BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12265

Length=1177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57292.1|  gamma-glutamyl hydrolase                               459   3e-157   Ipomoea nil [qian niu]
ref|XP_006348322.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         425   5e-144   Solanum tuberosum [potatoes]
emb|CDP06032.1|  unnamed protein product                                426   2e-143   Coffea canephora [robusta coffee]
ref|NP_001234434.1|  gamma-glutamylhydrolase 1 precursor                422   6e-143   Solanum lycopersicum
ref|XP_009769712.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         422   1e-142   Nicotiana sylvestris
ref|XP_006442404.1|  hypothetical protein CICLE_v10020608mg             423   1e-142   Citrus clementina [clementine]
ref|XP_009605608.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         421   2e-142   Nicotiana tomentosiformis
ref|XP_009803991.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         419   7e-142   Nicotiana sylvestris
ref|XP_011098203.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         421   7e-142   Sesamum indicum [beniseed]
ref|XP_012074574.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         421   1e-141   Jatropha curcas
ref|XP_009630845.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         417   5e-141   Nicotiana tomentosiformis
ref|XP_010060723.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    417   8e-141   
ref|XP_010060720.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         418   1e-140   Eucalyptus grandis [rose gum]
ref|XP_006348321.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         416   2e-140   Solanum tuberosum [potatoes]
gb|AFK48386.1|  unknown                                                 414   1e-139   Lotus japonicus
ref|XP_002285525.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    415   2e-139   Vitis vinifera
ref|XP_002524523.1|  Gamma-glutamyl hydrolase precursor, putative       414   3e-139   Ricinus communis
ref|NP_001234438.1|  gamma-glutamylhydrolase 3 precursor                410   2e-138   Solanum lycopersicum
ref|XP_004294089.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    412   2e-138   Fragaria vesca subsp. vesca
ref|XP_006477853.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    411   3e-138   Citrus sinensis [apfelsine]
emb|CBI20168.3|  unnamed protein product                                416   4e-138   Vitis vinifera
ref|XP_007149562.1|  hypothetical protein PHAVU_005G080700g             410   4e-138   Phaseolus vulgaris [French bean]
ref|XP_006360033.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         410   5e-138   Solanum tuberosum [potatoes]
ref|NP_001234440.1|  gamma-glutamylhydrolase 2                          409   8e-138   Solanum lycopersicum
ref|XP_010675311.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         410   2e-137   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006442395.1|  hypothetical protein CICLE_v10020872mg             407   6e-137   Citrus clementina [clementine]
ref|XP_010060722.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    407   1e-136   Eucalyptus grandis [rose gum]
ref|XP_006377741.1|  hypothetical protein POPTR_0011s10890g             408   2e-136   
ref|XP_011002760.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         408   3e-136   Populus euphratica
ref|XP_006477852.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    405   3e-136   Citrus sinensis [apfelsine]
ref|XP_010106571.1|  Gamma-glutamyl hydrolase                           407   5e-136   Morus notabilis
gb|KJB13015.1|  hypothetical protein B456_002G051200                    406   7e-136   Gossypium raimondii
ref|XP_003543198.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         402   4e-135   Glycine max [soybeans]
ref|XP_003596306.1|  Gamma-glutamylhydrolase                            402   7e-135   Medicago truncatula
ref|XP_008386275.1|  PREDICTED: gamma-glutamyl hydrolase 2              402   2e-134   
gb|KHG06555.1|  Gamma-glutamyl hydrolase -like protein                  402   3e-134   Gossypium arboreum [tree cotton]
ref|XP_010644101.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    401   3e-134   
ref|XP_004489007.1|  PREDICTED: gamma-glutamyl hydrolase-like           400   4e-134   Cicer arietinum [garbanzo]
ref|XP_011044052.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         402   7e-134   Populus euphratica
gb|EPS62480.1|  hypothetical protein M569_12307                         399   1e-133   Genlisea aurea
ref|XP_007021916.1|  Gamma-glutamyl hydrolase 1 isoform 1               400   1e-133   
ref|XP_010242157.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    400   1e-133   Nelumbo nucifera [Indian lotus]
ref|XP_009342915.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    399   4e-133   Pyrus x bretschneideri [bai li]
ref|XP_002318789.2|  hypothetical protein POPTR_0012s11220g             399   5e-133   
ref|XP_008345165.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    397   2e-132   
ref|XP_010429695.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         396   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_009334021.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         395   3e-132   Pyrus x bretschneideri [bai li]
ref|XP_007213890.1|  hypothetical protein PRUPE_ppa006962mg             397   3e-132   Prunus persica
ref|XP_002862660.1|  gamma-glutamyl hydrolase 2                         394   6e-132   Arabidopsis lyrata subsp. lyrata
ref|XP_009342914.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    396   6e-132   Pyrus x bretschneideri [bai li]
