gb|KDO80361.1|  hypothetical protein CISIN_1g014743mg                   379   2e-128   Citrus sinensis [apfelsine]
emb|CDP03399.1|  unnamed protein product                                384   2e-128   Coffea canephora [robusta coffee]
gb|ABR18043.1|  unknown                                                 379   2e-128   Picea sitchensis
emb|CDY35832.1|  BnaC09g37640D                                          384   3e-128   Brassica napus [oilseed rape]
ref|XP_010254305.1|  PREDICTED: 26S protease regulatory subunit 8...    384   3e-128   Nelumbo nucifera [Indian lotus]
ref|XP_009599866.1|  PREDICTED: 26S protease regulatory subunit 8...    384   3e-128   Nicotiana tomentosiformis
ref|XP_002284747.1|  PREDICTED: 26S protease regulatory subunit 8...    384   3e-128   Vitis vinifera
ref|XP_011072258.1|  PREDICTED: 26S protease regulatory subunit 8...    384   3e-128   Sesamum indicum [beniseed]
ref|XP_006647057.1|  PREDICTED: 26S protease regulatory subunit 8...    384   4e-128   Oryza brachyantha
ref|XP_004951510.1|  PREDICTED: 26S protease regulatory subunit 8...    384   4e-128   Setaria italica
ref|XP_002453516.1|  hypothetical protein SORBIDRAFT_04g007170          384   4e-128   Sorghum bicolor [broomcorn]
ref|NP_001142276.1|  uncharacterized protein LOC100274445               384   4e-128   Zea mays [maize]
ref|XP_009770420.1|  PREDICTED: 26S protease regulatory subunit 8...    383   4e-128   Nicotiana sylvestris
ref|XP_009126408.1|  PREDICTED: 26S protease regulatory subunit 8...    383   5e-128   Brassica rapa
ref|NP_001140953.1|  hypothetical protein                               383   5e-128   Zea mays [maize]
ref|XP_010249967.1|  PREDICTED: 26S protease regulatory subunit 8...    383   5e-128   Nelumbo nucifera [Indian lotus]
ref|XP_010454291.1|  PREDICTED: 26S protease regulatory subunit 8...    383   6e-128   Camelina sativa [gold-of-pleasure]
emb|CDX70903.1|  BnaC03g09870D                                          383   6e-128   
ref|XP_009381131.1|  PREDICTED: 26S protease regulatory subunit 8...    383   6e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010493091.1|  PREDICTED: 26S protease regulatory subunit 8...    383   7e-128   Camelina sativa [gold-of-pleasure]
ref|XP_008464995.1|  PREDICTED: 26S protease regulatory subunit 8...    383   7e-128   Cucumis melo [Oriental melon]
ref|XP_006400565.1|  hypothetical protein EUTSA_v10013657mg             383   7e-128   Eutrema salsugineum [saltwater cress]
ref|XP_006843919.1|  PREDICTED: 26S protease regulatory subunit 8...    382   8e-128   Amborella trichopoda
ref|XP_010420826.1|  PREDICTED: 26S protease regulatory subunit 8...    383   8e-128   Camelina sativa [gold-of-pleasure]
ref|XP_006840553.1|  PREDICTED: 26S protease regulatory subunit 8...    382   8e-128   Amborella trichopoda
ref|XP_006400566.1|  hypothetical protein EUTSA_v10013659mg             382   9e-128   Eutrema salsugineum [saltwater cress]
ref|NP_001046248.1|  Os02g0205300                                       383   9e-128   
ref|XP_009408962.1|  PREDICTED: 26S protease regulatory subunit 8...    382   9e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004139327.1|  PREDICTED: 26S protease regulatory subunit 8...    382   1e-127   Cucumis sativus [cucumbers]
ref|XP_004149888.1|  PREDICTED: 26S protease regulatory subunit 8...    382   1e-127   Cucumis sativus [cucumbers]
gb|KJB64819.1|  hypothetical protein B456_010G066600                    382   1e-127   Gossypium raimondii
ref|XP_010049955.1|  PREDICTED: 26S protease regulatory subunit 8...    382   1e-127   Eucalyptus grandis [rose gum]
ref|XP_008785391.1|  PREDICTED: 26S protease regulatory subunit 8...    382   1e-127   Phoenix dactylifera
ref|XP_010420827.1|  PREDICTED: 26S protease regulatory subunit 8...    382   1e-127   Camelina sativa [gold-of-pleasure]
ref|XP_007013331.1|  Regulatory particle triple-A ATPase 6A             382   1e-127   Theobroma cacao [chocolate]
gb|KJB83166.1|  hypothetical protein B456_013G232600                    382   1e-127   Gossypium raimondii
ref|XP_007135858.1|  hypothetical protein PHAVU_010G164000g             382   1e-127   Phaseolus vulgaris [French bean]
gb|KHG13670.1|  26S protease regulatory subunit 8 A -like protein       382   1e-127   Gossypium arboreum [tree cotton]
ref|XP_008457948.1|  PREDICTED: 26S protease regulatory subunit 8...    382   1e-127   Cucumis melo [Oriental melon]
ref|XP_010914939.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   
ref|XP_008375711.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Malus domestica [apple tree]
ref|XP_010925261.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Elaeis guineensis
ref|XP_009131763.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Brassica rapa
ref|XP_006451010.1|  hypothetical protein CICLE_v10008422mg             382   2e-127   Citrus clementina [clementine]
ref|XP_008344058.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Malus domestica [apple tree]
ref|XP_009376844.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Pyrus x bretschneideri [bai li]
ref|XP_012078707.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Jatropha curcas
ref|XP_008792112.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Phoenix dactylifera
ref|XP_009337249.1|  PREDICTED: 26S protease regulatory subunit 8...    382   2e-127   Pyrus x bretschneideri [bai li]
gb|EYU24670.1|  hypothetical protein MIMGU_mgv1a007142mg                382   2e-127   Erythranthe guttata [common monkey flower]
gb|KHN39373.1|  26S protease regulatory subunit 8 like A                382   2e-127   Glycine soja [wild soybean]
ref|XP_006584548.1|  PREDICTED: uncharacterized protein LOC100776...    382   2e-127   
ref|NP_001241552.1|  uncharacterized protein LOC100812783               381   2e-127   Glycine max [soybeans]
ref|XP_009120838.1|  PREDICTED: 26S protease regulatory subunit 8...    381   2e-127   Brassica rapa
gb|KEH31238.1|  26S proteasome regulatory particle triple-A ATPas...    381   3e-127   Medicago truncatula
gb|ACL53562.1|  unknown                                                 381   3e-127   Zea mays [maize]
ref|XP_004239281.1|  PREDICTED: 26S protease regulatory subunit 8...    381   3e-127   Solanum lycopersicum
gb|AAF27916.1|AF220199_1  26S proteasome regulatory subunit 8           382   3e-127   Pinus taeda
ref|XP_004504777.1|  PREDICTED: 26S protease regulatory subunit 8...    381   3e-127   Cicer arietinum [garbanzo]
gb|KJB83167.1|  hypothetical protein B456_013G232600                    380   3e-127   Gossypium raimondii
ref|XP_006338168.1|  PREDICTED: 26S protease regulatory subunit 8...    381   3e-127   Solanum tuberosum [potatoes]
gb|ACN40682.1|  unknown                                                 382   3e-127   Picea sitchensis
dbj|BAJ99861.1|  predicted protein                                      381   4e-127   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004239282.1|  PREDICTED: 26S protease regulatory subunit 8...    381   4e-127   Solanum lycopersicum
gb|EPS65331.1|  hypothetical protein M569_09445                         381   4e-127   Genlisea aurea
gb|KHG30505.1|  26S protease regulatory subunit 8 A -like protein       380   5e-127   Gossypium arboreum [tree cotton]
gb|KJB54106.1|  hypothetical protein B456_009G020800                    380   5e-127   Gossypium raimondii
gb|AIZ74339.1|  26S proteasome regulatory subunit                       381   5e-127   Pinus massoniana [Chinese red pine]
ref|XP_003563677.1|  PREDICTED: 26S protease regulatory subunit 8...    380   1e-126   Brachypodium distachyon [annual false brome]
gb|AFK34159.1|  unknown                                                 380   1e-126   Medicago truncatula
emb|CDO98106.1|  unnamed protein product                                380   1e-126   Coffea canephora [robusta coffee]
ref|XP_010670712.1|  PREDICTED: 26S protease regulatory subunit 8...    378   3e-126   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK26248.1|  hypothetical protein AALP_AA8G222400                    379   4e-126   Arabis alpina [alpine rockcress]
ref|XP_006379809.1|  hypothetical protein POPTR_0008s14310g             378   6e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010688096.1|  PREDICTED: 26S protease regulatory subunit 8...    377   7e-126   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW66094.1|  hypothetical protein ZEAMMB73_419750                    379   8e-126   
gb|EMT18785.1|  26S protease regulatory subunit 8                       375   1e-125   
ref|XP_002315825.2|  26S proteasome subunit 8 family protein            377   1e-125   Populus trichocarpa [western balsam poplar]
ref|XP_011021674.1|  PREDICTED: 26S protease regulatory subunit 8...    377   2e-125   Populus euphratica
ref|XP_002529369.1|  26S protease regulatory subunit, putative          375   2e-125   
ref|XP_002978587.1|  hypothetical protein SELMODRAFT_108927             374   3e-125   
dbj|BAA87070.2|  TAT-binding protein homolog                            376   3e-125   Matricaria chamomilla
ref|XP_002311569.2|  26S proteasome subunit 8 family protein            376   3e-125   
gb|EMS56105.1|  26S protease regulatory subunit 8-like protein A        375   3e-125   Triticum urartu
dbj|BAJ85508.1|  predicted protein                                      376   4e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003571095.2|  PREDICTED: 26S protease regulatory subunit 8...    375   5e-125   Brachypodium distachyon [annual false brome]
ref|XP_006656207.1|  PREDICTED: 26S protease regulatory subunit 8...    375   6e-125   Oryza brachyantha
ref|XP_004490469.1|  PREDICTED: 26S protease regulatory subunit 8...    375   6e-125   Cicer arietinum [garbanzo]
ref|XP_011025256.1|  PREDICTED: 26S protease regulatory subunit 8...    375   1e-124   Populus euphratica
ref|XP_002994774.1|  hypothetical protein SELMODRAFT_139105             372   1e-124   
ref|NP_001057999.1|  Os06g0600100                                       375   1e-124   
gb|EEC80919.1|  hypothetical protein OsI_23597                          374   2e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_002970508.1|  hypothetical protein SELMODRAFT_441130             373   2e-124   Selaginella moellendorffii
emb|CDY44958.1|  BnaA02g04630D                                          383   5e-124   Brassica napus [oilseed rape]
gb|AAG42150.1|  26S proteasome RPT6a subunit                            374   8e-124   Dactylis glomerata [cocksfoot]
emb|CDY42324.1|  BnaC02g09300D                                          380   8e-123   Brassica napus [oilseed rape]
ref|XP_010541726.1|  PREDICTED: 26S protease regulatory subunit 8...    372   9e-123   Tarenaya hassleriana [spider flower]
ref|XP_002437236.1|  hypothetical protein SORBIDRAFT_10g023320          369   2e-122   Sorghum bicolor [broomcorn]
ref|XP_001778777.1|  26S proteasome regulatory complex, ATPase RPT6     367   1e-121   
ref|XP_004965964.1|  PREDICTED: 26S protease regulatory subunit 8...    365   5e-121   Setaria italica
ref|XP_010535884.1|  PREDICTED: 26S protease regulatory subunit 8...    363   4e-120   Tarenaya hassleriana [spider flower]
gb|AAC32150.1|  TAT-binding protein homolog                             350   1e-118   Picea mariana [black spruce]
ref|XP_005644732.1|  26S proteasome AAA-ATPase subunit RPT6a            352   3e-116   Coccomyxa subellipsoidea C-169
ref|XP_010420832.1|  PREDICTED: 26S protease regulatory subunit 8...    343   5e-116   Camelina sativa [gold-of-pleasure]
ref|XP_005846786.1|  26S proteasome AAA-ATPase subunit RPT6a            350   5e-116   Chlorella variabilis
ref|XP_002951010.1|  26S proteasome regulatory complex                  350   3e-115   Volvox carteri f. nagariensis
emb|CAB63651.1|  26S proteasome subunit 8                               349   7e-115   Fagus sylvatica
ref|XP_011397854.1|  26S protease regulatory subunit 8-like prote...    344   4e-113   Auxenochlorella protothecoides
ref|XP_005705074.1|  AAA-type ATPase                                    344   6e-113   Galdieria sulphuraria
ref|XP_002023000.1|  GL16409                                            339   8e-113   
gb|KDD77137.1|  AAA+ ATPase                                             343   1e-112   Helicosporidium sp. ATCC 50920
gb|AAU84927.1|  putative 26S protease regulatory subunit 8              343   2e-112   Aphis citricidus
ref|XP_003287255.1|  26S proteasome subunit ATPase 5                    342   2e-112   Dictyostelium purpureum
ref|XP_001943740.1|  PREDICTED: 26S protease regulatory subunit 8       343   2e-112   Acyrthosiphon pisum
gb|EIE88480.1|  26S protease regulatory subunit 8                       341   3e-112   Rhizopus delemar RA 99-880
gb|EDM06377.1|  peptidase (prosome, macropain) 26S subunit, ATPas...    336   4e-112   Rattus norvegicus [brown rat]
gb|KHN38098.1|  26S protease regulatory subunit 8 like A                349   4e-112   Glycine soja [wild soybean]
gb|EIE87521.1|  26S protease regulatory subunit 8                       341   7e-112   Rhizopus delemar RA 99-880
gb|EDM06376.1|  peptidase (prosome, macropain) 26S subunit, ATPas...    336   9e-112   Rattus norvegicus [brown rat]
gb|AAB88187.1|  similar to 26S proteasome subunit p45                   337   9e-112   Homo sapiens [man]
emb|CEP15966.1|  hypothetical protein                                   341   9e-112   Parasitella parasitica
gb|ACO12128.1|  26S protease regulatory subunit 8                       341   1e-111   Lepeophtheirus salmonis
emb|CEG67285.1|  Putative P-loop containing nucleoside triphospha...    340   1e-111   Rhizopus microsporus
gb|EPB86422.1|  26S protease regulatory subunit 8                       340   1e-111   Mucor circinelloides f. circinelloides 1006PhL
emb|CEF68527.1|  Proteasome (Prosome, macropain) 26S subunit, ATP...    341   1e-111   Strongyloides ratti
gb|KDR20973.1|  hypothetical protein L798_04485                         340   2e-111   Zootermopsis nevadensis
ref|XP_001649429.1|  AAEL014723-PA                                      340   2e-111   Aedes aegypti
gb|EFX79350.1|  hypothetical protein DAPPUDRAFT_52572                   340   2e-111   Daphnia pulex
ref|XP_004926152.1|  PREDICTED: 26S protease regulatory subunit 8...    340   2e-111   Bombyx mori [silk moth]
dbj|BAM18224.1|  26S protease regulatory subunit                        340   2e-111   Papilio xuthus [Chinese swallowtail]
ref|XP_003398987.1|  PREDICTED: 26S protease regulatory subunit 8...    340   2e-111   Bombus terrestris [large earth bumblebee]
ref|XP_011708228.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Wasmannia auropunctata
ref|XP_006564449.1|  PREDICTED: 26S protease regulatory subunit 8...    340   2e-111   
ref|XP_011341411.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Ooceraea biroi
ref|XP_011260528.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Camponotus floridanus
ref|XP_001870728.1|  26S protease regulatory subunit 8                  340   2e-111   Culex quinquefasciatus
ref|XP_008545433.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Microplitis demolitor
ref|XP_001967051.1|  GF21725                                            340   2e-111   Drosophila ananassae
sp|P54814.1|PRS8_MANSE  RecName: Full=26S protease regulatory sub...    340   2e-111   Manduca sexta [Carolina sphinx]
ref|XP_011059922.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Acromyrmex echinatior
gb|EHJ76020.1|  26S protease regulatory subunit 8                       340   2e-111   
ref|XP_002011885.1|  GI14329                                            340   2e-111   Drosophila mojavensis
ref|XP_001355733.1|  GA13327                                            340   2e-111   Drosophila pseudoobscura pseudoobscura
ref|XP_002067234.1|  GK16292                                            340   2e-111   Drosophila willistoni
ref|XP_011154641.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Harpegnathos saltator
gb|AAC48284.1|  DUG                                                     340   2e-111   Drosophila melanogaster
ref|XP_011303291.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Fopius arisanus
ref|XP_005181458.1|  PREDICTED: 26S protease regulatory subunit 8       340   2e-111   Musca domestica
ref|XP_001991849.1|  GH11847                                            340   2e-111   Drosophila grimshawi
gb|EXX51895.1|  proteasome regulatory particle base subunit RPT6        340   2e-111   Rhizophagus irregularis DAOM 197198w
ref|XP_002037380.1|  GM12144                                            340   2e-111   Drosophila sechellia
ref|XP_002055458.1|  GJ19383                                            340   2e-111   Drosophila virilis
ref|XP_002105532.1|  GD16958                                            340   3e-111   Drosophila simulans
ref|XP_001978679.1|  GG19719                                            340   3e-111   Drosophila erecta
gb|KFB40364.1|  AGAP007243-PA-like protein                              340   3e-111   Anopheles sinensis
ref|XP_011497497.1|  PREDICTED: 26S protease regulatory subunit 8       340   3e-111   Ceratosolen solmsi marchali
ref|NP_608447.1|  regulatory particle triple-A ATPase 6                 340   3e-111   Drosophila melanogaster
ref|XP_972551.1|  PREDICTED: 26S protease regulatory subunit 8          340   3e-111   Tribolium castaneum [rust-red flour beetle]
ref|XP_004535085.1|  PREDICTED: 26S protease regulatory subunit 8...    340   3e-111   
gb|EDM06375.1|  peptidase (prosome, macropain) 26S subunit, ATPas...    337   3e-111   Rattus norvegicus [brown rat]
gb|AAH04052.1|  Psmc5 protein                                           336   3e-111   Mus musculus [mouse]
ref|XP_308557.2|  AGAP007243-PA                                         340   3e-111   Anopheles gambiae str. PEST
gb|EGI70168.1|  26S protease regulatory subunit 8                       340   3e-111   Acromyrmex echinatior
gb|ETN68121.1|  26S protease regulatory subunit                         340   4e-111   Anopheles darlingi [American malaria mosquito]
gb|AEE62443.1|  unknown                                                 340   4e-111   Dendroctonus ponderosae
ref|XP_005834377.1|  26S proteasome regulatory complex, ATPase RPT6     339   4e-111   Guillardia theta CCMP2712
ref|XP_003740119.1|  PREDICTED: 26S protease regulatory subunit 8...    340   5e-111   Galendromus occidentalis
ref|XP_007072058.1|  PREDICTED: 26S protease regulatory subunit 8       337   5e-111   
ref|XP_008471380.1|  PREDICTED: 26S protease regulatory subunit 8       339   5e-111   Diaphorina citri
ref|XP_007527730.1|  PREDICTED: 26S protease regulatory subunit 8       336   6e-111   
emb|CDX88865.1|  BnaA03g07840D                                          346   6e-111   
gb|EDL34283.1|  protease (prosome, macropain) 26S subunit, ATPase...    336   6e-111   Mus musculus [mouse]
gb|EFA09518.1|  hypothetical protein TcasGA2_TC011620                   340   8e-111   
ref|XP_002099414.1|  GE23375                                            338   9e-111   Drosophila yakuba
ref|XP_001608055.1|  PREDICTED: 26S protease regulatory subunit 8       338   9e-111   Nasonia vitripennis
ref|NP_651811.1|  regulatory particle triple-A ATPase 6-related         338   1e-110   Drosophila melanogaster
ref|XP_001981178.1|  GG11925                                            338   1e-110   Drosophila erecta
gb|EOA97184.1|  26S protease regulatory subunit 8                       337   1e-110   Anas platyrhynchos [duck]
gb|ERL90778.1|  hypothetical protein D910_08124                         338   1e-110   Dendroctonus ponderosae
gb|EFB27243.1|  hypothetical protein PANDA_013936                       336   1e-110   Ailuropoda melanoleuca
dbj|BAA22935.1|  proteasome p45/SUG                                     337   2e-110   Rattus norvegicus [brown rat]
ref|XP_002423806.1|  26S protease regulatory subunit, putative          338   2e-110   Pediculus humanus corporis [human body lice]
ref|XP_011558016.1|  PREDICTED: 26S protease regulatory subunit 8       338   2e-110   Plutella xylostella [cabbage moth]
gb|ENN73378.1|  hypothetical protein YQE_10005                          338   2e-110   Dendroctonus ponderosae
ref|XP_001786865.1|  predicted protein                                  329   2e-110   
gb|EAW94269.1|  proteasome (prosome, macropain) 26S subunit, ATPa...    337   2e-110   Homo sapiens [man]
ref|XP_007255206.1|  PREDICTED: 26S protease regulatory subunit 8...    337   2e-110   
emb|CBY22717.1|  unnamed protein product                                339   2e-110   Oikopleura dioica
ref|XP_011604416.1|  PREDICTED: 26S protease regulatory subunit 8...    338   2e-110   
ref|XP_011925997.1|  PREDICTED: 26S protease regulatory subunit 8...    337   2e-110   Cercocebus atys
ref|XP_005668738.1|  PREDICTED: 26S protease regulatory subunit 8...    338   2e-110   Sus scrofa [pigs]
ref|XP_008691830.1|  PREDICTED: 26S protease regulatory subunit 8...    337   2e-110   Ursus maritimus [white bear]
ref|XP_010207663.1|  PREDICTED: 26S protease regulatory subunit 8       337   3e-110   Colius striatus
ref|NP_001279851.1|  proteasome (prosome, macropain) 26S subunit,...    337   3e-110   Callorhinchus milii [Australian ghost shark]
gb|KFM60482.1|  26S protease regulatory subunit 8                       338   3e-110   Stegodyphus mimosarum
ref|NP_001186092.1|  26S protease regulatory subunit 8 isoform 2        337   3e-110   Homo sapiens [man]
ref|XP_008311950.1|  PREDICTED: 26S protease regulatory subunit 8...    337   3e-110   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_009094856.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    337   3e-110   
gb|EHH58251.1|  hypothetical protein EGM_08055                          337   3e-110   Macaca fascicularis [crab eating macaque]
ref|XP_006722043.1|  PREDICTED: 26S protease regulatory subunit 8...    337   3e-110   
ref|XP_006807591.1|  PREDICTED: 26S protease regulatory subunit 8...    337   3e-110   Neolamprologus brichardi [lyretail cichlid]
ref|XP_009077704.1|  PREDICTED: 26S protease regulatory subunit 8       337   3e-110   Acanthisitta chloris
gb|ETE70098.1|  26S protease regulatory subunit 8                       337   3e-110   Ophiophagus hannah
ref|XP_011366835.1|  PREDICTED: 26S protease regulatory subunit 8...    337   3e-110   Pteropus vampyrus
ref|XP_005753574.1|  PREDICTED: 26S protease regulatory subunit 8...    337   3e-110   Pundamilia nyererei
ref|NP_001279980.1|  proteasome (prosome, macropain) 26S subunit,...    337   3e-110   Falco peregrinus [peregrine]
ref|XP_006833639.1|  PREDICTED: 26S protease regulatory subunit 8       337   3e-110   Chrysochloris asiatica
ref|NP_001003740.1|  26S protease regulatory subunit 8                  337   4e-110   Danio rerio [leopard danio]
gb|AFM89751.1|  26S protease regulatory subunit 8-like protein          337   4e-110   Callorhinchus milii [Australian ghost shark]
ref|XP_003414376.1|  PREDICTED: 26S protease regulatory subunit 8       337   4e-110   Loxodonta africana [African bush elephant]
ref|XP_006886352.1|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005496491.1|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Zonotrichia albicollis
ref|XP_005753575.1|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Pundamilia nyererei
ref|XP_008633469.1|  PREDICTED: 26S protease regulatory subunit 8       337   4e-110   
ref|NP_001279996.1|  proteasome (prosome, macropain) 26S subunit,...    337   4e-110   Alligator mississippiensis
ref|XP_009189269.1|  PREDICTED: 26S protease regulatory subunit 8       337   4e-110   
ref|XP_007255205.1|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Astyanax mexicanus [blind cave fish]
gb|AAV38531.1|  proteasome (prosome, macropain) 26S subunit, ATPa...    337   4e-110   synthetic construct
ref|XP_001376943.2|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Monodelphis domestica