gb|AAC83041.1|  Strong similarity to gb|AF067141 gamma-glutamyl h...    393   8e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008463749.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         394   1e-131   Cucumis melo [Oriental melon]
ref|XP_009128305.1|  PREDICTED: gamma-glutamyl hydrolase 1              393   2e-131   Brassica rapa
ref|NP_565186.2|  gamma-glutamyl hydrolase 2                            393   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540146.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         395   2e-131   Tarenaya hassleriana [spider flower]
ref|XP_002887752.1|  gamma-glutamyl hydrolase 2                         392   3e-131   Arabidopsis lyrata subsp. lyrata
ref|XP_008226384.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         394   5e-131   Prunus mume [ume]
emb|CDY14595.1|  BnaC02g25180D                                          392   6e-131   Brassica napus [oilseed rape]
ref|XP_006389965.1|  hypothetical protein EUTSA_v10018776mg             391   1e-130   Eutrema salsugineum [saltwater cress]
ref|XP_003596308.1|  Gamma-glutamylhydrolase                            388   1e-129   
ref|XP_010472700.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         389   2e-129   Camelina sativa [gold-of-pleasure]
ref|XP_008792313.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         390   2e-129   Phoenix dactylifera
emb|CDX87442.1|  BnaA07g34310D                                          387   3e-129   
ref|XP_010924708.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    388   3e-129   Elaeis guineensis
gb|KEH38596.1|  gamma-glutamylhydrolase                                 387   4e-129   Medicago truncatula
ref|XP_006302531.1|  hypothetical protein CARUB_v10020631mg             386   6e-129   
ref|XP_010417473.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         387   6e-129   Camelina sativa [gold-of-pleasure]
gb|AFK41094.1|  unknown                                                 385   2e-128   Medicago truncatula
ref|XP_004146022.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         386   2e-128   Cucumis sativus [cucumbers]
ref|XP_009106586.1|  PREDICTED: gamma-glutamyl hydrolase 2              385   4e-128   Brassica rapa
ref|XP_002887750.1|  ATGGH1                                             384   6e-128   
gb|AFK48342.1|  unknown                                                 384   6e-128   Medicago truncatula
ref|NP_177987.1|  gamma-glutamyl hydrolase 1                            384   6e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42251.1|  hypothetical protein AALP_AA2G230800                    384   9e-128   Arabis alpina [alpine rockcress]
emb|CDX88464.1|  BnaC06g39080D                                          383   1e-127   
ref|NP_849900.1|  gamma-glutamyl hydrolase 1                            383   2e-127   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42250.1|  hypothetical protein AALP_AA2G230700                    382   2e-127   Arabis alpina [alpine rockcress]
ref|XP_010417472.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         382   7e-127   Camelina sativa [gold-of-pleasure]
ref|NP_001185429.1|  gamma-glutamyl hydrolase 2                         381   7e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429696.1|  PREDICTED: gamma-glutamyl hydrolase 1-like         381   8e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010472701.1|  PREDICTED: gamma-glutamyl hydrolase 1              381   8e-127   Camelina sativa [gold-of-pleasure]
ref|XP_006833066.2|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    382   1e-126   Amborella trichopoda
ref|XP_009406770.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    380   4e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010248391.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    379   8e-126   Nelumbo nucifera [Indian lotus]
ref|XP_004489008.1|  PREDICTED: gamma-glutamyl hydrolase-like           378   1e-125   
ref|XP_006477848.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    379   2e-125   Citrus sinensis [apfelsine]
gb|EYU29531.1|  hypothetical protein MIMGU_mgv1a009742mg                374   5e-124   Erythranthe guttata [common monkey flower]
gb|KFK42249.1|  hypothetical protein AALP_AA2G230600                    373   7e-124   Arabis alpina [alpine rockcress]
ref|XP_011082781.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         373   7e-124   
gb|KJB13019.1|  hypothetical protein B456_002G051600                    372   6e-123   Gossypium raimondii
ref|XP_002887751.1|  gamma-glutamyl hydrolase 3                         371   1e-122   Arabidopsis lyrata subsp. lyrata
gb|ERM98344.1|  hypothetical protein AMTR_s00170p00050820               371   1e-122   Amborella trichopoda
ref|XP_002862659.1|  gamma-glutamyl hydrolase 3                         370   2e-122   Arabidopsis lyrata subsp. lyrata
ref|XP_003568092.2|  PREDICTED: gamma-glutamyl hydrolase 2-like         370   4e-122   Brachypodium distachyon [annual false brome]
gb|AAM65646.1|  gamma glutamyl hydrolase, putative                      369   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177988.1|  gamma-glutamyl hydrolase 3                            368   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406768.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    369   1e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006593481.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     367   4e-121   
ref|NP_001235549.1|  gamma-glutamyl hydrolase precursor                 366   6e-121   