ref|XP_008281791.1|  PREDICTED: 26S protease regulatory subunit 8       337   4e-110   Stegastes partitus
ref|NP_001085482.1|  proteasome (prosome, macropain) 26S subunit,...    337   4e-110   Xenopus laevis [clawed frog]
ref|XP_004575488.1|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Maylandia zebra
ref|XP_003961613.1|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Takifugu rubripes [tiger puffer]
ref|XP_006000215.1|  PREDICTED: 26S protease regulatory subunit 8...    337   4e-110   Latimeria chalumnae
ref|XP_006092214.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    337   4e-110   Myotis lucifugus
ref|NP_001279985.1|  proteasome (prosome, macropain) 26S subunit,...    337   4e-110   Myotis brandtii
ref|XP_005070074.1|  PREDICTED: 26S protease regulatory subunit 8       337   4e-110   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003222519.1|  PREDICTED: 26S protease regulatory subunit 8       337   4e-110   Anolis carolinensis [Carolina anole]
ref|XP_003501915.2|  PREDICTED: 26S protease regulatory subunit 8       337   4e-110   
gb|ELR44943.1|  26S protease regulatory subunit 8                       337   4e-110   Bos mutus
gb|EDM06373.1|  peptidase (prosome, macropain) 26S subunit, ATPas...    337   5e-110   Rattus norvegicus [brown rat]
ref|XP_003441913.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   Oreochromis niloticus
ref|XP_007543031.1|  PREDICTED: 26S protease regulatory subunit 8       337   5e-110   Poecilia formosa
ref|NP_001280016.1|  proteasome (prosome, macropain) 26S subunit,...    337   5e-110   Python bivittatus
gb|AAH77223.1|  Unknown (protein for MGC:79055)                         337   5e-110   Xenopus laevis [clawed frog]
ref|XP_010743473.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   
ref|XP_007957923.1|  PREDICTED: 26S protease regulatory subunit 8       337   5e-110   Orycteropus afer afer
ref|XP_006638172.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   Lepisosteus oculatus
dbj|BAA07919.1|  26S proteasome subunit p45                             337   5e-110   Homo sapiens [man]
ref|NP_032976.1|  26S protease regulatory subunit 8                     337   5e-110   Mus musculus [mouse]
ref|XP_002588921.1|  hypothetical protein BRAFLDRAFT_125428             337   5e-110   Branchiostoma floridae
ref|XP_005369493.1|  PREDICTED: 26S protease regulatory subunit 8       337   5e-110   Microtus ochrogaster [prairie voles]
ref|NP_001232710.1|  proteasome (prosome, macropain) 26S subunit,...    337   5e-110   Taeniopygia guttata
ref|NP_001278998.1|  26S protease regulatory subunit 8                  337   5e-110   Gallus gallus [bantam]
ref|XP_010743472.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   
ref|XP_008434961.1|  PREDICTED: 26S protease regulatory subunit 8       337   5e-110   Poecilia reticulata
ref|XP_006000216.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   Latimeria chalumnae
ref|XP_004080302.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   
ref|XP_006638171.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   
ref|XP_005812784.1|  PREDICTED: 26S protease regulatory subunit 8...    337   5e-110   Xiphophorus maculatus
ref|XP_004013072.1|  PREDICTED: 26S protease regulatory subunit 8       337   6e-110   Ovis aries [domestic sheep]
ref|XP_005858700.1|  PREDICTED: 26S protease regulatory subunit 8...    337   6e-110   Myotis brandtii
ref|XP_008311949.1|  PREDICTED: 26S protease regulatory subunit 8...    337   6e-110   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005025420.1|  PREDICTED: 26S protease regulatory subunit 8       337   6e-110   
ref|XP_007175820.1|  PREDICTED: 26S protease regulatory subunit 8...    336   6e-110   
ref|NP_989358.1|  proteasome (prosome, macropain) 26S subunit, AT...    337   6e-110   Xenopus tropicalis [western clawed frog]
ref|XP_006776774.1|  PREDICTED: 26S protease regulatory subunit 8...    337   6e-110   Myotis davidii
gb|ELU08778.1|  hypothetical protein CAPTEDRAFT_183959                  337   6e-110   Capitella teleta
ref|XP_007104592.1|  PREDICTED: 26S protease regulatory subunit 8...    336   7e-110   
ref|XP_009928195.1|  PREDICTED: 26S protease regulatory subunit 8       336   7e-110   Haliaeetus albicilla
ref|XP_003702455.1|  PREDICTED: 26S protease regulatory subunit 8       336   9e-110   Megachile rotundata
ref|XP_009997639.1|  PREDICTED: 26S protease regulatory subunit 8       335   9e-110   Chaetura pelagica
emb|CDS09166.1|  Putative 26S protease regulatory subunit 8             335   1e-109   
ref|NP_001270686.1|  uncharacterized protein LOC101865051               335   1e-109   
ref|XP_010153733.1|  PREDICTED: 26S protease regulatory subunit 8       335   1e-109   
gb|ACO09830.1|  26S protease regulatory subunit 8                       335   1e-109   
ref|XP_007088322.1|  PREDICTED: 26S protease regulatory subunit 8...    337   2e-109   
ref|XP_001641587.1|  predicted protein                                  335   2e-109   
ref|XP_005624306.1|  PREDICTED: 26S protease regulatory subunit 8...    337   2e-109   
gb|ACQ58243.1|  26S protease regulatory subunit 8                       335   2e-109   
ref|XP_010615042.1|  PREDICTED: 26S protease regulatory subunit 8...    337   2e-109   
emb|CBN81418.1|  26S protease regulatory subunit 8                      335   2e-109   
gb|ELK12471.1|  26S protease regulatory subunit 8                       337   2e-109   
emb|CDP93276.1|  Protein Bm13756, isoform c                             330   3e-109   
ref|XP_006940547.1|  PREDICTED: 26S protease regulatory subunit 8...    335   3e-109   
gb|EJW74670.1|  26S protease regulatory subunit 8                       330   3e-109   
ref|XP_010778828.1|  PREDICTED: 26S protease regulatory subunit 8       334   4e-109   
gb|AAG41119.1|AF115331_1  26S protease regulatory subunit               327   4e-109   
ref|XP_002054061.1|  GJ23001                                            334   5e-109   
ref|XP_001964693.1|  GF23322                                            334   5e-109   
ref|XP_009014724.1|  hypothetical protein HELRODRAFT_76345              334   6e-109   
ref|XP_002001184.1|  GI10644                                            334   6e-109   
dbj|BAB26990.1|  unnamed protein product                                334   6e-109   
ref|XP_005949341.1|  PREDICTED: 26S protease regulatory subunit 8...    335   8e-109   
ref|XP_005949342.1|  PREDICTED: 26S protease regulatory subunit 8...    335   8e-109   
ref|XP_010862883.1|  PREDICTED: 26S protease regulatory subunit 8       333   9e-109   
ref|XP_007104593.1|  PREDICTED: 26S protease regulatory subunit 8...    333   1e-108   
ref|XP_003138569.1|  26S protease regulatory subunit 8                  333   1e-108   
ref|NP_001127417.1|  26S protease regulatory subunit 8                  333   2e-108   
ref|XP_009047076.1|  hypothetical protein LOTGIDRAFT_138721             332   2e-108   
gb|EHB07350.1|  26S protease regulatory subunit 8                       337   2e-108   
ref|XP_011435912.1|  PREDICTED: 26S protease regulatory subunit 8       333   2e-108   
ref|XP_001895811.1|  26S protease regulatory subunit 8                  331   2e-108   
ref|XP_741049.1|  tat-binding protein                                   325   2e-108   
ref|XP_002501348.1|  proteasomal ATPase                                 332   3e-108   
ref|XP_002641019.1|  C. briggsae CBR-RPT-6 protein                      333   3e-108   
ref|XP_003698467.1|  PREDICTED: 26S protease regulatory subunit 8...    332   3e-108   
gb|ABB13463.1|  26S proteasome subunit RPT6                             331   4e-108   
gb|EGT53541.1|  hypothetical protein CAEBREN_19051                      332   4e-108   
gb|EGT47270.1|  hypothetical protein CAEBREN_10399                      332   4e-108   
ref|XP_002780060.1|  tat-binding protein, putative                      332   4e-108   
ref|XP_003062429.1|  proteasomal ATPase                                 332   4e-108   
ref|XP_002772340.1|  tat-binding protein, putative                      332   5e-108   
ref|NP_499609.1|  Protein RPT-6                                         332   5e-108   
ref|XP_002137338.1|  GA26607                                            332   5e-108   
ref|XP_009286152.1|  PREDICTED: 26S protease regulatory subunit 8...    331   5e-108   
ref|NP_001081635.1|  26S protease regulatory subunit 8                  333   5e-108   
emb|CDP93275.1|  Protein Bm13756, isoform a                             332   5e-108   
dbj|BAE88251.1|  unnamed protein product                                332   5e-108   
ref|XP_001416582.1|  predicted protein                                  331   5e-108   
gb|EPY86421.1|  26S protease regulatory subunit 8 isoform 8             335   6e-108   
emb|CAH91432.1|  hypothetical protein                                   331   6e-108   
ref|XP_005091123.1|  PREDICTED: 26S protease regulatory subunit 8...    331   8e-108   
gb|AAC41735.1|  thyroid receptor interactor                             331   1e-107   
ref|XP_002131047.2|  PREDICTED: 26S protease regulatory subunit 8       334   1e-107   
ref|XP_003383665.1|  PREDICTED: 26S protease regulatory subunit 8       330   1e-107   
emb|CDH58931.1|  26s protease regulatory subunit 8                      337   2e-107   
emb|CAX76058.1|  Tat-binding protein 10                                 330   2e-107   
ref|XP_003882870.1|  26S proteasome regulatory subunit S4 like AA...    329   2e-107   
ref|XP_784151.4|  PREDICTED: 26S protease regulatory subunit 8          330   2e-107   
emb|CDS31889.1|  26S protease regulatory subunit 8                      332   2e-107   
ref|NP_001188134.1|  26S protease regulatory subunit 8                  331   2e-107   
emb|CDS35918.1|  26S protease regulatory subunit 8                      330   3e-107   
emb|CEF97024.1|  26S proteasome subunit P45                             330   3e-107   
gb|AFW66097.1|  hypothetical protein ZEAMMB73_419750                    320   3e-107   
emb|CAX76059.1|  Tat-binding protein 10                                 330   3e-107   
emb|CDS22728.1|  26S protease regulatory subunit 8                      330   4e-107   
ref|XP_008882965.1|  tat-binding family protein, putative               329   5e-107   
emb|CCI49769.1|  unnamed protein product                                329   5e-107   
ref|XP_002365254.1|  26S protease regulatory subunit 8, putative        329   5e-107   
emb|CDH58930.1|  26s protease regulatory subunit 8                      337   5e-107   
ref|XP_001734886.1|  26S protease regulatory subunit                    328   7e-107   
ref|XP_002647983.1|  Hypothetical protein CBG23920                      324   7e-107   
emb|CAP20654.2|  Protein CBG23920                                       323   7e-107   
ref|XP_001734800.1|  26S protease regulatory subunit                    328   8e-107   
ref|XP_010420829.1|  PREDICTED: 26S protease regulatory subunit 8...    320   8e-107   
ref|XP_008866523.1|  26S protease regulatory subunit 8                  328   9e-107   
ref|XP_002262561.1|  tat-binding-like protein                           329   9e-107   
ref|XP_008346705.1|  PREDICTED: 26S protease regulatory subunit 8...    328   1e-106   
ref|XP_649078.1|  26S protease regulatory subunit                       328   1e-106   
dbj|BAN38562.1|  26S protease regulatory subunit, putative              328   1e-106   
ref|XP_002140070.1|  26S protease regulatory subunit 8                  328   1e-106   
ref|XP_009166026.1|  hypothetical protein T265_13205                    328   1e-106   
ref|XP_001614014.1|  26S protease regulatory subunit 8                  328   1e-106   
ref|XP_004997758.1|  peptidase 26S subunit                              328   1e-106   
gb|AAW27345.1|  SJCHGC09272 protein                                     328   2e-106   
gb|KDO34339.1|  hypothetical protein SPRG_01475                         323   2e-106   
emb|CCA23809.1|  conserved unknown protein putative                     328   2e-106   
gb|KFD51250.1|  hypothetical protein M513_07850                         327   2e-106   
ref|XP_003078024.1|  26S proteasome regulatory complex, ATPase RP...    328   2e-106   
ref|XP_001350873.1|  tat-binding protein homolog                        328   2e-106   
ref|XP_004260558.1|  26S protease regulatory subunit, putative          327   2e-106   
emb|CDO65761.1|  26S protease regulatory subunit 8, putative            328   3e-106   
emb|CDU20987.1|  26S protease regulatory subunit 8, putative            327   4e-106   
gb|ETB62047.1|  26S protease regulatory subunit 8                       327   4e-106   
ref|XP_005535327.1|  26S proteasome ATP-dependent regulatory subunit    326   5e-106   
ref|XP_008901335.1|  26S protease regulatory subunit 8                  326   6e-106   
gb|EPY39153.1|  26S proteasome regulatory subunit T6                    323   6e-106   
gb|ETI52811.1|  26S protease regulatory subunit 8                       326   6e-106   
gb|EUD74697.1|  26S protease regulatory subunit 8 like A                327   6e-106   
ref|XP_009529425.1|  hypothetical protein PHYSODRAFT_546373             326   6e-106   
ref|XP_006682141.1|  26S protease subunit                               326   6e-106   
ref|XP_675910.1|  tat-binding protein                                   327   6e-106   
ref|NP_741099.1|  Protein F56F11.4, isoform a                           326   7e-106   
ref|XP_008622617.1|  26S protease regulatory subunit 8 like A           327   7e-106   
pir||S51042  tat-binding protein homolog - malaria parasite (Plas...    327   8e-106
ref|XP_008818762.1|  26S protease regulatory subunit 8 like A           327   9e-106   
gb|AEQ34995.1|  26S protease regulatory subunit 8                       318   9e-106   
gb|KHJ42528.1|  26S proteasome subunit P45 family protein               327   1e-105   
ref|XP_009694446.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    326   1e-105   
ref|XP_002909192.1|  26S protease regulatory subunit 8                  325   2e-105   
ref|XP_001995904.1|  GH14117                                            325   2e-105   
ref|NP_741098.1|  Protein F56F11.4, isoform b                           326   2e-105   
gb|EFA79359.1|  26S proteasome subunit ATPase 5                         325   2e-105   
ref|XP_001009196.2|  26S proteasome subunit P45 family protein          325   2e-105   
ref|XP_002675948.1|  26S proteosome subunit P45                         325   2e-105   
ref|XP_003114915.1|  hypothetical protein CRE_28272                     325   2e-105   
gb|EIF46002.1|  26s protease regulatory subunit 8                       323   2e-105   
dbj|BAN42316.1|  26S protease regulatory subunit, putative              324   3e-105   
ref|XP_002646506.1|  Hypothetical protein CBG20339                      325   3e-105   
sp|Q25544.1|PRS8_NAEFO  RecName: Full=26S protease regulatory sub...    325   3e-105   
ref|XP_003378582.1|  26S protease regulatory subunit 8                  322   4e-105   
pir||T33633  hypothetical protein F56F11.4 - Caenorhabditis elegans     325   4e-105
ref|XP_001388307.1|  26s protease regulatory subunit 8                  324   4e-105   
ref|XP_009823671.1|  26S protease regulatory subunit 8                  323   5e-105   
gb|ESL11298.1|  proteasome regulatory ATPase subunit                    323   6e-105   
dbj|BAN42462.1|  26S protease regulatory subunit, putative              323   6e-105   
gb|ERG85894.1|  26s protease regulatory subunit 8                       323   7e-105   
gb|EPY30871.1|  26S proteasome regulatory subunit T6                    322   7e-105   
ref|XP_001569078.1|  proteasome regulatory ATPase subunit               323   9e-105   
ref|XP_001470007.1|  proteasome regulatory ATPase subunit               323   1e-104   
ref|XP_002489693.1|  One of six ATPases of the 19S regulatory par...    322   1e-104   
ref|XP_003874794.1|  proteasome regulatory ATPase subunit               323   1e-104   
gb|EPY43158.1|  26S proteasome regulatory subunit T6                    323   1e-104   
gb|KIW85266.1|  26S protease regulatory subunit 8                       322   1e-104   
dbj|GAM29492.1|  hypothetical protein SAMD00019534_126680               322   1e-104   
gb|EPY22683.1|  26S proteasome regulatory subunit T6                    323   1e-104   
emb|CBN80092.1|  conserved unknown protein                              322   2e-104   
ref|XP_004575485.1|  PREDICTED: 26S protease regulatory subunit 8...    323   2e-104   
emb|CCA36512.1|  26S protease regulatory subunit 8                      322   2e-104   
gb|EMP24271.1|  26S protease regulatory subunit 8                       321   2e-104   
ref|XP_004575486.1|  PREDICTED: 26S protease regulatory subunit 8...    323   2e-104   
gb|EWM22455.1|  26s protease regulatory subunit 8                       323   2e-104   
ref|XP_004575484.1|  PREDICTED: 26S protease regulatory subunit 8...    323   2e-104   
ref|XP_001687020.1|  proteasome regulatory ATPase subunit               322   2e-104   
ref|XP_004575483.1|  PREDICTED: 26S protease regulatory subunit 8...    323   3e-104   
gb|ABI14281.1|  ATP-dependent 26S proteasome regulatory subunit         322   4e-104   
ref|XP_011486302.1|  PREDICTED: 26S protease regulatory subunit 8...    322   4e-104   
emb|CCC51911.1|  putative 19S proteasome regulatory subunit             322   4e-104   
gb|EKF36782.1|  proteasome regulatory ATPase subunit 2, putative        322   5e-104   
ref|XP_007748908.1|  26S protease regulatory subunit 8 like A           321   5e-104   
ref|XP_009307164.1|  putative 19S proteasome regulatory subunit         321   6e-104   
ref|XP_011486301.1|  PREDICTED: 26S protease regulatory subunit 8...    322   6e-104   
ref|XP_819842.1|  proteasome regulatory ATPase subunit                  321   6e-104   
gb|KIW32462.1|  26S protease regulatory subunit 8                       320   7e-104   
gb|EKG04192.1|  proteasome regulatory ATPase subunit 2, putative        321   7e-104   
ref|XP_004037554.1|  hypothetical protein IMG5_049440                   320   8e-104   
gb|ESW98631.1|  26S protease regulatory subunit 8                       320   9e-104   
ref|XP_823196.1|  proteasome regulatory ATPase subunit 6                321   1e-103   
ref|XP_007729701.1|  26S protease regulatory subunit 8                  320   1e-103   
gb|KIV89900.1|  26S protease regulatory subunit 8                       320   1e-103   
ref|XP_001225963.1|  hypothetical protein CHGG_08307                    315   1e-103   
ref|XP_007757915.1|  26S protease regulatory subunit 8                  320   1e-103   
ref|XP_008729350.1|  26S protease regulatory subunit 8                  320   1e-103   
ref|XP_011130217.1|  26S proteasome regulatory subunit                  318   1e-103   
gb|KIX02757.1|  26S protease regulatory subunit 8                       320   2e-103   
ref|XP_008711686.1|  26S protease regulatory subunit 8                  319   2e-103   
ref|XP_004948567.1|  PREDICTED: 26S protease regulatory subunit 8...    322   2e-103   
ref|XP_004350825.1|  26S proteasome subunit ATPase 5                    319   3e-103   
ref|XP_002835307.1|  hypothetical protein                               318   3e-103   
emb|CCE44632.1|  hypothetical protein CPAR2_404360                      319   3e-103   
emb|CDW87136.1|  26s protease regulatory subunit 8 homolog a-like       319   4e-103   
ref|XP_003853920.1|  proteasome regulatory particle subunit RPT6        318   4e-103   
ref|XP_003868648.1|  Rpt6 ATPase of the 19S regulatory particle o...    319   4e-103   
ref|XP_007679848.1|  hypothetical protein BAUCODRAFT_37896              318   4e-103   
ref|WP_028830662.1|  hypothetical protein                               318   4e-103   
ref|XP_001750050.1|  hypothetical protein                               319   4e-103   
ref|XP_007932487.1|  hypothetical protein MYCFIDRAFT_60582              318   4e-103   
gb|EPY49601.1|  19S proteasome regulatory subunit Rpt6                  319   5e-103   
gb|EFQ31197.1|  26S proteasome subunit P45 family protein               318   5e-103   
ref|XP_007918463.1|  putative 26s protease regulatory subunit 8 p...    318   5e-103   
gb|ERS95489.1|  26S protease regulatory subunit 8                       318   5e-103   
gb|KEY70327.1|  hypothetical protein S7711_06802                        318   5e-103   
gb|EGU74064.1|  hypothetical protein FOXB_15454                         318   5e-103   
ref|XP_007279260.1|  26s protease regulatory subunit 8                  318   6e-103   
ref|XP_007838108.1|  26S protease regulatory subunit 8                  318   6e-103   
ref|XP_007788467.1|  putative 26s protease regulatory subunit 8 p...    318   6e-103   
ref|XP_003049600.1|  26S proteasome regulatory complex, ATPase RPT6     318   6e-103   
gb|EFX06437.1|  26S protease regulatory subunit 8                       318   6e-103   
gb|KFY24149.1|  hypothetical protein V493_05402                         318   6e-103   
gb|KFX92447.1|  hypothetical protein O988_07270                         318   7e-103   
ref|XP_006691299.1|  26S protease regulatory subunit 8-like protein     318   7e-103   
gb|KIL86603.1|  hypothetical protein FAVG1_10433                        318   7e-103   
ref|XP_009261390.1|  hypothetical protein FPSE_09998                    318   7e-103   
ref|XP_007723356.1|  26S protease regulatory subunit 8                  318   7e-103   
gb|ELR01697.1|  26S protease regulatory subunit 8                       318   7e-103   
emb|CCC94085.1|  unnamed protein product                                318   9e-103   
ref|XP_003657348.1|  hypothetical protein THITE_2122931                 318   9e-103   
gb|EPE07133.1|  26s protease regulatory subunit 8                       317   9e-103   
emb|CCX08283.1|  Similar to 26S protease regulatory subunit 8; ac...    317   1e-102   
gb|KJZ71951.1|  26S protease regulatory subunit 8-like protein          317   1e-102   
emb|CDW58348.1|  26S protease regulatory subunit 8                      319   1e-102   
gb|KFH48413.1|  26S protease regulatory subunit-like protein            317   1e-102   
ref|XP_001608710.1|  tat-binding protein-like protein                   318   1e-102   
ref|XP_003346692.1|  hypothetical protein SMAC_04125                    317   1e-102   
ref|XP_003666532.1|  hypothetical protein MYCTH_2084256                 317   1e-102   
ref|XP_963354.1|  26S protease regulatory subunit 8                     317   1e-102   
ref|XP_003958041.1|  hypothetical protein KAFR_0F03100                  318   1e-102   
ref|XP_009223587.1|  26S protease regulatory subunit 8                  317   1e-102   
ref|XP_006966046.1|  predicted protein                                  317   1e-102   
gb|ELQ41963.1|  26S protease regulatory subunit 8                       317   1e-102   
gb|EHK16049.1|  hypothetical protein TRIVIDRAFT_184509                  317   1e-102   
ref|XP_009654355.1|  26S protease regulatory subunit 8                  317   1e-102   
gb|KDB19058.1|  26S protease regulatory subunit 8                       317   2e-102   
emb|CEJ94045.1|  Putative Protease regulatory subunit 8 homolog (...    317   2e-102   
ref|XP_008598242.1|  26S proteasome regulatory complex, ATPase RPT6     317   2e-102   
gb|KID96701.1|  ATPase Rpt6 of the 19S regulatory particle of the...    317   2e-102   
ref|XP_007824755.1|  ATPase Rpt6 of the 19S regulatory particle o...    317   2e-102   
gb|EME41214.1|  hypothetical protein DOTSEDRAFT_73588                   317   2e-102   
gb|EGT37310.1|  hypothetical protein CAEBREN_16307                      317   2e-102   
ref|XP_007585579.1|  putative 26s protease regulatory subunit 8 p...    317   2e-102   
gb|KJK74389.1|  hypothetical protein H634G_10296                        317   2e-102   
emb|CCE32558.1|  probable 26S protease subunit RPT6                     317   2e-102   