ref|XP_009406769.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    367   1e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441386.1|  hypothetical protein SORBIDRAFT_09g025690          364   3e-120   Sorghum bicolor [broomcorn]
ref|XP_011460803.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    365   7e-120   Fragaria vesca subsp. vesca
gb|KHN36905.1|  Gamma-glutamyl hydrolase                                362   3e-119   Glycine soja [wild soybean]
ref|XP_006655488.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         360   5e-119   Oryza brachyantha
ref|NP_001056052.1|  Os05g0517500                                       360   8e-119   
ref|XP_006442394.1|  hypothetical protein CICLE_v10020872mg             359   1e-118   
dbj|BAJ93186.1|  predicted protein                                      359   2e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009106581.1|  PREDICTED: probable gamma-glutamyl hydrolase 3     359   5e-118   Brassica rapa
gb|ACG46729.1|  gamma-glutamyl hydrolase precursor                      357   2e-117   Zea mays [maize]
ref|XP_004961495.1|  PREDICTED: gamma-glutamyl hydrolase-like           356   5e-117   Setaria italica
gb|AAC33745.1|  gamma-glutamyl hydrolase                                352   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324181.1|  PREDICTED: gamma-glutamylhydrolase 3 isoform X1    350   3e-115   
gb|EYU26311.1|  hypothetical protein MIMGU_mgv1a022410mg                350   1e-113   Erythranthe guttata [common monkey flower]
gb|AES66560.2|  gamma-glutamylhydrolase                                 345   4e-113   Medicago truncatula
ref|XP_006302530.1|  hypothetical protein CARUB_v10020631mg             345   5e-113   
ref|XP_002441385.1|  hypothetical protein SORBIDRAFT_09g025680          346   6e-113   
ref|XP_007021917.1|  Gamma-glutamyl hydrolase 1 isoform 2               340   2e-110   
emb|CDX87443.1|  BnaA07g34300D                                          335   3e-109   
ref|XP_006442406.1|  hypothetical protein CICLE_v10020608mg             332   6e-108   
ref|XP_007149561.1|  hypothetical protein PHAVU_005G080600g             330   7e-107   Phaseolus vulgaris [French bean]
ref|XP_006389966.1|  hypothetical protein EUTSA_v10018738mg             328   2e-105   
ref|XP_011654039.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         326   5e-105   Cucumis sativus [cucumbers]
gb|EYU26304.1|  hypothetical protein MIMGU_mgv1a019206mg                321   3e-103   Erythranthe guttata [common monkey flower]
gb|ABK22567.1|  unknown                                                 319   1e-102   Picea sitchensis
ref|XP_006370106.1|  hypothetical protein POPTR_0001s39540g             318   1e-102   
dbj|BAJ98663.1|  predicted protein                                      318   2e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU26310.1|  hypothetical protein MIMGU_mgv1a022815mg                318   2e-102   Erythranthe guttata [common monkey flower]
ref|XP_006494682.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    316   4e-102   Citrus sinensis [apfelsine]
gb|KDO42395.1|  hypothetical protein CISIN_1g023716mg                   314   2e-101   Citrus sinensis [apfelsine]
ref|XP_010242158.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    306   5e-98    
ref|XP_002441384.1|  hypothetical protein SORBIDRAFT_09g025670          308   1e-97    
ref|XP_006442405.1|  hypothetical protein CICLE_v10020608mg             302   1e-96    
ref|XP_006442396.1|  hypothetical protein CICLE_v10021719mg             299   7e-96    
ref|XP_011654410.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         298   3e-94    Cucumis sativus [cucumbers]
ref|XP_006301184.1|  hypothetical protein CARUB_v10021583mg             293   4e-93    
ref|XP_011620471.1|  PREDICTED: gamma-glutamyl hydrolase 2 isofor...    294   6e-93    Amborella trichopoda
ref|XP_006494683.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    286   1e-90    Citrus sinensis [apfelsine]
gb|KDO42396.1|  hypothetical protein CISIN_1g023716mg                   284   4e-90    Citrus sinensis [apfelsine]
ref|XP_006477850.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    283   7e-89    Citrus sinensis [apfelsine]
ref|XP_006477849.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    283   1e-88    Citrus sinensis [apfelsine]
ref|XP_007021919.1|  Gamma-glutamyl hydrolase 1 isoform 4               279   1e-87    
ref|XP_007021918.1|  Gamma-glutamyl hydrolase 1 isoform 3               278   2e-87    
ref|XP_010248393.1|  PREDICTED: gamma-glutamyl hydrolase 2-like i...    278   2e-87    Nelumbo nucifera [Indian lotus]
ref|XP_002984712.1|  hypothetical protein SELMODRAFT_423816             279   5e-87    Selaginella moellendorffii
ref|XP_001772336.1|  predicted protein                                  277   8e-87    
ref|XP_002978801.1|  hypothetical protein SELMODRAFT_177157             278   1e-86    Selaginella moellendorffii
ref|XP_001782403.1|  predicted protein                                  259   8e-80    
gb|KDO42394.1|  hypothetical protein CISIN_1g039121mg                   255   3e-79    Citrus sinensis [apfelsine]
ref|XP_002862658.1|  hypothetical protein ARALYDRAFT_359459             254   4e-79    
ref|XP_010064498.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         253   2e-78    
gb|ACU20290.1|  unknown                                                 248   4e-76    Glycine max [soybeans]
gb|AES66561.2|  class I glutamine amidotransferase                      247   1e-75    Medicago truncatula
gb|EMT14979.1|  Gamma-glutamyl hydrolase                                247   3e-75    
gb|KDO42397.1|  hypothetical protein CISIN_1g023716mg                   244   8e-75    Citrus sinensis [apfelsine]
gb|KCW67543.1|  hypothetical protein EUGRSUZ_F01296                     238   3e-73    Eucalyptus grandis [rose gum]
ref|XP_003596310.1|  Gamma-glutamyl hydrolase                           238   3e-72    
ref|XP_003596307.1|  Gamma-glutamylhydrolase                            224   8e-68    
gb|KHN36904.1|  Gamma-glutamyl hydrolase                                222   4e-67    Glycine soja [wild soybean]
ref|XP_008359366.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    215   2e-64    
ref|XP_005645555.1|  class I glutamine amidotransferase-like protein    219   1e-63    Coccomyxa subellipsoidea C-169
gb|KDD74766.1|  hypothetical protein H632_c1088p1                       209   5e-60    Helicosporidium sp. ATCC 50920
ref|XP_637673.1|  peptidase C26 family protein                          208   5e-60    Dictyostelium discoideum AX4
ref|XP_003287039.1|  hypothetical protein DICPUDRAFT_31892              208   7e-60    Dictyostelium purpureum
ref|XP_011395864.1|  Gamma-glutamyl hydrolase A                         209   8e-60    Auxenochlorella protothecoides
gb|EMS68709.1|  Gamma-glutamyl hydrolase                                207   2e-59    Triticum urartu
gb|EFA81874.1|  peptidase C26 family protein                            206   3e-59    Heterostelium album PN500
ref|XP_001696183.1|  gamma-glutamyl hydrolase                           207   6e-59    Chlamydomonas reinhardtii
ref|XP_001626371.1|  predicted protein                                  206   6e-59    Nematostella vectensis
ref|XP_003391262.1|  PREDICTED: gamma-glutamyl hydrolase A-like         203   2e-58    
ref|XP_005830901.1|  hypothetical protein GUITHDRAFT_72685              203   1e-57    Guillardia theta CCMP2712
ref|XP_011406499.1|  PREDICTED: gamma-glutamyl hydrolase A-like         201   2e-57    
gb|EYU26306.1|  hypothetical protein MIMGU_mgv1a019546mg                198   4e-57    Erythranthe guttata [common monkey flower]
dbj|GAM18533.1|  hypothetical protein SAMD00019534_017080               199   2e-56    Acytostelium subglobosum LB1
ref|XP_005852047.1|  hypothetical protein CHLNCDRAFT_133025             199   2e-55    Chlorella variabilis
pdb|4L8F|C  Chain C, Crystal Structure Of Gamma-glutamyl Hydrolas...    196   3e-55    Danio rerio [leopard danio]
ref|NP_998487.1|  gamma-glutamyl hydrolase precursor                    196   4e-55    Danio rerio [leopard danio]
ref|XP_004998304.1|  gamma-glutamyl hydrolase                           196   4e-55    Salpingoeca rosetta
pdb|4L8W|D  Chain D, Crystal Structure Of Gamma Glutamyl Hydrolas...    195   5e-55    Danio rerio [leopard danio]
ref|XP_005009586.1|  PREDICTED: gamma-glutamyl hydrolase                197   6e-55    
ref|XP_419226.4|  PREDICTED: gamma-glutamyl hydrolase                   197   1e-54    Gallus gallus [bantam]
ref|XP_009075416.1|  PREDICTED: gamma-glutamyl hydrolase                193   1e-54    Acanthisitta chloris
ref|XP_007894923.1|  PREDICTED: gamma-glutamyl hydrolase                193   4e-54    Callorhinchus milii [Australian ghost shark]
ref|XP_010707289.1|  PREDICTED: gamma-glutamyl hydrolase                195   6e-54    Meleagris gallopavo [common turkey]
gb|AAI08439.1|  LOC496099 protein                                       192   7e-54    Xenopus laevis [clawed frog]
gb|KFP82604.1|  Gamma-glutamyl hydrolase                                191   7e-54    Acanthisitta chloris
ref|XP_005288157.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    194   8e-54    Chrysemys picta bellii
gb|AAH87532.1|  LOC496099 protein                                       192   9e-54    Xenopus laevis [clawed frog]
ref|XP_009707401.1|  PREDICTED: gamma-glutamyl hydrolase                191   1e-53    Cariama cristata
ref|XP_007421928.1|  PREDICTED: gamma-glutamyl hydrolase                192   1e-53    Python bivittatus
ref|XP_002946185.1|  hypothetical protein VOLCADRAFT_102798             192   1e-53    Volvox carteri f. nagariensis
ref|XP_010288197.1|  PREDICTED: gamma-glutamyl hydrolase                191   1e-53    Phaethon lepturus
ref|XP_009950167.1|  PREDICTED: gamma-glutamyl hydrolase                191   2e-53    Leptosomus discolor
gb|KFP61510.1|  Gamma-glutamyl hydrolase                                191   2e-53    Cariama cristata
gb|KFQ12123.1|  Gamma-glutamyl hydrolase                                191   2e-53    Leptosomus discolor
gb|KFQ77761.1|  Gamma-glutamyl hydrolase                                191   2e-53    Phaethon lepturus
ref|XP_007231125.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    190   6e-53    
ref|XP_004350727.1|  peptidase C26 family protein                       190   6e-53    Cavenderia fasciculata
gb|KFQ39814.1|  Gamma-glutamyl hydrolase                                190   6e-53    Mesitornis unicolor
ref|XP_007937663.1|  PREDICTED: gamma-glutamyl hydrolase                190   7e-53    Orycteropus afer afer
gb|KFV98034.1|  Gamma-glutamyl hydrolase                                188   9e-53    Fulmarus glacialis
ref|XP_009584845.1|  PREDICTED: gamma-glutamyl hydrolase                188   9e-53    Fulmarus glacialis
ref|XP_010189075.1|  PREDICTED: gamma-glutamyl hydrolase                189   1e-52    Mesitornis unicolor
ref|XP_007231124.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    189   1e-52    
ref|XP_006634071.1|  PREDICTED: gamma-glutamyl hydrolase-like           189   1e-52    
gb|KFW77964.1|  Gamma-glutamyl hydrolase                                189   1e-52    Manacus vitellinus
ref|XP_006860125.1|  PREDICTED: gamma-glutamyl hydrolase                189   1e-52    Chrysochloris asiatica