>gb|ABR25526.1| 26S protease regulatory subunit 8 [Oryza sativa Indica Group]
Length=208

 Score =   381 bits (979),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  20   LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  79

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  80   NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  139

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  140  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  199

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  200  NMSLRKLWK  208



>gb|AAF22526.1|AF123395_1 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis thaliana]
Length=405

 Score =   386 bits (991),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  217  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  277  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  337  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  396

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  397  NMSLRKLWK  405



>ref|XP_010520598.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Tarenaya 
hassleriana]
Length=418

 Score =   386 bits (992),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_002871914.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48173.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
Length=419

 Score =   386 bits (992),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_009760357.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Nicotiana 
sylvestris]
 ref|XP_009760362.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Nicotiana 
sylvestris]
Length=322

 Score =   382 bits (982),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  134  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  193

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  194  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  253

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  254  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  313

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  314  NMSLRKLWK  322



>ref|XP_002871915.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48174.1| ATSUG1 [Arabidopsis lyrata subsp. lyrata]
Length=419

 Score =   386 bits (991),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_007202157.1| hypothetical protein PRUPE_ppa006323mg [Prunus persica]
 ref|XP_008242710.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Prunus 
mume]
 gb|EMJ03356.1| hypothetical protein PRUPE_ppa006323mg [Prunus persica]
Length=417