ref|XP_006113705.1|  PREDICTED: gamma-glutamyl hydrolase                189   1e-52    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008171736.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    189   2e-52    
gb|KFW02734.1|  Gamma-glutamyl hydrolase                                187   3e-52    Eurypyga helias
gb|KFV06368.1|  Gamma-glutamyl hydrolase                                187   3e-52    Pterocles gutturalis
ref|XP_010147217.1|  PREDICTED: gamma-glutamyl hydrolase                187   3e-52    Eurypyga helias
gb|KFP45914.1|  Gamma-glutamyl hydrolase                                187   3e-52    Chlamydotis macqueenii
ref|XP_010127038.1|  PREDICTED: gamma-glutamyl hydrolase                187   4e-52    Chlamydotis macqueenii
gb|KFR13230.1|  Gamma-glutamyl hydrolase                                186   4e-52    Opisthocomus hoazin [hoatzin]
ref|XP_009632417.1|  PREDICTED: gamma-glutamyl hydrolase                186   4e-52    Egretta garzetta
ref|XP_010016975.1|  PREDICTED: gamma-glutamyl hydrolase                186   5e-52    Nestor notabilis
gb|KFQ53384.1|  Gamma-glutamyl hydrolase                                186   5e-52    Nestor notabilis
gb|KFU88050.1|  Gamma-glutamyl hydrolase                                186   6e-52    Chaetura pelagica
gb|KFP12067.1|  Gamma-glutamyl hydrolase                                186   7e-52    Egretta garzetta
ref|XP_009993891.1|  PREDICTED: gamma-glutamyl hydrolase                186   8e-52    Chaetura pelagica
ref|XP_005652325.1|  class I glutamine amidotransferase-like protein    187   9e-52    Coccomyxa subellipsoidea C-169
gb|KFP55993.1|  Gamma-glutamyl hydrolase                                186   9e-52    Cathartes aura
ref|XP_002595632.1|  hypothetical protein BRAFLDRAFT_275357             187   1e-51    Branchiostoma floridae
ref|XP_005152793.1|  PREDICTED: gamma-glutamyl hydrolase                187   1e-51    Melopsittacus undulatus
ref|XP_009936040.1|  PREDICTED: gamma-glutamyl hydrolase                186   1e-51    Opisthocomus hoazin [hoatzin]
ref|XP_008918537.1|  PREDICTED: gamma-glutamyl hydrolase                188   1e-51    
ref|XP_010071123.1|  PREDICTED: gamma-glutamyl hydrolase                185   1e-51    Pterocles gutturalis
ref|XP_005988287.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    186   1e-51    Latimeria chalumnae
gb|KFV00608.1|  Gamma-glutamyl hydrolase                                185   1e-51    Tauraco erythrolophus
gb|KGL97086.1|  Gamma-glutamyl hydrolase                                185   2e-51    Charadrius vociferus
gb|ACI68420.1|  Gamma-glutamyl hydrolase precursor                      186   2e-51    Salmo salar
ref|XP_009979902.1|  PREDICTED: gamma-glutamyl hydrolase                185   2e-51    Tauraco erythrolophus
emb|CDQ81962.1|  unnamed protein product                                186   2e-51    Oncorhynchus mykiss
gb|KFO77933.1|  Gamma-glutamyl hydrolase                                185   2e-51    Cuculus canorus
ref|XP_007231126.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    186   2e-51    
ref|XP_008945346.1|  PREDICTED: gamma-glutamyl hydrolase                184   2e-51    Merops nubicus
gb|KFQ20983.1|  Gamma-glutamyl hydrolase                                185   2e-51    Merops nubicus
ref|XP_008354553.1|  PREDICTED: gamma-glutamyl hydrolase 2-like         183   3e-51    
gb|KFZ55994.1|  Gamma-glutamyl hydrolase                                184   3e-51    Podiceps cristatus
ref|XP_005517480.1|  PREDICTED: gamma-glutamyl hydrolase                189   3e-51    
gb|KFV70089.1|  Gamma-glutamyl hydrolase                                185   3e-51    Picoides pubescens
ref|XP_009888091.1|  PREDICTED: gamma-glutamyl hydrolase                185   3e-51    Charadrius vociferus
ref|XP_009902444.1|  PREDICTED: gamma-glutamyl hydrolase                186   3e-51    Picoides pubescens
ref|XP_009971297.1|  PREDICTED: gamma-glutamyl hydrolase                184   3e-51    Tyto alba [Schleiereule]
ref|XP_005423104.1|  PREDICTED: gamma-glutamyl hydrolase                185   3e-51    
ref|XP_009501530.1|  PREDICTED: gamma-glutamyl hydrolase                184   3e-51    Phalacrocorax carbo [common cormorant]
ref|XP_003999883.1|  PREDICTED: gamma-glutamyl hydrolase                185   3e-51    
gb|KFV58816.1|  Gamma-glutamyl hydrolase                                184   4e-51    Tyto alba [Schleiereule]
gb|KFW90224.1|  Gamma-glutamyl hydrolase                                184   4e-51    Phalacrocorax carbo [common cormorant]
gb|KFP85763.1|  Gamma-glutamyl hydrolase                                184   4e-51    Apaloderma vittatum
ref|XP_010139831.1|  PREDICTED: gamma-glutamyl hydrolase                184   5e-51    Buceros rhinoceros silvestris
ref|XP_009561586.1|  PREDICTED: gamma-glutamyl hydrolase                184   5e-51    Cuculus canorus
ref|XP_007231561.1|  PREDICTED: gamma-glutamyl hydrolase-like           185   5e-51    
ref|XP_636287.1|  peptidase C26 family protein                          186   5e-51    Dictyostelium discoideum AX4
gb|KFO85082.1|  Gamma-glutamyl hydrolase                                183   6e-51    Buceros rhinoceros silvestris
ref|XP_011588830.1|  PREDICTED: gamma-glutamyl hydrolase                185   6e-51    Aquila chrysaetos canadensis
ref|XP_006370105.1|  hypothetical protein POPTR_0001s39540g             182   7e-51    
ref|XP_010219839.1|  PREDICTED: gamma-glutamyl hydrolase                183   7e-51    Tinamus guttatus
gb|KGL82032.1|  Gamma-glutamyl hydrolase                                183   7e-51    Tinamus guttatus
ref|XP_010175281.1|  PREDICTED: gamma-glutamyl hydrolase                183   7e-51    Antrostomus carolinensis