 Score =   386 bits (991),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_004287374.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Fragaria 
vesca subsp. vesca]
Length=419

 Score =   386 bits (991),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSR+MN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRRMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_006287833.1| hypothetical protein CARUB_v10001052mg [Capsella rubella]
 gb|EOA20731.1| hypothetical protein CARUB_v10001052mg [Capsella rubella]
Length=419

 Score =   386 bits (991),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|NP_197500.1| AAA-type ATPase family protein [Arabidopsis thaliana]
 sp|Q94BQ2.1|PRS8B_ARATH RecName: Full=26S protease regulatory subunit 8 homolog B; AltName: 
Full=26S proteasome AAA-ATPase subunit RPT6b; AltName: 
Full=26S proteasome subunit 8 homolog B; AltName: Full=Regulatory 
particle triple-A ATPase subunit 6b [Arabidopsis thaliana]
 gb|AAK64142.1| putative 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis 
thaliana]
 gb|AAL85134.1| putative 26S proteasome AAA-ATPase subunit RPT6a [Arabidopsis 
thaliana]
 gb|AAM65046.1| 26S proteasome AAA-ATPase subunit RPT6a-like protein [Arabidopsis 
thaliana]
 dbj|BAE98371.1| 26S proteasome AAA-ATPase subunit RPT6a - like protein [Arabidopsis 
thaliana]
 gb|AED92778.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=419

 Score =   386 bits (991),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|NP_568389.1| regulatory particle triple-A ATPase 6A [Arabidopsis thaliana]
 sp|Q9C5U3.1|PRS8A_ARATH RecName: Full=26S protease regulatory subunit 8 homolog A; AltName: 
Full=26S proteasome AAA-ATPase subunit RPT6a; AltName: 
Full=26S proteasome subunit 8 homolog A; AltName: Full=Regulatory 
particle triple-A ATPase subunit 6a [Arabidopsis thaliana]
 dbj|BAB40755.1| AtSUG1 [Arabidopsis thaliana]
 gb|AAL38350.1| unknown protein [Arabidopsis thaliana]
 gb|AAP78936.1| At5g19990 [Arabidopsis thaliana]
 gb|AED92777.1| regulatory particle triple-A ATPase 6A [Arabidopsis thaliana]
Length=419

 Score =   385 bits (990),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_010454292.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Camelina 
sativa]
Length=419

 Score =   385 bits (990),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_006293475.1| hypothetical protein CARUB_v10023291mg [Capsella rubella]
 gb|ABW81135.1| unknown [Capsella rubella]
 gb|EOA26373.1| hypothetical protein CARUB_v10023291mg [Capsella rubella]
Length=419

 Score =   385 bits (989),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 188/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_011081123.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Sesamum 
indicum]
Length=417

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_002285273.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Vitis 
vinifera]
 emb|CBI36245.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   385 bits (988),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN ESRWDILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNGESRWDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_009590572.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Nicotiana 
tomentosiformis]
Length=418

 Score =   384 bits (987),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>gb|AGC54441.1| 26S proteasome ATPase regulatory subunit 6 [Capsicum annuum]
Length=417

 Score =   384 bits (987),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|KDO80361.1| hypothetical protein CISIN_1g014743mg [Citrus sinensis]
Length=270

 Score =   379 bits (973),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  82   LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  141

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  142  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  201

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+HVTQEDFEMAVAKVMKK+TEK
Sbjct  202  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETEK  261

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  262  NMSLRKLWK  270



>emb|CDP03399.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   384 bits (986),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  291

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  292  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  351

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  352  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  411

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  412  NMSLRKLWK  420



>gb|ABR18043.1| unknown [Picea sitchensis]
Length=288

 Score =   379 bits (974),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  100  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  159

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  160  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  219

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM+GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  220  LMRGIDLKKIAEKMSGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  279

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  280  NMSLRKLWK  288



>emb|CDY35832.1| BnaC09g37640D [Brassica napus]
Length=419

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_010254305.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Nelumbo 
nucifera]
Length=418

 Score =   384 bits (986),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_009599866.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Nicotiana 
tomentosiformis]
Length=417

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRQDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_002284747.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Vitis 
vinifera]
 emb|CBI20968.3| unnamed protein product [Vitis vinifera]
Length=420

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  291

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  292  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  351

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  352  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  411

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  412  NMSLRKLWK  420



>ref|XP_011072258.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Sesamum 
indicum]
Length=417

 Score =   384 bits (985),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_006647057.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Oryza 
brachyantha]
Length=420

 Score =   384 bits (985),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  291

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  292  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  351

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  352  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  411

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  412  NMSLRKLWK  420



>ref|XP_004951510.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Setaria 
italica]
Length=422

 Score =   384 bits (985),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  234  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  293

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  294  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  353

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  354  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  413

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  414  NMSLRKLWK  422



>ref|XP_002453516.1| hypothetical protein SORBIDRAFT_04g007170 [Sorghum bicolor]
 gb|EES06492.1| hypothetical protein SORBIDRAFT_04g007170 [Sorghum bicolor]
Length=422

 Score =   384 bits (985),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  234  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  293

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  294  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  353

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  354  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  413

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  414  NMSLRKLWK  422



>ref|NP_001142276.1| uncharacterized protein LOC100274445 [Zea mays]
 gb|ACF88067.1| unknown [Zea mays]
 gb|ACG38713.1| 26S protease regulatory subunit 8 [Zea mays]
 gb|AFW66095.1| 26S protease regulatory subunit 8 [Zea mays]
Length=422

 Score =   384 bits (985),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  234  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  293

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  294  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  353

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  354  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  413

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  414  NMSLRKLWK  422



>ref|XP_009770420.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Nicotiana 
sylvestris]
 gb|AGC54442.1| 26S proteasome ATPase regulatory subunit 6 [Nicotiana tabacum]
Length=417

 Score =   383 bits (984),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_009126408.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Brassica 
rapa]
Length=419

 Score =   383 bits (984),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|NP_001140953.1| hypothetical protein [Zea mays]
 gb|ACF85044.1| unknown [Zea mays]
 gb|ACF88222.1| unknown [Zea mays]
 gb|AFW71391.1| hypothetical protein ZEAMMB73_600751 [Zea mays]
 gb|AFW71392.1| hypothetical protein ZEAMMB73_600751 [Zea mays]
Length=422

 Score =   383 bits (984),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  234  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  293

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  294  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  353

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  354  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  413

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  414  NMSLRKLWK  422



>ref|XP_010249967.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Nelumbo 
nucifera]
Length=418

 Score =   383 bits (984),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+HVTQEDFEMAVAKVMKK+TEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_010454291.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Camelina 
sativa]
Length=419

 Score =   383 bits (983),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN ESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNGESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>emb|CDX70903.1| BnaC03g09870D [Brassica napus]
Length=416

 Score =   383 bits (983),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  228  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  287

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  288  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRKMN  347

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  348  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  407

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  408  NMSLRKLWK  416



>ref|XP_009381131.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Musa 
acuminata subsp. malaccensis]
Length=420

 Score =   383 bits (983),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  291

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  292  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  351

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  352  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  411

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  412  NMSLRKLWK  420



>ref|XP_010493091.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Camelina 
sativa]
Length=420

 Score =   383 bits (983),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  291

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN ESR+DILKIHSRKMN
Sbjct  292  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNGESRFDILKIHSRKMN  351

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  352  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  411

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  412  NMSLRKLWK  420



>ref|XP_008464995.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Cucumis 
melo]
Length=418

 Score =   383 bits (983),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK++EK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKESEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_006400565.1| hypothetical protein EUTSA_v10013657mg [Eutrema salsugineum]
 gb|ESQ42018.1| hypothetical protein EUTSA_v10013657mg [Eutrema salsugineum]
Length=419

 Score =   383 bits (983),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKI EKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIGEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_006843919.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Amborella 
trichopoda]
 gb|ERN05594.1| hypothetical protein AMTR_s00007p00269350 [Amborella trichopoda]
Length=395

 Score =   382 bits (980),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  207  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  266

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  267  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  326

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  327  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  386

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  387  NMSLRKLWK  395



>ref|XP_010420826.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Camelina 
sativa]
 ref|XP_010493090.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Camelina 
sativa]
Length=419

 Score =   383 bits (983),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN ESR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNGESRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_006840553.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Amborella 
trichopoda]
 gb|ERN02228.1| hypothetical protein AMTR_s00045p00217520 [Amborella trichopoda]
Length=395

 Score =   382 bits (980),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  207  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  266

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  267  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  326

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  327  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  386

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  387  NMSLRKLWK  395



>ref|XP_006400566.1| hypothetical protein EUTSA_v10013659mg [Eutrema salsugineum]
 gb|ESQ42019.1| hypothetical protein EUTSA_v10013659mg [Eutrema salsugineum]
Length=419

 Score =   382 bits (982),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKI EKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIGEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|NP_001046248.1| Os02g0205300 [Oryza sativa Japonica Group]
 dbj|BAB17626.1| 26S proteasome regulatory particle triple-A ATPase subunit6 [Oryza 
sativa Japonica Group]
 dbj|BAB19880.1| 26S proteasome ATPase subunit Rpt6 [Oryza sativa]
 dbj|BAD16017.1| 26S proteasome regulatory particle triple-A ATPase subunit6 [Oryza 
sativa Japonica Group]
 dbj|BAD38437.1| 26S proteasome regulatory particle triple-A ATPase subunit6 [Oryza 
sativa Japonica Group]
 dbj|BAF08162.1| Os02g0205300 [Oryza sativa Japonica Group]
 gb|EAY84939.1| hypothetical protein OsI_06305 [Oryza sativa Indica Group]
 gb|EAZ22161.1| hypothetical protein OsJ_05824 [Oryza sativa Japonica Group]
 dbj|BAG88097.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95480.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97646.1| unnamed protein product [Oryza sativa Japonica Group]
Length=424

 Score =   383 bits (983),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  236  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  295

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  296  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  355

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  356  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  415

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  416  NMSLRKLWK  424



>ref|XP_009408962.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Musa 
acuminata subsp. malaccensis]
Length=420

 Score =   382 bits (982),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  291

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  292  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  351

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  352  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  411

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  412  NMSLRKLWK  420



>ref|XP_004139327.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Cucumis 
sativus]
 gb|KGN60651.1| hypothetical protein Csa_2G005970 [Cucumis sativus]
Length=418

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGN DSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNSDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDT+K
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTDK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_004149888.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Cucumis 
sativus]
 gb|KGN65291.1| hypothetical protein Csa_1G302180 [Cucumis sativus]
Length=418

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK++EK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKESEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>gb|KJB64819.1| hypothetical protein B456_010G066600 [Gossypium raimondii]
Length=417

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_010049955.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Eucalyptus 
grandis]
 gb|KCW82784.1| hypothetical protein EUGRSUZ_C04160 [Eucalyptus grandis]
Length=426

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  238  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  297

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  298  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  357

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  358  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  417

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  418  NMSLRKLWK  426



>ref|XP_008785391.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Phoenix 
dactylifera]
Length=427

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  239  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  299  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  359  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  418

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  419  NMSLRKLWK  427



>ref|XP_010420827.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Camelina 
sativa]
Length=426

 Score =   382 bits (982),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  238  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  297

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN ESR+DILKIHSRKMN
Sbjct  298  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNGESRFDILKIHSRKMN  357

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  358  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  417

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  418  NMSLRKLWK  426



>ref|XP_007013331.1| Regulatory particle triple-A ATPase 6A [Theobroma cacao]
 gb|EOY30950.1| Regulatory particle triple-A ATPase 6A [Theobroma cacao]
Length=417

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|KJB83166.1| hypothetical protein B456_013G232600 [Gossypium raimondii]
Length=417

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRQDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_007135858.1| hypothetical protein PHAVU_010G164000g [Phaseolus vulgaris]
 gb|ESW07852.1| hypothetical protein PHAVU_010G164000g [Phaseolus vulgaris]
Length=417

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|KHG13670.1| 26S protease regulatory subunit 8 A -like protein [Gossypium 
arboreum]
Length=417

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_008457948.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cucumis 
melo]
Length=418

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGN DSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNSDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDT+K
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTDK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_010914939.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Elaeis 
guineensis]
Length=427

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  239  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  299  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  359  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  418

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  419  NMSLRKLWK  427



>ref|XP_008375711.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Malus 
domestica]
Length=417

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNP+EESRWDILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPSEESRWDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+ EK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKENEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_010925261.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Elaeis 
guineensis]
Length=428

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  240  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  299

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  300  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  359

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  360  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  419

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  420  NMSLRKLWK  428



>ref|XP_009131763.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Brassica 
rapa]
Length=419

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAE+MNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEQMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_006451010.1| hypothetical protein CICLE_v10008422mg [Citrus clementina]
 ref|XP_006475777.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Citrus 
sinensis]
 gb|ESR64250.1| hypothetical protein CICLE_v10008422mg [Citrus clementina]
 gb|KDO80360.1| hypothetical protein CISIN_1g014743mg [Citrus sinensis]
Length=419

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+HVTQEDFEMAVAKVMKK+TEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKETEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_008344058.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Malus 
domestica]
Length=417

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNP+EESRWDILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPSEESRWDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+ EK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKENEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_009376844.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Pyrus 
x bretschneideri]
 ref|XP_009350288.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Pyrus 
x bretschneideri]
Length=417

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNP+EESRWDILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPSEESRWDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+ EK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKENEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_012078707.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Jatropha 
curcas]
 gb|KDP32350.1| hypothetical protein JCGZ_13275 [Jatropha curcas]
Length=419

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_008792112.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Phoenix 
dactylifera]
Length=427

 Score =   382 bits (981),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  239  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  299  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRKMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  359  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  418

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  419  NMSLRKLWK  427



>ref|XP_009337249.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Pyrus 
x bretschneideri]
 ref|XP_009339862.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Pyrus 
x bretschneideri]
Length=417

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNP+EESRWDILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPSEESRWDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+ EK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKENEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|EYU24670.1| hypothetical protein MIMGU_mgv1a007142mg [Erythranthe guttata]
Length=417

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRADILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|KHN39373.1| 26S protease regulatory subunit 8 like A [Glycine soja]
Length=418

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_006584548.1| PREDICTED: uncharacterized protein LOC100776268 isoform X1 [Glycine 
max]
Length=418

 Score =   382 bits (980),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|NP_001241552.1| uncharacterized protein LOC100812783 [Glycine max]
 gb|ACU20059.1| unknown [Glycine max]
Length=418

 Score =   381 bits (979),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_009120838.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Brassica 
rapa]
Length=419

 Score =   381 bits (979),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQED EMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDVEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>gb|KEH31238.1| 26S proteasome regulatory particle triple-A ATPase protein [Medicago 
truncatula]
Length=417

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRRDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|ACL53562.1| unknown [Zea mays]
Length=422

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  234  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  293

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  294  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  353

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVM KDTEK
Sbjct  354  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMNKDTEK  413

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  414  NMSLRKLWK  422



>ref|XP_004239281.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Solanum 
lycopersicum]
Length=417

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRQDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM+GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMSGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|AAF27916.1|AF220199_1 26S proteasome regulatory subunit 8 [Pinus taeda]
Length=433

 Score =   382 bits (980),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  245  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  304

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  305  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  364

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM+GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  365  LMRGIDLKKIAEKMSGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  424

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  425  NMSLRKLWK  433



>ref|XP_004504777.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cicer 
arietinum]
Length=417

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRRDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|KJB83167.1| hypothetical protein B456_013G232600 [Gossypium raimondii]
Length=390

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -3

Query  879  VQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLN  700
            VQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLN
Sbjct  203  VQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLN  262

Query  699  QLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMNL  520
            QLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MNL
Sbjct  263  QLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRQDILKIHSRRMNL  322

Query  519  MRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKN  340
            MRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEKN
Sbjct  323  MRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEKN  382

Query  339  MSLRKLWK  316
            MSLRKLWK
Sbjct  383  MSLRKLWK  390



>ref|XP_006338168.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Solanum 
tuberosum]
 ref|XP_006365620.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Solanum 
tuberosum]
Length=417

 Score =   381 bits (978),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRQDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM+GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMSGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|ACN40682.1| unknown [Picea sitchensis]
Length=433

 Score =   382 bits (980),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  245  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  304

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  305  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  364

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM+GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  365  LMRGIDLKKIAEKMSGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  424

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  425  NMSLRKLWK  433



>dbj|BAJ99861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49046.1| 26S protease regulatory subunit 8-like protein A [Triticum urartu]
 gb|EMT18240.1| 26S protease regulatory subunit 8 [Aegilops tauschii]
Length=423

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  235  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  294

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN +SR DILKIHSRKMN
Sbjct  295  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNADSRGDILKIHSRKMN  354

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  355  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  414

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  415  NMSLRKLWK  423



>ref|XP_004239282.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Solanum 
lycopersicum]
Length=417

 Score =   381 bits (978),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRQDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM+GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMSGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|EPS65331.1| hypothetical protein M569_09445 [Genlisea aurea]
Length=417

 Score =   381 bits (978),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN ESR+DILKIHSRKMN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNGESRFDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGM+ALRERRVHVTQEDFEMAVAKVMKKDT+K
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMYALRERRVHVTQEDFEMAVAKVMKKDTDK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|KHG30505.1| 26S protease regulatory subunit 8 A -like protein [Gossypium 
arboreum]
Length=417

 Score =   380 bits (977),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTE+GMFALRERRVHVTQEDFEMAVAKVMKK++EK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTESGMFALRERRVHVTQEDFEMAVAKVMKKESEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|KJB54106.1| hypothetical protein B456_009G020800 [Gossypium raimondii]
 gb|KJB54107.1| hypothetical protein B456_009G020800 [Gossypium raimondii]
Length=417

 Score =   380 bits (977),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTE+GMFALRERRVHVTQEDFEMAVAKVMKK++EK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTESGMFALRERRVHVTQEDFEMAVAKVMKKESEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>gb|AIZ74339.1| 26S proteasome regulatory subunit [Pinus massoniana]
Length=433

 Score =   381 bits (978),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  245  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  304

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  305  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  364

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM+GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  365  LMRGIDLKKIAEKMSGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  424

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  425  NMSLRKLWK  433



>ref|XP_003563677.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Brachypodium 
distachyon]
Length=422

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  234  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  293

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN +SR DILKIHSRKMN
Sbjct  294  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNADSRGDILKIHSRKMN  353

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  354  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  413

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  414  NMSLRKLWK  422



>gb|AFK34159.1| unknown [Medicago truncatula]
Length=417

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRRDILKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVH TQEDFEMAVAKVMKK+TEK
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHATQEDFEMAVAKVMKKETEK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>emb|CDO98106.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  238  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  297

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  298  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  357

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAV+KVMKK+TEK
Sbjct  358  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVSKVMKKETEK  417

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  418  NMSLRKLWK  426



>ref|XP_010670712.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Beta 
vulgaris subsp. vulgaris]
Length=411

 Score =   378 bits (971),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  223  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  282

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEAS KIKVLMATNRIDILD ALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  283  NQLDGFEASKKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPNEDSRCDILKIHSRKMN  342

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+HVTQEDFEMAVAKVMKKDTEK
Sbjct  343  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKDTEK  402

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  403  NMSLRKLWK  411



>gb|KFK26248.1| hypothetical protein AALP_AA8G222400 [Arabis alpina]
Length=419

 Score =   379 bits (972),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREH PSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHQPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSR+MN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRRMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKM GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMGGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_006379809.1| hypothetical protein POPTR_0008s14310g [Populus trichocarpa]
 gb|ERP57606.1| hypothetical protein POPTR_0008s14310g [Populus trichocarpa]
Length=427

 Score =   378 bits (971),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/189 (97%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  239  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MN
Sbjct  299  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRRMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  359  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  418

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  419  NMSLRKLWK  427



>ref|XP_010688096.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Beta 
vulgaris subsp. vulgaris]
Length=404

 Score =   377 bits (968),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS RMESGSGNGDSEVQRTMLELL
Sbjct  216  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRMESGSGNGDSEVQRTMLELL  275

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILD ALLRPGRIDRKIEFPNPNEESR+DILKIHSR+MN
Sbjct  276  NQLDGFEASNKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPNEESRFDILKIHSRRMN  335

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKI EKMNGASGAELKAVCTEAGMFALRERR+HVTQEDFEMAVAKVMKKDT+K
Sbjct  336  LMRGIDLKKIGEKMNGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVAKVMKKDTDK  395

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  396  NMSLRKLWK  404



>gb|AFW66094.1| hypothetical protein ZEAMMB73_419750 [Zea mays]
Length=477

 Score =   379 bits (974),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  234  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  293

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  294  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  353

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  354  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  413

Query  342  NMSLRKLW  319
            NMSLRKLW
Sbjct  414  NMSLRKLW  421



>gb|EMT18785.1| 26S protease regulatory subunit 8 [Aegilops tauschii]
Length=378

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  190  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  249

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MN
Sbjct  250  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRGDILKIHSRRMN  309

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKD EK
Sbjct  310  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDNEK  369

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  370  NMSLRKLWK  378



>ref|XP_002315825.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
 gb|ABK95350.1| unknown [Populus trichocarpa]
 gb|EEF01996.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
Length=426

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  238  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  297

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN +SR+DI+KIHSR+MN
Sbjct  298  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNVDSRFDIVKIHSRRMN  357

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGID+KKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  358  LMRGIDMKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  417

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  418  NMSLRKLWK  426



>ref|XP_011021674.1| PREDICTED: 26S protease regulatory subunit 8 homolog A [Populus 
euphratica]
Length=426

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  238  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  297

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPN +SR+DI+KIHSR+MN
Sbjct  298  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNVDSRFDIVKIHSRRMN  357

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGID+KKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  358  LMRGIDMKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  417

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  418  NMSLRKLWK  426



>ref|XP_002529369.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF33036.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=382

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/187 (97%), Positives = 186/187 (99%), Gaps = 0/187 (0%)
 Frame = -3

Query  876  QKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQ  697
            +KYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQ
Sbjct  196  KKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQ  255

Query  696  LDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMNLM  517
            LDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MNLM
Sbjct  256  LDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRLDILKIHSRRMNLM  315

Query  516  RGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNM  337
            RGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEKNM
Sbjct  316  RGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEKNM  375

Query  336  SLRKLWK  316
            SLRKLWK
Sbjct  376  SLRKLWK  382



>ref|XP_002978587.1| hypothetical protein SELMODRAFT_108927 [Selaginella moellendorffii]
 gb|EFJ20573.1| hypothetical protein SELMODRAFT_108927 [Selaginella moellendorffii]
Length=352

 Score =   374 bits (959),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+RMESG+GNGDSEVQRTMLELL
Sbjct  164  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRMESGNGNGDSEVQRTMLELL  223

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILD ALLRPGRIDRKIEFPNP EESR DILKIHSRKMN
Sbjct  224  NQLDGFEASNKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPTEESRLDILKIHSRKMN  283

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDF+MAVAKVMKK+TEK
Sbjct  284  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFDMAVAKVMKKETEK  343

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  344  NMSLRKLWK  352



>dbj|BAA87070.2| TAT-binding protein homolog [Matricaria chamomilla]
Length=414

 Score =   376 bits (965),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  226  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  285

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFE+S KIKVLMATNRIDILD ALLRPGRIDR+IEFPNPNE+SR+DILKIHSRKMN
Sbjct  286  NQLDGFESSTKIKVLMATNRIDILDPALLRPGRIDREIEFPNPNEDSRFDILKIHSRKMN  345

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  346  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  405

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  406  NMSLRKLWK  414



>ref|XP_002311569.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
 gb|EEE88936.2| 26S proteasome subunit 8 family protein [Populus trichocarpa]
Length=427

 Score =   376 bits (966),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAR HAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  239  LVQKYIGEGSRMVRELFVMARSHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MN
Sbjct  299  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRRMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEK
Sbjct  359  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEK  418

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  419  NMSLRKLWK  427



>gb|EMS56105.1| 26S protease regulatory subunit 8-like protein A [Triticum urartu]
Length=405

 Score =   375 bits (964),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  217  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MN
Sbjct  277  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRGDILKIHSRRMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKD EK
Sbjct  337  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDNEK  396

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  397  NMSLRKLWK  405



>dbj|BAJ85508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   376 bits (965),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRGDILKIHSRRMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKD EK
Sbjct  350  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDNEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_003571095.2| PREDICTED: 26S protease regulatory subunit 8 homolog A [Brachypodium 
distachyon]
Length=418

 Score =   375 bits (964),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRGDILKIHSRRMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKD EK
Sbjct  350  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDNEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>ref|XP_006656207.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Oryza 
brachyantha]
Length=427

 Score =   375 bits (964),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARM+SGSG GDSEVQRTMLELL
Sbjct  239  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMQSGSGGGDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNR+DILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  299  NQLDGFEASNKIKVLMATNRMDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHV QEDFEMAV KVMKKDTEK
Sbjct  359  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVNQEDFEMAVGKVMKKDTEK  418

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  419  NMSLRKLWK  427



>ref|XP_004490469.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Cicer 
arietinum]
Length=417

 Score =   375 bits (963),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  229  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DI+KIHSR+MN
Sbjct  289  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDIVKIHSRRMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERR+HV QEDFEM+VAKVMKK+T+K
Sbjct  349  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRIHVAQEDFEMSVAKVMKKETDK  408

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  409  NMSLRKLWK  417



>ref|XP_011025256.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Populus 
euphratica]
Length=427

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/189 (97%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  239  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSR+MN
Sbjct  299  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRRMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERR HVTQEDFEMAVAKVMKK+TEK
Sbjct  359  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRGHVTQEDFEMAVAKVMKKETEK  418

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  419  NMSLRKLWK  427



>ref|XP_002994774.1| hypothetical protein SELMODRAFT_139105 [Selaginella moellendorffii]
 gb|EFJ04162.1| hypothetical protein SELMODRAFT_139105 [Selaginella moellendorffii]
Length=352

 Score =   372 bits (955),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+RMESG+GNGDSEVQRTMLELL
Sbjct  164  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRMESGNGNGDSEVQRTMLELL  223

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILD ALLRPGRIDRKIEFPNP EESR DILKIHSRKMN
Sbjct  224  NQLDGFEASNKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPTEESRLDILKIHSRKMN  283

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDF+M VAKVMKK+TEK
Sbjct  284  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFDMPVAKVMKKETEK  343

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  344  NMSLRKLWK  352



>ref|NP_001057999.1| Os06g0600100 [Oryza sativa Japonica Group]
 dbj|BAD32833.1| putative 26S proteasome regulatory particle triple-A ATPase subunit6 
[Oryza sativa Japonica Group]
 dbj|BAD32954.1| putative 26S proteasome regulatory particle triple-A ATPase subunit6 
[Oryza sativa Japonica Group]
 dbj|BAF19913.1| Os06g0600100 [Oryza sativa Japonica Group]
 dbj|BAG89590.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65971.1| hypothetical protein OsJ_21883 [Oryza sativa Japonica Group]
Length=423

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARM+SGSG GDSEVQRTMLELL
Sbjct  235  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMQSGSGGGDSEVQRTMLELL  294

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNR+DILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  295  NQLDGFEASNKIKVLMATNRMDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  354

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHV QEDF MAVAKVMKKDTEK
Sbjct  355  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVNQEDFLMAVAKVMKKDTEK  414

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  415  NMSLRKLWK  423



>gb|EEC80919.1| hypothetical protein OsI_23597 [Oryza sativa Indica Group]
Length=423

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARM+SGSG GDSEVQRTMLELL
Sbjct  235  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMQSGSGGGDSEVQRTMLELL  294

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNR+DILDQALLRPGRIDRKIEFPNPNE+SR+DILKIHSRKMN
Sbjct  295  NQLDGFEASNKIKVLMATNRMDILDQALLRPGRIDRKIEFPNPNEDSRFDILKIHSRKMN  354

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHV QEDF MAVAKVMKKDTEK
Sbjct  355  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVNQEDFLMAVAKVMKKDTEK  414

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  415  NMSLRKLWK  423



>ref|XP_002970508.1| hypothetical protein SELMODRAFT_441130 [Selaginella moellendorffii]
 ref|XP_002978590.1| hypothetical protein SELMODRAFT_177014 [Selaginella moellendorffii]
 gb|EFJ20576.1| hypothetical protein SELMODRAFT_177014 [Selaginella moellendorffii]
 gb|EFJ28638.1| hypothetical protein SELMODRAFT_441130 [Selaginella moellendorffii]
Length=395

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+RMESG+GNGDSEVQRTMLELL
Sbjct  207  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRMESGNGNGDSEVQRTMLELL  266

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILD ALLRPGRIDRKIEFPNP EESR DILKIHSRKMN
Sbjct  267  NQLDGFEASNKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPTEESRLDILKIHSRKMN  326

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDF+MAVAKVMKK+TEK
Sbjct  327  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFDMAVAKVMKKETEK  386

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  387  NMSLRKLWK  395



>emb|CDY44958.1| BnaA02g04630D [Brassica napus]
Length=721

 Score =   383 bits (983),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 187/189 (99%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>gb|AAG42150.1| 26S proteasome RPT6a subunit [Dactylis glomerata]
Length=452

 Score =   374 bits (959),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELL
Sbjct  264  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELL  323

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHS  MN
Sbjct  324  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRGDILKIHSTTMN  383

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKD EK
Sbjct  384  LMRGIDLKKIAGKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDNEK  443

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  444  NMSLRKLWK  452



>emb|CDY42324.1| BnaC02g09300D [Brassica napus]
Length=717

 Score =   380 bits (975),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 185/189 (98%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAR HAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMARSHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILD+ALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDKALLRPGRIDRKIEFPNPNEDSRCDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_010541726.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Tarenaya 
hassleriana]
Length=473

 Score =   372 bits (954),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 181/184 (98%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKI EKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDT+K
Sbjct  350  LMRGIDLKKIGEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTDK  409

Query  342  NMSL  331
            NMSL
Sbjct  410  NMSL  413



>ref|XP_002437236.1| hypothetical protein SORBIDRAFT_10g023320 [Sorghum bicolor]
 gb|EER88603.1| hypothetical protein SORBIDRAFT_10g023320 [Sorghum bicolor]
Length=419

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMES SG+GDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMES-SGSGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+NKIKVLMATNRIDILDQALLRPGRIDRKIEFPNP+E SR+DILKIHSR+MN
Sbjct  291  NQLDGFEATNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPSETSRFDILKIHSRRMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIA KMNGASGAELKA+CTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK
Sbjct  351  LMRGIDLKKIATKMNGASGAELKAICTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  410

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  411  NMSLRKLWK  419



>ref|XP_001778777.1| 26S proteasome regulatory complex, ATPase RPT6 [Physcomitrella 
patens]
 gb|EDQ56363.1| 26S proteasome regulatory complex, ATPase RPT6 [Physcomitrella 
patens]
Length=410

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 186/194 (96%), Gaps = 5/194 (3%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSAR+ESG+GNGDSEVQRTMLELL
Sbjct  217  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARVESGNGNGDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNP EESR DILKIHSRKMN
Sbjct  277  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPTEESRLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELK-----AVCTEAGMFALRERRVHVTQEDFEMAVAKVMK  358
            LMRGIDLKKIAEKM GASGAELK     AVCTEAGMFALRERRVHVTQEDFEM+VAKVMK
Sbjct  337  LMRGIDLKKIAEKMGGASGAELKAITGPAVCTEAGMFALRERRVHVTQEDFEMSVAKVMK  396

Query  357  KDTEKNMSLRKLWK  316
            KDT+KNMSL+KLWK
Sbjct  397  KDTDKNMSLKKLWK  410



>ref|XP_004965964.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Setaria 
italica]
Length=420

 Score =   365 bits (938),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARM SG G GDSEVQRTMLELL
Sbjct  232  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMGSGGGRGDSEVQRTMLELL  291

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA++KIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE SR+DILKIHSR+MN
Sbjct  292  NQLDGFEATHKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNETSRFDILKIHSRRMN  351

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMR IDLKKIA KMNGASGAELKA+CTEAGMFALRERRVHVTQEDF+MAVAKVMKKDTEK
Sbjct  352  LMRDIDLKKIAAKMNGASGAELKAICTEAGMFALRERRVHVTQEDFDMAVAKVMKKDTEK  411

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  412  NMSLRKLWK  420



>ref|XP_010535884.1| PREDICTED: 26S protease regulatory subunit 8 homolog A-like [Tarenaya 
hassleriana]
Length=418

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAG        VHVTQE FEMAVAKVMKKDTEK
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGXXXXXXXXVHVTQEYFEMAVAKVMKKDTEK  409

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  410  NMSLRKLWK  418



>gb|AAC32150.1| TAT-binding protein homolog [Picea mariana]
Length=175

 Score =   350 bits (898),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/175 (98%), Positives = 175/175 (100%), Gaps = 0/175 (0%)
 Frame = -3

Query  840  ELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKV  661
            ELFVMAREHAPSIIFMDEIDSIGSARMESG+GNGDSEVQRTMLELLNQLDGFEASNKIKV
Sbjct  1    ELFVMAREHAPSIIFMDEIDSIGSARMESGTGNGDSEVQRTMLELLNQLDGFEASNKIKV  60

Query  660  LMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMNLMRGIDLKKIAEKM  481
            LMATNRIDILDQALLRPGRIDRKIEFPNPNEESR+DILKIHSRKMNLMRGIDLKKIAEKM
Sbjct  61   LMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRGIDLKKIAEKM  120

Query  480  NGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLRKLWK  316
            +GASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+TEKNMSLRKLWK
Sbjct  121  SGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETEKNMSLRKLWK  175



>ref|XP_005644732.1| 26S proteasome AAA-ATPase subunit RPT6a [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20188.1| 26S proteasome AAA-ATPase subunit RPT6a [Coccomyxa subellipsoidea 
C-169]
Length=396

 Score =   352 bits (903),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDE+DSIGSAR ++G G GDSEVQRTMLELL
Sbjct  208  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEVDSIGSARTDNGGGGGDSEVQRTMLELL  267

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+NKIKVLMATNRIDILD ALLRPGRIDRKIEFPNPNE SR DIL+IHSRKMN
Sbjct  268  NQLDGFEATNKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPNESSRADILRIHSRKMN  327

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L+RGIDL+KIA+KM GASGAELKA CTEAGMFALRERRVHVTQEDFEMAVAKVMKKD++ 
Sbjct  328  LVRGIDLRKIADKMTGASGAELKACCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDSDA  387

Query  342  NMSLRKLWK  316
            NMSLRKL+K
Sbjct  388  NMSLRKLFK  396



>ref|XP_010420832.1| PREDICTED: 26S protease regulatory subunit 8 homolog B-like [Camelina 
sativa]
Length=171

 Score =   343 bits (881),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = -3

Query  828  MAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMAT  649
            MAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMAT
Sbjct  1    MAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMAT  60

Query  648  NRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMNLMRGIDLKKIAEKMNGAS  469
            NRIDILDQALLRPGRIDRKIEFPNPN ESR+DILKIHSRKMNLMRGIDLKKIAEKMNGAS
Sbjct  61   NRIDILDQALLRPGRIDRKIEFPNPNGESRFDILKIHSRKMNLMRGIDLKKIAEKMNGAS  120

Query  468  GAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLRKLWK  316
            GAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLRKLWK
Sbjct  121  GAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLRKLWK  171



>ref|XP_005846786.1| 26S proteasome AAA-ATPase subunit RPT6a [Chlorella variabilis]
 gb|EFN54684.1| 26S proteasome AAA-ATPase subunit RPT6a [Chlorella variabilis]
Length=349

 Score =   350 bits (898),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDE+DSIGSAR ++  G+GDSEVQRTMLELL
Sbjct  161  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEVDSIGSARTDNSGGSGDSEVQRTMLELL  220

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+NKIKVLMATNRIDILD ALLRPGRIDRKIEFPNP+E SR+DILKIHSRKMN
Sbjct  221  NQLDGFEATNKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPDETSRFDILKIHSRKMN  280

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGIDLKKIAE M G+SGAELKAVCTEAGMFALRERRVHVTQEDFEM+V+KVMKKDT+K
Sbjct  281  LQRGIDLKKIAEGMTGSSGAELKAVCTEAGMFALRERRVHVTQEDFEMSVSKVMKKDTDK  340

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  341  NMSIKKLWK  349



>ref|XP_002951010.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ47904.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=396

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDE+DSIGSAR E+  G GDSEVQRTMLELL
Sbjct  208  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEVDSIGSARTENSGGGGDSEVQRTMLELL  267

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILD ALLRPGRIDRKIEFPNPNE +R DILKIHSRKMN
Sbjct  268  NQLDGFEASNKIKVLMATNRIDILDAALLRPGRIDRKIEFPNPNEAARLDILKIHSRKMN  327

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGIDLKKIA+KM+  SGAELKA CTEAGMFALRERRVHVTQEDFEMAV KVMKKD++K
Sbjct  328  LTRGIDLKKIADKMSNCSGAELKACCTEAGMFALRERRVHVTQEDFEMAVGKVMKKDSDK  387

Query  342  NMSLRKLWK  316
            NMS+RKLWK
Sbjct  388  NMSIRKLWK  396



>emb|CAB63651.1| 26S proteasome subunit 8 [Fagus sylvatica]
Length=418

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 181/191 (95%), Gaps = 2/191 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQ  MLELL
Sbjct  228  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQDHMLELL  287

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFE+  +IKVLM TNRIDILDQALLRPGRIDRKIEFPNPN ESR+DILKIHSR+MN
Sbjct  288  NQLDGFESIKQIKVLMRTNRIDILDQALLRPGRIDRKIEFPNPNRESRFDILKIHSRRMN  347

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALR-ERRVH-VTQEDFEMAVAKVMKKDT  349
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFAL  ERRV  VTQEDFEMAVAKVMKK+T
Sbjct  348  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALTAERRVRLVTQEDFEMAVAKVMKKET  407

Query  348  EKNMSLRKLWK  316
            EKNMSLRKLWK
Sbjct  408  EKNMSLRKLWK  418



>ref|XP_011397854.1| 26S protease regulatory subunit 8-like protein A [Auxenochlorella 
protothecoides]
 gb|KFM24966.1| 26S protease regulatory subunit 8-like protein A [Auxenochlorella 
protothecoides]
Length=396

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREH+PSIIFMDE+DSIGSAR++   G GDSEVQRTMLELL
Sbjct  208  LVQKYIGEGSRMVRELFVMAREHSPSIIFMDEVDSIGSARIDGSGGTGDSEVQRTMLELL  267

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+NKIKVLMATNR+DILD ALLRPGRIDRKIEFPNPNE SR DILKIHSR+MN
Sbjct  268  NQLDGFEATNKIKVLMATNRMDILDPALLRPGRIDRKIEFPNPNEASRLDILKIHSRRMN  327

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L+RGIDLK+IA++M GASGAELKA CTEAGMFALRERRVHVTQED EMAV KVM+KD +K
Sbjct  328  LLRGIDLKRIADQMTGASGAELKACCTEAGMFALRERRVHVTQEDLEMAVTKVMRKDKDK  387

Query  342  NMSLRKLWK  316
            NMSLRKLWK
Sbjct  388  NMSLRKLWK  396



>ref|XP_005705074.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME28554.1| AAA-type ATPase [Galdieria sulphuraria]
Length=407

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG-SGNGDSEVQRTMLEL  706
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS R++SG SG GDSEVQRTMLEL
Sbjct  218  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRIDSGNSGGGDSEVQRTMLEL  277

Query  705  LNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKM  526
            LNQLDGFE    IKVLMATNRIDILD ALLRPGRIDRKIEFPNPNE++R+DILKIHSRKM
Sbjct  278  LNQLDGFEPHQNIKVLMATNRIDILDPALLRPGRIDRKIEFPNPNEDARFDILKIHSRKM  337

Query  525  NLMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTE  346
            NL+RGIDLKKIA +++GASGAELKAVCTEAGMFALRERR+HVTQEDFEMAV+KVM+KD+E
Sbjct  338  NLVRGIDLKKIASQLHGASGAELKAVCTEAGMFALRERRIHVTQEDFEMAVSKVMRKDSE  397

Query  345  KNMSLRKLWK  316
            +NMSLRKL+K
Sbjct  398  QNMSLRKLFK  407



>ref|XP_002023000.1| GL16409 [Drosophila persimilis]
 gb|EDW27105.1| GL16409 [Drosophila persimilis]
Length=269

 Score =   339 bits (869),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  82   LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  140

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  141  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  200

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  201  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  260

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  261  NMSIKKLWK  269



>gb|KDD77137.1| AAA+ ATPase [Helicosporidium sp. ATCC 50920]
Length=396

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREH+PSIIFMDE+DSIGSAR ++  G+GDSEVQRTMLELL
Sbjct  208  LVQKYIGEGSRMVRELFVMAREHSPSIIFMDEVDSIGSARTDNSGGSGDSEVQRTMLELL  267

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILD ALLRPGRIDRKIEFPNPNE SR DIL+IHSRKMN
Sbjct  268  NQLDGFEASNKIKVLMATNRIDILDPALLRPGRIDRKIEFPNPNEASRADILRIHSRKMN  327

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L+RGIDLKK+A+ M GASGAELKA CTEAGMFALRERRVHVTQED +MAVAKVM KD +K
Sbjct  328  LVRGIDLKKVADAMAGASGAELKACCTEAGMFALRERRVHVTQEDLDMAVAKVMHKDKDK  387

Query  342  NMSLRKLWK  316
            NMSL+KLWK
Sbjct  388  NMSLKKLWK  396



>gb|AAU84927.1| putative 26S protease regulatory subunit 8 [Aphis citricidus]
 dbj|BAJ91604.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 180/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  221  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  279

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RWDIL+IHSRKMN
Sbjct  280  NQLDGFEATKNIKVIMATNRIDILDTALLRPGRIDRKIEFPPPNEEARWDILRIHSRKMN  339

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+LKKIAE M GASGAE+K VCTEAGM+ALRERRVHVTQ+DFEMAVAKVM+KD+EK
Sbjct  340  LTRGINLKKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQDDFEMAVAKVMQKDSEK  399

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  400  NMSIKKLWK  408



>ref|XP_003287255.1| 26S proteasome subunit ATPase 5 [Dictyostelium purpureum]
 gb|EGC36188.1| 26S proteasome subunit ATPase 5 [Dictyostelium purpureum]
Length=398

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELF+MAREHAPSIIFMDEIDSIGS+R ESGSG GDSEVQRTMLELL
Sbjct  210  LVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRTESGSGGGDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFE++  IKVLM TNRIDILD ALLRPGRIDRKIEFPNP +  R DILKIHSRKMN
Sbjct  270  NQLDGFESTKNIKVLMCTNRIDILDPALLRPGRIDRKIEFPNPGDAGRLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+LKKI++KMNGASGAELKAVCTEAGM+ALRERRVHV+QEDFEMAV+KVMKKD+E 
Sbjct  330  LTRGINLKKISDKMNGASGAELKAVCTEAGMYALRERRVHVSQEDFEMAVSKVMKKDSEN  389

Query  342  NMSLRKLWK  316
            NMS+ KLWK
Sbjct  390  NMSINKLWK  398



>ref|XP_001943740.1| PREDICTED: 26S protease regulatory subunit 8 [Acyrthosiphon pisum]
Length=408

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 180/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  221  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  279

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+RWDIL+IHSRKMN
Sbjct  280  NQLDGFEATKNIKVIMATNRIDILDTALLRPGRIDRKIEFPPPNEEARWDILRIHSRKMN  339

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+LKKIAE M GASGAE+K VCTEAGM+ALRERRVHVTQ+DFEMAVAKVM+KD+EK
Sbjct  340  LTRGINLKKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQDDFEMAVAKVMQKDSEK  399

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  400  NMSIKKLWK  408



>gb|EIE88480.1| 26S protease regulatory subunit 8 [Rhizopus delemar RA 99-880]
Length=367

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG G GDSEVQRTMLELL
Sbjct  180  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG-GGGDSEVQRTMLELL  238

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP P+EE+R DILKIHSRKMN
Sbjct  239  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPSEEARADILKIHSRKMN  298

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAEKM+G+SGAE+KAVCTEAGMFALRERRVHVTQEDFEM+VAKVMKKD++ 
Sbjct  299  LTRGINLRKIAEKMSGSSGAEVKAVCTEAGMFALRERRVHVTQEDFEMSVAKVMKKDSDA  358

Query  342  NMSLRKLWK  316
            N SL+KLWK
Sbjct  359  NTSLKKLWK  367



>gb|EDM06377.1| peptidase (prosome, macropain) 26S subunit, ATPase 5, isoform 
CRA_f [Rattus norvegicus]
Length=240

 Score =   336 bits (862),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  53   LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  111

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  112  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  171

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  172  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  231

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  232  NMSIKKLWK  240



>gb|KHN38098.1| 26S protease regulatory subunit 8 like A [Glycine soja]
Length=623

 Score =   349 bits (895),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/181 (95%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  230  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  289

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESR DILKIHSR+MN
Sbjct  290  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRLDILKIHSRRMN  349

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAK  K+    
Sbjct  350  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKKTKQPLAL  409

Query  342  N  340
            N
Sbjct  410  N  410



>gb|EIE87521.1| 26S protease regulatory subunit 8 [Rhizopus delemar RA 99-880]
Length=392

 Score =   341 bits (874),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG G GDSEVQRTMLELL
Sbjct  205  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG-GGGDSEVQRTMLELL  263

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP P+EE+R DILKIHSRKMN
Sbjct  264  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPSEEARADILKIHSRKMN  323

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAEKM+G+SGAE+KAVCTEAGMFALRERRVHVTQEDFEM+VAKVMKKD++ 
Sbjct  324  LTRGINLRKIAEKMSGSSGAEVKAVCTEAGMFALRERRVHVTQEDFEMSVAKVMKKDSDA  383

Query  342  NMSLRKLWK  316
            N SL+KLWK
Sbjct  384  NTSLKKLWK  392



>gb|EDM06376.1| peptidase (prosome, macropain) 26S subunit, ATPase 5, isoform 
CRA_e [Rattus norvegicus]
Length=269

 Score =   336 bits (862),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  82   LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  140

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  141  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  200

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  201  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  260

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  261  NMSIKKLWK  269



>gb|AAB88187.1| similar to 26S proteasome subunit p45 [Homo sapiens]
Length=280

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  93   LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  151

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  152  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  211

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  212  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  271

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  272  NMSIKKLWK  280



>emb|CEP15966.1| hypothetical protein [Parasitella parasitica]
Length=392

 Score =   341 bits (874),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG G GDSEVQRTMLELL
Sbjct  205  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG-GGGDSEVQRTMLELL  263

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP P+EE+R DILKIHSRKMN
Sbjct  264  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPSEEARADILKIHSRKMN  323

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAEKM+G+SGAE+KAVCTEAGMFALRERRVHVTQEDFEM+VAKVMKKD++ 
Sbjct  324  LTRGINLRKIAEKMSGSSGAEVKAVCTEAGMFALRERRVHVTQEDFEMSVAKVMKKDSDA  383

Query  342  NMSLRKLWK  316
            N SL+KLWK
Sbjct  384  NTSLKKLWK  392



>gb|ACO12128.1| 26S protease regulatory subunit 8 [Lepeophtheirus salmonis]
 gb|ADD24295.1| 26S protease regulatory subunit 8 [Lepeophtheirus salmonis]
 gb|ADD38306.1| 26S protease regulatory subunit 8 [Lepeophtheirus salmonis]
Length=410

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSAR+ESGSG GDSEVQRTMLELL
Sbjct  222  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARIESGSGGGDSEVQRTMLELL  281

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  282  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  341

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M G+SGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAK+M++D+EK
Sbjct  342  LTRGINLRKIAETMPGSSGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKIMQRDSEK  401

Query  342  NMSLRKLWK  316
            NMS++KL+K
Sbjct  402  NMSIKKLFK  410



>emb|CEG67285.1| Putative P-loop containing nucleoside triphosphate hydrolase 
[Rhizopus microsporus]
Length=392

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG G GDSEVQRTMLELL
Sbjct  205  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG-GGGDSEVQRTMLELL  263

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFE +  IKV+MATNRIDILD ALLRPGRIDRKIEFP P+EE+R DILKIHSRKMN
Sbjct  264  NQLDGFEPTKNIKVIMATNRIDILDAALLRPGRIDRKIEFPPPSEEARADILKIHSRKMN  323

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAEKM+G+SGAE+KAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKD++ 
Sbjct  324  LTRGINLRKIAEKMSGSSGAEVKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDSDA  383

Query  342  NMSLRKLWK  316
            N SL+KLWK
Sbjct  384  NTSLKKLWK  392



>gb|EPB86422.1| 26S protease regulatory subunit 8 [Mucor circinelloides f. circinelloides 
1006PhL]
 dbj|GAN08818.1| 26S protease regulatory subunit 8-like isoform X4 [Mucor ambiguus]
Length=392

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG G GDSEVQRTMLELL
Sbjct  205  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESG-GGGDSEVQRTMLELL  263

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP P+EE+R DILKIHSRKMN
Sbjct  264  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPSEEARADILKIHSRKMN  323

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAEKM G+SGAE+KAVCTEAGMFALRERRVHVTQEDFEM+VAKVMKKD++ 
Sbjct  324  LTRGINLRKIAEKMGGSSGAEVKAVCTEAGMFALRERRVHVTQEDFEMSVAKVMKKDSDA  383

Query  342  NMSLRKLWK  316
            N SL+KLWK
Sbjct  384  NTSLKKLWK  392



>emb|CEF68527.1| Proteasome (Prosome, macropain) 26S subunit, ATPase, 5 [Strongyloides 
ratti]
Length=414

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+RME GS  GDSEVQRTMLELL
Sbjct  226  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRMEGGSSGGDSEVQRTMLELL  285