ref|XP_008642427.1|  PREDICTED: gamma-glutamyl hydrolase                184   8e-51    Corvus brachyrhynchos
gb|KFZ45669.1|  Gamma-glutamyl hydrolase                                183   8e-51    Antrostomus carolinensis
gb|KFW72792.1|  Gamma-glutamyl hydrolase                                183   8e-51    Pygoscelis adeliae
ref|XP_004359252.1|  hypothetical protein DFA_01284                     190   1e-50    Cavenderia fasciculata
ref|XP_009330385.1|  PREDICTED: gamma-glutamyl hydrolase                183   1e-50    Pygoscelis adeliae
gb|KFQ09872.1|  Gamma-glutamyl hydrolase                                182   1e-50    Haliaeetus albicilla
gb|ACO09704.1|  Gamma-glutamyl hydrolase precursor                      186   1e-50    Osmerus mordax
ref|XP_009864501.1|  PREDICTED: gamma-glutamyl hydrolase                184   1e-50    Apaloderma vittatum
ref|XP_010298803.1|  PREDICTED: gamma-glutamyl hydrolase                182   1e-50    Balearica regulorum gibbericeps
emb|CDQ59361.1|  unnamed protein product                                183   1e-50    Oncorhynchus mykiss
gb|KFO09908.1|  Gamma-glutamyl hydrolase                                182   1e-50    Balearica regulorum gibbericeps
ref|XP_009924525.1|  PREDICTED: gamma-glutamyl hydrolase                182   2e-50    Haliaeetus albicilla
ref|XP_004912572.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    183   2e-50    
ref|XP_009283787.1|  PREDICTED: gamma-glutamyl hydrolase                182   2e-50    Aptenodytes forsteri
ref|XP_005943740.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    183   2e-50    
gb|KFP27811.1|  Gamma-glutamyl hydrolase                                182   2e-50    Colius striatus
ref|XP_010198415.1|  PREDICTED: gamma-glutamyl hydrolase                182   2e-50    Colius striatus
gb|KFM01460.1|  Gamma-glutamyl hydrolase                                182   2e-50    Aptenodytes forsteri
ref|XP_002978799.1|  hypothetical protein SELMODRAFT_109437             179   2e-50    
ref|XP_010581262.1|  PREDICTED: gamma-glutamyl hydrolase                182   2e-50    
gb|ACI66462.1|  Gamma-glutamyl hydrolase precursor                      182   4e-50    
ref|XP_002595630.1|  hypothetical protein BRAFLDRAFT_275351             182   5e-50    
ref|XP_005730485.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    182   5e-50    
ref|XP_004372622.1|  PREDICTED: gamma-glutamyl hydrolase                182   5e-50    
gb|KFQ95121.1|  Gamma-glutamyl hydrolase                                181   6e-50    
ref|XP_005479735.1|  PREDICTED: gamma-glutamyl hydrolase                181   6e-50    
ref|XP_010403523.1|  PREDICTED: gamma-glutamyl hydrolase                181   6e-50    
ref|XP_009460946.1|  PREDICTED: gamma-glutamyl hydrolase                181   6e-50    
ref|XP_002710570.1|  PREDICTED: gamma-glutamyl hydrolase                182   7e-50    
ref|XP_004081412.1|  PREDICTED: gamma-glutamyl hydrolase-like           181   8e-50    
ref|XP_006012487.1|  PREDICTED: gamma-glutamyl hydrolase-like           181   9e-50    
ref|XP_010874408.1|  PREDICTED: RING finger protein 122 isoform X1      181   9e-50    
ref|XP_005943739.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    181   1e-49    
ref|XP_002671580.1|  predicted protein                                  180   1e-49    
ref|XP_002156669.1|  PREDICTED: gamma-glutamyl hydrolase A-like         181   1e-49    
ref|XP_006783068.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    181   2e-49    
ref|XP_004551883.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    180   2e-49    
gb|KFO99622.1|  Gamma-glutamyl hydrolase                                180   2e-49    
ref|XP_005469772.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    180   3e-49    
gb|KFV80511.1|  Gamma-glutamyl hydrolase                                179   3e-49    
ref|XP_007251560.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    179   5e-49    
ref|XP_005506577.1|  PREDICTED: gamma-glutamyl hydrolase                178   5e-49    
ref|XP_003968229.1|  PREDICTED: gamma-glutamyl hydrolase                179   6e-49    
ref|XP_009671852.1|  PREDICTED: gamma-glutamyl hydrolase                179   7e-49    
ref|XP_001636982.1|  predicted protein                                  179   7e-49    
ref|XP_003219641.1|  PREDICTED: gamma-glutamyl hydrolase                179   8e-49    
ref|XP_008287386.1|  PREDICTED: gamma-glutamyl hydrolase-like           179   9e-49    
ref|XP_002197287.2|  PREDICTED: gamma-glutamyl hydrolase                181   9e-49    
ref|XP_004548914.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    179   9e-49    
ref|XP_003439349.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    179   1e-48    
ref|XP_002595631.1|  hypothetical protein BRAFLDRAFT_200938             178   1e-48    
ref|XP_009088479.1|  PREDICTED: gamma-glutamyl hydrolase                181   1e-48    
ref|XP_005066278.1|  PREDICTED: gamma-glutamyl hydrolase                178   1e-48    
ref|XP_005795110.1|  PREDICTED: gamma-glutamyl hydrolase-like           178   1e-48    
ref|XP_006625568.1|  PREDICTED: gamma-glutamyl hydrolase-like           179   2e-48    
ref|XP_005730484.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    178   2e-48    
ref|XP_004551881.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    178   2e-48    
ref|NP_034411.2|  gamma-glutamyl hydrolase precursor                    178   2e-48    
gb|KDR20013.1|  Gamma-glutamyl hydrolase                                178   2e-48    
ref|XP_004551882.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    177   2e-48    
ref|XP_005231600.1|  PREDICTED: gamma-glutamyl hydrolase                177   2e-48    
ref|XP_007613199.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     177   2e-48    
ref|NP_001104645.1|  uncharacterized protein LOC563836 precursor        177   2e-48    
ref|XP_008490429.1|  PREDICTED: gamma-glutamyl hydrolase                180   2e-48    
ref|XP_003505759.2|  PREDICTED: gamma-glutamyl hydrolase isoform X1     178   2e-48    
gb|EMC87051.1|  Gamma-glutamyl hydrolase                                176   3e-48    
ref|XP_005847461.1|  hypothetical protein CHLNCDRAFT_52559              179   3e-48    
ref|XP_004343749.1|  gamma-glutamyl hydrolase A                         177   3e-48    
ref|XP_006261097.1|  PREDICTED: gamma-glutamyl hydrolase                177   4e-48    
ref|XP_010775082.1|  PREDICTED: gamma-glutamyl hydrolase-like           177   5e-48    
ref|XP_002740732.1|  PREDICTED: gamma-glutamyl hydrolase-like           177   5e-48    
ref|XP_004072343.2|  PREDICTED: gamma-glutamyl hydrolase-like           177   5e-48    
ref|XP_008416492.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    176   5e-48    
ref|XP_004814095.1|  PREDICTED: gamma-glutamyl hydrolase                177   5e-48    
ref|XP_004773000.1|  PREDICTED: gamma-glutamyl hydrolase                177   6e-48    
gb|AAI24119.1|  LOC553228 protein                                       177   6e-48    
ref|XP_005042227.1|  PREDICTED: gamma-glutamyl hydrolase                177   6e-48    
ref|XP_005443321.1|  PREDICTED: gamma-glutamyl hydrolase                176   6e-48    
ref|NP_001025598.1|  gamma-glutamyl hydrolase precursor                 176   7e-48    
ref|XP_008416491.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    176   7e-48    
ref|XP_005449148.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    176   7e-48    
ref|XP_006019197.1|  PREDICTED: gamma-glutamyl hydrolase                176   9e-48    
ref|XP_006799271.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    176   1e-47    
ref|XP_010984857.1|  PREDICTED: gamma-glutamyl hydrolase                176   1e-47    
ref|XP_004435789.1|  PREDICTED: gamma-glutamyl hydrolase                176   1e-47    
ref|XP_010968962.1|  PREDICTED: gamma-glutamyl hydrolase                176   1e-47    
gb|AAI34126.1|  LOC553228 protein                                       176   2e-47    
gb|AAH93328.1|  LOC553228 protein                                       175   3e-47    
gb|EFN70834.1|  Gamma-glutamyl hydrolase                                176   3e-47    
ref|XP_003408374.1|  PREDICTED: gamma-glutamyl hydrolase                174   3e-47    
ref|NP_001243151.1|  gamma-glutamyl hydrolase precursor                 174   4e-47    
gb|EGW11198.1|  Gamma-glutamyl hydrolase                                173   4e-47    
emb|CDQ65392.1|  unnamed protein product                                174   5e-47    
gb|AAI54503.1|  LOC553228 protein                                       174   6e-47    
gb|AAH76459.1|  LOC553228 protein                                       174   7e-47    
ref|XP_002166069.2|  PREDICTED: gamma-glutamyl hydrolase A-like         174   8e-47    
ref|XP_006442390.1|  hypothetical protein CICLE_v10022857mg             167   8e-47    
ref|XP_001926738.1|  PREDICTED: gamma-glutamyl hydrolase                174   9e-47    
ref|XP_005803695.1|  PREDICTED: gamma-glutamyl hydrolase-like           173   9e-47    
ref|XP_007557581.1|  PREDICTED: gamma-glutamyl hydrolase-like           174   1e-46    
ref|XP_004011748.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     173   1e-46    
ref|XP_006880500.1|  PREDICTED: gamma-glutamyl hydrolase                173   1e-46    
ref|XP_010884125.1|  PREDICTED: gamma-glutamyl hydrolase-like           173   1e-46    
ref|XP_003294636.1|  hypothetical protein DICPUDRAFT_51633              172   1e-46    
ref|XP_004398839.1|  PREDICTED: gamma-glutamyl hydrolase                173   1e-46    
gb|KIZ06309.1|  gamma-glutamyl hydrolase                                174   1e-46    
gb|KFM77469.1|  Gamma-glutamyl hydrolase                                173   2e-46    
ref|XP_012064117.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    173   2e-46    
ref|XP_001513787.2|  PREDICTED: gamma-glutamyl hydrolase                172   2e-46    
ref|XP_007555757.1|  PREDICTED: gamma-glutamyl hydrolase-like           172   2e-46    
ref|NP_001086160.1|  gamma-glutamyl hydrolase (conjugase, folylpo...    172   2e-46    
ref|XP_003974928.1|  PREDICTED: gamma-glutamyl hydrolase-like           172   2e-46    
ref|XP_002740734.1|  PREDICTED: gamma-glutamyl hydrolase-like           172   3e-46    
ref|XP_008704953.1|  PREDICTED: gamma-glutamyl hydrolase                172   3e-46    
ref|XP_010344363.1|  PREDICTED: gamma-glutamyl hydrolase                171   3e-46    
gb|KDR20012.1|  Gamma-glutamyl hydrolase                                172   3e-46    
ref|XP_005288158.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    173   4e-46    
ref|XP_011362877.1|  PREDICTED: gamma-glutamyl hydrolase                172   5e-46    
ref|XP_008334216.1|  PREDICTED: gamma-glutamyl hydrolase-like           173   5e-46    
ref|XP_005323027.1|  PREDICTED: gamma-glutamyl hydrolase                171   6e-46    
ref|XP_006734306.1|  PREDICTED: gamma-glutamyl hydrolase                171   6e-46    
ref|XP_011252591.1|  PREDICTED: chitobiosyldiphosphodolichol beta...    178   6e-46    
ref|XP_002166220.1|  PREDICTED: gamma-glutamyl hydrolase A-like         172   7e-46    
ref|XP_010863022.1|  PREDICTED: gamma-glutamyl hydrolase-like           171   8e-46    