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IK++MATNRIDILD ALLRPGRIDRKIEFP P+E++R DILKIHSRKMN
Sbjct  286  NQLDGFEATKNIKIIMATNRIDILDPALLRPGRIDRKIEFPAPDEKARIDILKIHSRKMN  345

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGID++KIAE + GASGAE+KAVCTEAGMFALRERRVHVTQEDFEMAV KVM+KD EK
Sbjct  346  LMRGIDMRKIAESIPGASGAEVKAVCTEAGMFALRERRVHVTQEDFEMAVGKVMQKDNEK  405

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  406  NMSIKKLWK  414



>gb|KDR20973.1| hypothetical protein L798_04485, partial [Zootermopsis nevadensis]
Length=399

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  212  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  270

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  271  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  330

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  331  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  390

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  391  NMSIKKLWK  399



>ref|XP_001649429.1| AAEL014723-PA [Aedes aegypti]
 ref|XP_001663850.1| AAEL013676-PA [Aedes aegypti]
 gb|EAT33024.1| AAEL014723-PA [Aedes aegypti]
 gb|EAT34058.1| AAEL013676-PA [Aedes aegypti]
Length=403

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  216  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  275  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  335  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  394

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  395  NMSIKKLWK  403



>gb|EFX79350.1| hypothetical protein DAPPUDRAFT_52572 [Daphnia pulex]
Length=399

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  212  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  270

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  271  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  330

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  331  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  390

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  391  NMSIKKLWK  399



>ref|XP_004926152.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombyx mori]
Length=403

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  216  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  275  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  335  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  394

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  395  NMSIKKLWK  403



>dbj|BAM18224.1| 26S protease regulatory subunit [Papilio xuthus]
Length=402

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  215  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  273

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  274  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  333

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  334  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  393

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  394  NMSIKKLWK  402



>ref|XP_003398987.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombus terrestris]
 ref|XP_003485515.1| PREDICTED: 26S protease regulatory subunit 8-like [Bombus impatiens]
Length=405

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_011708228.1| PREDICTED: 26S protease regulatory subunit 8 [Wasmannia auropunctata]
Length=405

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_006564449.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Apis 
mellifera]
 ref|XP_006564450.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Apis 
mellifera]
 ref|XP_006564451.1| PREDICTED: 26S protease regulatory subunit 8 isoform X3 [Apis 
mellifera]
 ref|XP_006564452.1| PREDICTED: 26S protease regulatory subunit 8 isoform X4 [Apis 
mellifera]
 ref|XP_006615913.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Apis dorsata]
 ref|XP_006615914.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Apis dorsata]
 ref|XP_006615915.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X3 
[Apis dorsata]
 ref|XP_006615916.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X4 
[Apis dorsata]
Length=405

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_011341411.1| PREDICTED: 26S protease regulatory subunit 8 [Cerapachys biroi]
Length=405

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_011260528.1| PREDICTED: 26S protease regulatory subunit 8 [Camponotus floridanus]
Length=405

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_001870728.1| 26S protease regulatory subunit 8 [Culex quinquefasciatus]
 gb|EDS34089.1| 26S protease regulatory subunit 8 [Culex quinquefasciatus]
Length=402

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  215  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  273

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  274  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  333

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  334  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  393

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  394  NMSIKKLWK  402



>ref|XP_008545433.1| PREDICTED: 26S protease regulatory subunit 8 [Microplitis demolitor]
Length=405

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_001967051.1| GF21725 [Drosophila ananassae]
 gb|EDV38370.1| GF21725 [Drosophila ananassae]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>sp|P54814.1|PRS8_MANSE RecName: Full=26S protease regulatory subunit 8; AltName: Full=Protein 
18-56 [Manduca sexta]
 gb|AAC46996.1| 18-56 protein [Manduca sexta]
Length=402

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  215  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  273

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  274  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  333

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  334  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  393

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  394  NMSIKKLWK  402



>ref|XP_011059922.1| PREDICTED: 26S protease regulatory subunit 8 [Acromyrmex echinatior]
 ref|XP_011168568.1| PREDICTED: 26S protease regulatory subunit 8 [Solenopsis invicta]
 ref|XP_011637951.1| PREDICTED: 26S protease regulatory subunit 8 [Pogonomyrmex barbatus]
 ref|XP_011867098.1| PREDICTED: 26S protease regulatory subunit 8 [Vollenhovia emeryi]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>gb|EHJ76020.1| 26S protease regulatory subunit 8 [Danaus plexippus]
Length=397

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  210  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  268

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  269  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  328

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  329  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  388

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  389  NMSIKKLWK  397



>ref|XP_002011885.1| GI14329 [Drosophila mojavensis]
 gb|EDW08006.1| GI14329 [Drosophila mojavensis]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_001355733.1| GA13327 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL32792.1| GA13327 [Drosophila pseudoobscura pseudoobscura]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_002067234.1| GK16292 [Drosophila willistoni]
 gb|EDW78220.1| GK16292 [Drosophila willistoni]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_011154641.1| PREDICTED: 26S protease regulatory subunit 8 [Harpegnathos saltator]
 gb|EFN87947.1| 26S protease regulatory subunit 8 [Harpegnathos saltator]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>gb|AAC48284.1| DUG [Drosophila melanogaster]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_011303291.1| PREDICTED: 26S protease regulatory subunit 8 [Fopius arisanus]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_005181458.1| PREDICTED: 26S protease regulatory subunit 8 [Musca domestica]
Length=404

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  217  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  275

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  276  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  335

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  336  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  395

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  396  NMSIKKLWK  404



>ref|XP_001991849.1| GH11847 [Drosophila grimshawi]
 gb|EDW00474.1| GH11847 [Drosophila grimshawi]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>gb|EXX51895.1| proteasome regulatory particle base subunit RPT6 [Rhizophagus 
irregularis DAOM 197198w]
Length=393

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  205  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGGDSEVQRTMLELL  264

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFE +  IKV+MATNRIDILD ALLRPGRIDRKIEFP P+E +R DILKIHSRKMN
Sbjct  265  NQLDGFEPTKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPSEAARADILKIHSRKMN  324

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAEKM G+SGAE+KAVCTEAGM+ALRERRVHVTQEDFEMAVAKVMKK  E+
Sbjct  325  LTRGINLRKIAEKMTGSSGAEVKAVCTEAGMYALRERRVHVTQEDFEMAVAKVMKKGEEQ  384

Query  342  NMSLRKLWK  316
            N SLRKLWK
Sbjct  385  NESLRKLWK  393



>ref|XP_002037380.1| GM12144 [Drosophila sechellia]
 gb|EDW53539.1| GM12144 [Drosophila sechellia]
Length=400

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSAR+E+G+G  DSEVQRTMLELL
Sbjct  214  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGTG--DSEVQRTMLELL  271

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRID+LDQALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  272  NQLDGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  331

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGIDL+KIAE+M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAV+KVM KD+EK
Sbjct  332  LTRGIDLRKIAEQMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEK  391

Query  342  NMSLRKLWK  316
            NMS+RK WK
Sbjct  392  NMSIRKFWK  400



>ref|XP_002055458.1| GJ19383 [Drosophila virilis]
 gb|EDW65659.1| GJ19383 [Drosophila virilis]
Length=405

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_002105532.1| GD16958 [Drosophila simulans]
 gb|EDX15035.1| GD16958 [Drosophila simulans]
Length=400

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSAR+E+G+G  DSEVQRTMLELL
Sbjct  214  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGTG--DSEVQRTMLELL  271

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRID+LDQALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  272  NQLDGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  331

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGIDL+KIAE+M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAV+KVM KD+EK
Sbjct  332  LTRGIDLRKIAEQMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEK  391

Query  342  NMSLRKLWK  316
            NMS+RK WK
Sbjct  392  NMSIRKFWK  400



>ref|XP_001978679.1| GG19719 [Drosophila erecta]
 ref|XP_002039625.1| GM23074 [Drosophila sechellia]
 ref|XP_002101976.1| GE17917 [Drosophila yakuba]
 ref|XP_002107540.1| GD17527 [Drosophila simulans]
 gb|EDV47606.1| GG19719 [Drosophila erecta]
 gb|EDW56367.1| GM23074 [Drosophila sechellia]
 gb|EDX03084.1| GE17917 [Drosophila yakuba]
 gb|EDX18526.1| GD17527 [Drosophila simulans]
Length=405

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>gb|KFB40364.1| AGAP007243-PA-like protein [Anopheles sinensis]
Length=397

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  210  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  268

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  269  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  328

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  329  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  388

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  389  NMSIKKLWK  397



>ref|XP_011497497.1| PREDICTED: 26S protease regulatory subunit 8 [Ceratosolen solmsi 
marchali]
Length=405

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRID+LD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDVLDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|NP_608447.1| regulatory particle triple-A ATPase 6 [Drosophila melanogaster]
 sp|O18413.2|PRS8_DROME RecName: Full=26S protease regulatory subunit 8 [Drosophila melanogaster]
 gb|AAC63219.1| Pros45 proteosome subunit homolog [Drosophila melanogaster]
 gb|AAF50835.1| regulatory particle triple-A ATPase 6 [Drosophila melanogaster]
 gb|AAK93156.1| LD26005p [Drosophila melanogaster]
 gb|ACL85442.1| Pros45-PA, partial [synthetic construct]
 gb|ACL90320.1| Pros45-PA [synthetic construct]
Length=405

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_972551.1| PREDICTED: 26S protease regulatory subunit 8 [Tribolium castaneum]
Length=404

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  217  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  275

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  276  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  335

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  336  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  395

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  396  NMSIKKLWK  404



>ref|XP_004535085.1| PREDICTED: 26S protease regulatory subunit 8-like [Ceratitis 
capitata]
 ref|XP_011179924.1| PREDICTED: 26S protease regulatory subunit 8 [Bactrocera cucurbitae]
 ref|XP_011198519.1| PREDICTED: 26S protease regulatory subunit 8 [Bactrocera dorsalis]
Length=404

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  217  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  275

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  276  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  335

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  336  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  395

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  396  NMSIKKLWK  404



>gb|EDM06375.1| peptidase (prosome, macropain) 26S subunit, ATPase 5, isoform 
CRA_d [Rattus norvegicus]
Length=320

 Score =   337 bits (863),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  133  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  191

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  192  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  251

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  252  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  311

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  312  NMSIKKLWK  320



>gb|AAH04052.1| Psmc5 protein, partial [Mus musculus]
Length=306

 Score =   336 bits (862),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  119  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  177

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  178  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  237

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  238  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  297

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  298  NMSIKKLWK  306



>ref|XP_308557.2| AGAP007243-PA [Anopheles gambiae str. PEST]
 gb|EAA04200.3| AGAP007243-PA [Anopheles gambiae str. PEST]
Length=403

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  216  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  275  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  335  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  394

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  395  NMSIKKLWK  403



>gb|EGI70168.1| 26S protease regulatory subunit 8 [Acromyrmex echinatior]
Length=427

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  240  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  298

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  299  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  358

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  359  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  418

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  419  NMSIKKLWK  427



>gb|ETN68121.1| 26S protease regulatory subunit [Anopheles darlingi]
Length=403

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  216  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  275  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  335  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  394

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  395  NMSIKKLWK  403



>gb|AEE62443.1| unknown [Dendroctonus ponderosae]
Length=405

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|XP_005834377.1| 26S proteasome regulatory complex, ATPase RPT6 [Guillardia theta 
CCMP2712]
 gb|EKX47397.1| 26S proteasome regulatory complex, ATPase RPT6 [Guillardia theta 
CCMP2712]
Length=403

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDE+DSIGS+R+E GS  GDSEVQRTMLELL
Sbjct  216  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEVDSIGSSRIE-GSEGGDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFE+S+ IKVLMATNR+DILD AL+RPGRIDRKIEFPNPNE +R DIL+IHSRKMN
Sbjct  275  NQLDGFESSSNIKVLMATNRLDILDDALIRPGRIDRKIEFPNPNEGARADILRIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            LMRGIDL KIAEK+ GASGAE+KAVCTEAGM+ALRERRVHVTQEDFEMAVAKVM KD EK
Sbjct  335  LMRGIDLSKIAEKLPGASGAEIKAVCTEAGMYALRERRVHVTQEDFEMAVAKVMNKDNEK  394

Query  342  NMSLRKLWK  316
            NMSLRKL+K
Sbjct  395  NMSLRKLFK  403



>ref|XP_003740119.1| PREDICTED: 26S protease regulatory subunit 8-like [Metaseiulus 
occidentalis]
Length=412

 Score =   340 bits (871),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  225  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  283

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DIL+IHSRKMN
Sbjct  284  NQLDGFEATRNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILRIHSRKMN  343

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGIDL+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKV++KD EK
Sbjct  344  LTRGIDLRKIAEAMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVVQKDAEK  403

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  404  NMSIKKLWK  412



>ref|XP_007072058.1| PREDICTED: 26S protease regulatory subunit 8 [Chelonia mydas]
Length=353

 Score =   337 bits (865),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  166  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  224

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  225  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  284

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  285  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  344

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  345  NMSIKKLWK  353



>ref|XP_008471380.1| PREDICTED: 26S protease regulatory subunit 8 [Diaphorina citri]
Length=403

 Score =   339 bits (870),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  216  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DIL+IHSRKMN
Sbjct  275  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILRIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  335  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  394

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  395  NMSIKKLWK  403



>ref|XP_007527730.1| PREDICTED: 26S protease regulatory subunit 8 [Erinaceus europaeus]
 ref|XP_008048856.1| PREDICTED: 26S protease regulatory subunit 8 [Tarsius syrichta]
Length=327

 Score =   336 bits (862),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  140  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  198

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  199  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  258

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  259  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  318

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  319  NMSIKKLWK  327



>emb|CDX88865.1| BnaA03g07840D [Brassica napus]
Length=629

 Score =   346 bits (888),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 170/172 (99%), Positives = 171/172 (99%), Gaps = 0/172 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL
Sbjct  231  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  290

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNE+SR DILKIHSRKMN
Sbjct  291  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEDSRCDILKIHSRKMN  350

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAK  367
            LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAK
Sbjct  351  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAK  402



>gb|EDL34283.1| protease (prosome, macropain) 26S subunit, ATPase 5, isoform 
CRA_b [Mus musculus]
Length=326

 Score =   336 bits (862),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  139  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  197

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  198  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  257

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  258  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  317

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  318  NMSIKKLWK  326



>gb|EFA09518.1| hypothetical protein TcasGA2_TC011620 [Tribolium castaneum]
Length=441

 Score =   340 bits (872),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  254  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  312

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  313  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  372

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  373  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  432

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  433  NMSIKKLWK  441



>ref|XP_002099414.1| GE23375 [Drosophila yakuba]
 gb|EDW99126.1| GE23375 [Drosophila yakuba]
Length=401

 Score =   338 bits (868),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARME+G+G  DSEVQRTMLELL
Sbjct  215  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMETGTG--DSEVQRTMLELL  272

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRID+LDQALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  273  NQLDGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  332

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE+M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAV+KVM KD+EK
Sbjct  333  LTRGINLRKIAEQMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEK  392

Query  342  NMSLRKLWK  316
            NMS++K WK
Sbjct  393  NMSIKKFWK  401



>ref|XP_001608055.1| PREDICTED: 26S protease regulatory subunit 8 [Nasonia vitripennis]
Length=405

 Score =   338 bits (868),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGS +GDSEVQRTMLELL
Sbjct  218  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGS-SGDSEVQRTMLELL  276

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  277  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  336

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  337  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  396

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  397  NMSIKKLWK  405



>ref|NP_651811.1| regulatory particle triple-A ATPase 6-related [Drosophila melanogaster]
 gb|AAF57069.1| regulatory particle triple-A ATPase 6-related [Drosophila melanogaster]
 gb|AAM51089.1| SD17676p [Drosophila melanogaster]
 gb|ACL92161.1| CG2241-PA [synthetic construct]
Length=399

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSAR+E+G+G  DSEVQRTMLELL
Sbjct  213  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGTG--DSEVQRTMLELL  270

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRID+LDQALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  271  NQLDGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  330

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE+M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAV+KVM KD+EK
Sbjct  331  LTRGINLRKIAEEMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEK  390

Query  342  NMSLRKLWK  316
            NMS+RK WK
Sbjct  391  NMSIRKFWK  399



>ref|XP_001981178.1| GG11925 [Drosophila erecta]
 gb|EDV53048.1| GG11925 [Drosophila erecta]
Length=401

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/189 (86%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARME+G+G  DSEVQRTMLELL
Sbjct  215  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMETGTG--DSEVQRTMLELL  272

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRID+LDQALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  273  NQLDGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  332

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE+M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAV+KVM KD+EK
Sbjct  333  LTRGINLRKIAEQMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEK  392

Query  342  NMSLRKLWK  316
            NMS++K WK
Sbjct  393  NMSIKKFWK  401



>gb|EOA97184.1| 26S protease regulatory subunit 8, partial [Anas platyrhynchos]
Length=379

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  192  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  250

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  251  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  310

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  311  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  370

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  371  NMSIKKLWK  379



>gb|ERL90778.1| hypothetical protein D910_08124 [Dendroctonus ponderosae]
Length=411

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  224  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  282

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  283  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  342

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  343  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  402

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  403  NMSIKKLWK  411



>gb|EFB27243.1| hypothetical protein PANDA_013936, partial [Ailuropoda melanoleuca]
Length=357

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  170  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  228

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  229  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  288

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  289  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  348

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  349  NMSIKKLWK  357



>dbj|BAA22935.1| proteasome p45/SUG [Rattus norvegicus]
Length=374

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  187  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  245

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  246  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  305

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  306  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  365

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  366  NMSIKKLWK  374



>ref|XP_002423806.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
 gb|EEB11068.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
Length=414

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ES +G GDSEVQRTMLELL
Sbjct  227  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESANG-GDSEVQRTMLELL  285

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  286  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  345

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+LKKIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  346  LTRGINLKKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  405

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  406  NMSIKKLWK  414



>ref|XP_011558016.1| PREDICTED: 26S protease regulatory subunit 8 [Plutella xylostella]
Length=402

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  215  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  273

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
             QLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  274  KQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  333

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  334  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  393

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  394  NMSIKKLWK  402



>gb|ENN73378.1| hypothetical protein YQE_10005, partial [Dendroctonus ponderosae]
Length=426

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 179/189 (95%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+ESGSG GDSEVQRTMLELL
Sbjct  239  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSG-GDSEVQRTMLELL  297

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  298  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  357

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  358  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  417

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  418  NMSIKKLWK  426



>ref|XP_001786865.1| predicted protein [Physcomitrella patens]
 gb|EDQ48321.1| predicted protein, partial [Physcomitrella patens]
Length=169

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = -3

Query  822  REHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNR  643
            REHAPSIIFMDEIDSIGSAR+ESG+GNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNR
Sbjct  1    REHAPSIIFMDEIDSIGSARVESGNGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNR  60

Query  642  IDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMNLMRGIDLKKIAEKMNGASGA  463
            IDILDQALLRPGRIDRKIEFPNP EESR DILKIHSRKMNLMRGIDLKKIAEKM GASGA
Sbjct  61   IDILDQALLRPGRIDRKIEFPNPTEESRLDILKIHSRKMNLMRGIDLKKIAEKMGGASGA  120

Query  462  ELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEKNMSLRKLWK  316
            ELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKK+T+KNMSL+KLWK
Sbjct  121  ELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKETDKNMSLKKLWK  169



>gb|EAW94269.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5, isoform 
CRA_a [Homo sapiens]
Length=383

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  196  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  254

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  255  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  314

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  315  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  374

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  375  NMSIKKLWK  383



>ref|XP_007255206.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Astyanax mexicanus]
Length=398

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>emb|CBY22717.1| unnamed protein product [Oikopleura dioica]
Length=447

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREH+PSIIFMDEIDSIGS+RMESGSG GDSEVQRTMLELL
Sbjct  259  LVQKFIGEGSRMVRELFVMAREHSPSIIFMDEIDSIGSSRMESGSGGGDSEVQRTMLELL  318

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFE    IK++MATNRIDILD ALLRPGRIDRKIEFP PNE++R DIL+IHSRKMN
Sbjct  319  NQLDGFEPHQNIKIIMATNRIDILDSALLRPGRIDRKIEFPAPNEDARVDILRIHSRKMN  378

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAEKM G+SGAE K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  379  LTRGINLRKIAEKMQGSSGAESKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  438

Query  342  NMSLRKLWK  316
            NMS+++LWK
Sbjct  439  NMSVKQLWK  447



>ref|XP_011604416.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Takifugu 
rubripes]
Length=407

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  220  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  278

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  279  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  338

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  339  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  398

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  399  NMSIKKLWK  407



>ref|XP_011925997.1| PREDICTED: 26S protease regulatory subunit 8 isoform X3 [Cercocebus 
atys]
Length=382

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  195  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  253

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  254  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  313

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  314  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  373

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  374  NMSIKKLWK  382



>ref|XP_005668738.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Sus 
scrofa]
Length=407

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  220  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  278

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  279  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  338

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  339  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  398

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  399  NMSIKKLWK  407



>ref|XP_008691830.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Ursus 
maritimus]
Length=398

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>ref|XP_010207663.1| PREDICTED: 26S protease regulatory subunit 8 [Colius striatus]
Length=398

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>ref|NP_001279851.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Callorhinchus 
milii]
 gb|AFM85802.1| 26S protease regulatory subunit 8-like isoform 2 [Callorhinchus 
milii]
 gb|AFM90117.1| 26S protease regulatory subunit 8-like isoform 2 [Callorhinchus 
milii]
Length=406

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>gb|KFM60482.1| 26S protease regulatory subunit 8, partial [Stegodyphus mimosarum]
Length=415

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R+++GSG GDSEVQRTMLELL
Sbjct  228  LVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIDAGSG-GDSEVQRTMLELL  286

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  287  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  346

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD EK
Sbjct  347  LTRGINLRKIAEMMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDAEK  406

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  407  NMSIKKLWK  415



>ref|NP_001186092.1| 26S protease regulatory subunit 8 isoform 2 [Homo sapiens]
 ref|NP_001233453.1| 26S protease regulatory subunit 8 [Pan troglodytes]
 ref|XP_003811390.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Pan 
paniscus]
 ref|XP_004041222.1| PREDICTED: 26S protease regulatory subunit 8 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004749241.1| PREDICTED: 26S protease regulatory subunit 8 isoform X3 [Mustela 
putorius furo]
 ref|XP_004868686.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Heterocephalus 
glaber]
 ref|XP_005597335.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Equus 
caballus]
 ref|XP_006146861.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Tupaia 
chinensis]
 ref|XP_006886351.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Elephantulus 
edwardii]
 ref|XP_006041689.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Bubalus 
bubalis]
 ref|XP_007628940.1| PREDICTED: 26S protease regulatory subunit 8 [Cricetulus griseus]
 ref|XP_008010321.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_008516522.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Equus 
przewalskii]
 ref|XP_010378340.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Rhinopithecus 
roxellana]
 ref|XP_010615045.1| PREDICTED: 26S protease regulatory subunit 8 isoform X3 [Fukomys 
damarensis]
 ref|XP_010814615.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Bos 
taurus]
 ref|XP_010954285.1| PREDICTED: 26S protease regulatory subunit 8 [Camelus bactrianus]
 ref|XP_010954286.1| PREDICTED: 26S protease regulatory subunit 8 [Camelus bactrianus]
 ref|XP_011229725.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Ailuropoda 
melanoleuca]
 ref|XP_011852465.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Mandrillus 
leucophaeus]
 ref|XP_011925996.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Cercocebus 
atys]
 ref|XP_011741861.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Macaca 
nemestrina]
 ref|XP_011741863.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Macaca 
nemestrina]
 ref|XP_011741864.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Macaca 
nemestrina]
 ref|XP_011741866.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Macaca 
nemestrina]
 emb|CAA61864.1| put. 26S protease subunit [Sus scrofa]
 gb|EAW94270.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5, isoform 
CRA_b [Homo sapiens]
 gb|EAW94271.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5, isoform 
CRA_b [Homo sapiens]
 dbj|BAF83447.1| unnamed protein product [Homo sapiens]
 dbj|BAK63205.1| 26S protease regulatory subunit 8 [Pan troglodytes]
 gb|ELW67504.1| 26S protease regulatory subunit 8 [Tupaia chinensis]
Length=398

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>ref|XP_008311950.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Cynoglossus 
semilaevis]
 ref|XP_008311951.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Cynoglossus 
semilaevis]
 ref|XP_008311958.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Cynoglossus 
semilaevis]
 ref|XP_008311960.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Cynoglossus 
semilaevis]
Length=398

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>ref|XP_009094856.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
8 [Serinus canaria]
Length=411

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  224  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  282

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  283  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  342

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  343  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  402

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  403  NMSIKKLWK  411



>gb|EHH58251.1| hypothetical protein EGM_08055 [Macaca fascicularis]
Length=406

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_006722043.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Homo 
sapiens]
Length=406

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_006807591.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X3 
[Neolamprologus brichardi]
Length=403

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  216  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  275  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  335  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  394

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  395  NMSIKKLWK  403



>ref|XP_009077704.1| PREDICTED: 26S protease regulatory subunit 8 [Acanthisitta chloris]
Length=398

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>gb|ETE70098.1| 26S protease regulatory subunit 8, partial [Ophiophagus hannah]
Length=414

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  227  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  285

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  286  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  345

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  346  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  405

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  406  NMSIKKLWK  414



>ref|XP_011366835.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Pteropus 
vampyrus]
Length=402

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  215  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  273

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  274  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  333

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  334  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  393

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  394  NMSIKKLWK  402



>ref|XP_005753574.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X3 
[Pundamilia nyererei]
 ref|XP_005949343.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X3 
[Haplochromis burtoni]
Length=404

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  217  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  275

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  276  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  335

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  336  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  395

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  396  NMSIKKLWK  404



>ref|NP_001279980.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Falco 
peregrinus]
 ref|NP_001279979.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Falco 
cherrug]
 ref|NP_001279981.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Columba 
livia]
 ref|XP_009462910.1| PREDICTED: 26S protease regulatory subunit 8 [Nipponia nippon]
 ref|XP_009553680.1| PREDICTED: 26S protease regulatory subunit 8 [Cuculus canorus]
 ref|XP_009674234.1| PREDICTED: 26S protease regulatory subunit 8 [Struthio camelus 
australis]
 ref|XP_009882121.1| PREDICTED: 26S protease regulatory subunit 8 [Charadrius vociferus]
 ref|XP_009941911.1| PREDICTED: 26S protease regulatory subunit 8 [Opisthocomus hoazin]
 ref|XP_010280782.1| PREDICTED: 26S protease regulatory subunit 8 [Phaethon lepturus]
Length=398

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>ref|XP_006833639.1| PREDICTED: 26S protease regulatory subunit 8 [Chrysochloris asiatica]
Length=406

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|NP_001003740.1| 26S protease regulatory subunit 8 [Danio rerio]
 gb|AAH78375.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Danio 
rerio]
 gb|AAI65834.1| Psmc5 protein [Danio rerio]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>gb|AFM89751.1| 26S protease regulatory subunit 8-like protein [Callorhinchus 
milii]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_003414376.1| PREDICTED: 26S protease regulatory subunit 8 [Loxodonta africana]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_006886352.1| PREDICTED: 26S protease regulatory subunit 8 isoform X3 [Elephantulus 
edwardii]
Length=401

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  214  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  272

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  273  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  332

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  333  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  392

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  393  NMSIKKLWK  401



>ref|XP_005496491.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Zonotrichia albicollis]
 ref|XP_005496492.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Zonotrichia albicollis]
Length=398

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>ref|XP_005753575.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X4 
[Pundamilia nyererei]
 ref|XP_005949344.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X4 
[Haplochromis burtoni]
Length=403

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  216  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  274

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  275  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  334

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  335  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  394

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  395  NMSIKKLWK  403



>ref|XP_008633469.1| PREDICTED: 26S protease regulatory subunit 8 [Corvus brachyrhynchos]
 ref|XP_008633470.1| PREDICTED: 26S protease regulatory subunit 8 [Corvus brachyrhynchos]
Length=398

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  211  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  269

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  270  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  329

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  330  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  389

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  390  NMSIKKLWK  398



>ref|NP_001279996.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Alligator 
mississippiensis]
 ref|NP_001280011.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Alligator 
sinensis]
 ref|NP_001279997.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Alligator 
mississippiensis]
 ref|XP_005313425.1| PREDICTED: 26S protease regulatory subunit 8 [Chrysemys picta 
bellii]
Length=411

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  224  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  282

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  283  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  342

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  343  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  402

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  403  NMSIKKLWK  411



>ref|XP_009189269.1| PREDICTED: 26S protease regulatory subunit 8 [Papio anubis]
Length=417

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  230  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  288

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  289  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  348

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  349  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  408

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  409  NMSIKKLWK  417



>ref|XP_007255205.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Astyanax mexicanus]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>gb|AAV38531.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [synthetic 
construct]
Length=407

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_001376943.2| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Monodelphis 
domestica]
 ref|XP_003768500.1| PREDICTED: 26S protease regulatory subunit 8 [Sarcophilus harrisii]
Length=407

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  220  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  278

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  279  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  338

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  339  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  398

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  399  NMSIKKLWK  407



>ref|XP_008281791.1| PREDICTED: 26S protease regulatory subunit 8 [Stegastes partitus]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|NP_001085482.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Xenopus 
laevis]
 gb|AAH72829.1| MGC80185 protein [Xenopus laevis]
 gb|AAH45221.1| MGC80185 protein [Xenopus laevis]
Length=415

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  228  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  286

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  287  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  346

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  347  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  406

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  407  NMSIKKLWK  415



>ref|XP_004575488.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X6 
[Maylandia zebra]
 ref|XP_005471295.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005753573.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Pundamilia nyererei]
 ref|XP_006807590.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X2 
[Neolamprologus brichardi]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_003961613.1| PREDICTED: 26S protease regulatory subunit 8 isoform X2 [Takifugu 
rubripes]
 emb|CAG12637.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_006000215.1| PREDICTED: 26S protease regulatory subunit 8 isoform X1 [Latimeria 
chalumnae]
Length=407

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  220  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  278

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  279  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  338

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  339  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  398

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  399  NMSIKKLWK  407



>ref|XP_006092214.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
8 [Myotis lucifugus]
Length=413

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  226  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  284

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  285  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  344

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  345  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  404

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  405  NMSIKKLWK  413



>ref|NP_001279985.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Myotis 
brandtii]
 ref|NP_001279984.1| proteasome (prosome, macropain) 26S subunit, ATPase, 5 [Myotis 
davidii]
 ref|XP_008147653.1| PREDICTED: 26S protease regulatory subunit 8 [Eptesicus fuscus]
Length=406

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



>ref|XP_005070074.1| PREDICTED: 26S protease regulatory subunit 8 [Mesocricetus auratus]
 ref|XP_006970569.1| PREDICTED: 26S protease regulatory subunit 8 [Peromyscus maniculatus 
bairdii]
Length=416

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  229  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  287

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  288  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  347

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  348  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  407

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  408  NMSIKKLWK  416



>ref|XP_003222519.1| PREDICTED: 26S protease regulatory subunit 8 [Anolis carolinensis]
Length=414

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  227  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  285

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  286  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  345

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  346  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  405

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  406  NMSIKKLWK  414



>ref|XP_003501915.2| PREDICTED: 26S protease regulatory subunit 8 [Cricetulus griseus]
Length=416

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  229  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  287

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  288  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  347

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  348  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  407

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  408  NMSIKKLWK  416



>gb|ELR44943.1| 26S protease regulatory subunit 8, partial [Bos mutus]
Length=410

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  223  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  281

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  282  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  341

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  342  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  401

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  402  NMSIKKLWK  410



>gb|EDM06373.1| peptidase (prosome, macropain) 26S subunit, ATPase 5, isoform 
CRA_b [Rattus norvegicus]
Length=416

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  229  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  287

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  288  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  347

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  348  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  407

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  408  NMSIKKLWK  416



>ref|XP_003441913.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004575487.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X5 
[Maylandia zebra]
 ref|XP_005753572.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Pundamilia nyererei]
 ref|XP_006807589.1| PREDICTED: 26S protease regulatory subunit 8-like isoform X1 
[Neolamprologus brichardi]
Length=407

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  220  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  278

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  279  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  338

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  339  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  398

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  399  NMSIKKLWK  407



>ref|XP_007543031.1| PREDICTED: 26S protease regulatory subunit 8 [Poecilia formosa]
Length=406

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 178/189 (94%), Gaps = 1/189 (1%)
 Frame = -3

Query  882  LVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  703
            LVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL
Sbjct  219  LVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELL  277

Query  702  NQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRWDILKIHSRKMN  523
            NQLDGFEA+  IKV+MATNRIDILD ALLRPGRIDRKIEFP PNEE+R DILKIHSRKMN
Sbjct  278  NQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN  337

Query  522  LMRGIDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVMKKDTEK  343
            L RGI+L+KIAE M GASGAE+K VCTEAGM+ALRERRVHVTQEDFEMAVAKVM+KD+EK
Sbjct  338  LTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK  397

Query  342  NMSLRKLWK  316
            NMS++KLWK
Sbjct  398  NMSIKKLWK  406



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2004804698818