ref|XP_007526913.1|  PREDICTED: gamma-glutamyl hydrolase                171   9e-46    
gb|AAI50899.1|  Gamma-glutamyl hydrolase                                171   1e-45    
ref|XP_008835806.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     171   1e-45    
ref|XP_002819168.1|  PREDICTED: gamma-glutamyl hydrolase                170   1e-45    
ref|XP_003831430.1|  PREDICTED: gamma-glutamyl hydrolase                170   2e-45    
dbj|BAF83139.1|  unnamed protein product                                170   2e-45    
ref|XP_008290933.1|  PREDICTED: gamma-glutamyl hydrolase                170   2e-45    
ref|NP_003869.1|  gamma-glutamyl hydrolase precursor                    170   2e-45    
ref|XP_001159345.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     170   2e-45    
ref|XP_001636983.1|  predicted protein                                  169   2e-45    
ref|XP_005452234.1|  PREDICTED: gamma-glutamyl hydrolase-like           170   2e-45    
ref|XP_003759794.1|  PREDICTED: gamma-glutamyl hydrolase                170   2e-45    
ref|XP_011304816.1|  PREDICTED: gamma-glutamyl hydrolase B-like i...    170   2e-45    
gb|AAC70003.1|  gamma-glutamyl hydrolase precursor                      170   2e-45    
ref|XP_004653382.1|  PREDICTED: gamma-glutamyl hydrolase                170   2e-45    
ref|XP_007085095.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    169   3e-45    
ref|XP_006631142.1|  PREDICTED: gamma-glutamyl hydrolase-like           170   3e-45    
ref|XP_011304814.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    170   3e-45    
pdb|1L9X|A  Chain A, Structure Of Gamma-Glutamyl Hydrolase              169   3e-45    
ref|XP_001601392.2|  PREDICTED: gamma-glutamyl hydrolase A-like i...    169   3e-45    
ref|XP_007168627.1|  PREDICTED: gamma-glutamyl hydrolase                169   3e-45    
ref|XP_005361968.1|  PREDICTED: gamma-glutamyl hydrolase                169   3e-45    
ref|NP_037092.1|  gamma-glutamyl hydrolase precursor                    169   4e-45    
ref|XP_008214312.1|  PREDICTED: gamma-glutamyl hydrolase A-like i...    169   4e-45    
ref|XP_002905277.1|  gamma-glutamyl hydrolase, putative                 169   4e-45    
ref|XP_004275026.1|  PREDICTED: gamma-glutamyl hydrolase                169   4e-45    
ref|XP_007487124.1|  PREDICTED: gamma-glutamyl hydrolase                169   5e-45    
ref|XP_008896163.1|  hypothetical protein PPTG_04091                    169   5e-45    
ref|XP_006789926.1|  PREDICTED: gamma-glutamyl hydrolase-like           169   5e-45    
gb|ETI36148.1|  hypothetical protein F443_17672                         169   5e-45    
gb|KIZ06563.1|  gamma-glutamyl hydrolase                                171   6e-45    
gb|EGI70452.1|  Gamma-glutamyl hydrolase B                              169   6e-45    
ref|XP_011160978.1|  PREDICTED: gamma-glutamyl hydrolase-like           170   7e-45    
ref|XP_007455320.1|  PREDICTED: gamma-glutamyl hydrolase                168   7e-45    
ref|XP_011304813.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    170   7e-45    
ref|XP_010358670.1|  PREDICTED: gamma-glutamyl hydrolase                168   8e-45    
gb|ETL83038.1|  hypothetical protein L917_16928                         169   8e-45    
gb|KFV43190.1|  Gamma-glutamyl hydrolase                                166   8e-45    
ref|NP_001192053.1|  gamma-glutamyl hydrolase-like precursor            168   1e-44    
ref|XP_010639617.1|  PREDICTED: gamma-glutamyl hydrolase                168   1e-44    
gb|AAH09809.1|  Gamma-glutamyl hydrolase                                168   1e-44    
ref|XP_004588067.1|  PREDICTED: gamma-glutamyl hydrolase                167   1e-44    
gb|AAC70002.1|  gamma glutamyl hydrolase precursor                      167   2e-44    
gb|ELT93533.1|  hypothetical protein CAPTEDRAFT_104938                  167   2e-44    
ref|XP_011058399.1|  PREDICTED: gamma-glutamyl hydrolase A-like         169   2e-44    
ref|XP_004679905.1|  PREDICTED: gamma-glutamyl hydrolase                167   2e-44    
ref|XP_006185877.1|  PREDICTED: gamma-glutamyl hydrolase                166   2e-44    
ref|XP_004642424.1|  PREDICTED: gamma-glutamyl hydrolase                167   2e-44    
ref|XP_010741799.1|  PREDICTED: gamma-glutamyl hydrolase                167   2e-44    
ref|XP_009521534.1|  hypothetical protein PHYSODRAFT_359609             167   3e-44    
ref|NP_001142323.1|  uncharacterized protein LOC100274493 precursor     162   3e-44    
ref|XP_001495890.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     167   3e-44    
gb|KFQ80861.1|  Gamma-glutamyl hydrolase                                164   4e-44    
ref|XP_009811210.1|  PREDICTED: gamma-glutamyl hydrolase                164   4e-44    
ref|XP_011787326.1|  PREDICTED: gamma-glutamyl hydrolase                166   4e-44    
ref|XP_004547177.1|  PREDICTED: gamma-glutamyl hydrolase-like           166   4e-44    
ref|XP_003640062.1|  PREDICTED: gamma-glutamyl hydrolase                166   4e-44    
gb|KDO31557.1|  hypothetical protein SPRG_03486                         166   5e-44    
gb|KDO17663.1|  hypothetical protein SPRG_16945                         166   6e-44    
ref|XP_011401628.1|  Gamma-glutamyl hydrolase A                         167   7e-44    
gb|EFX77408.1|  hypothetical protein DAPPUDRAFT_305752                  166   7e-44    
ref|XP_004602484.1|  PREDICTED: gamma-glutamyl hydrolase                166   7e-44    
ref|XP_006170664.1|  PREDICTED: gamma-glutamyl hydrolase                166   7e-44    
ref|XP_005392230.1|  PREDICTED: gamma-glutamyl hydrolase                166   8e-44    
ref|XP_007998939.1|  PREDICTED: gamma-glutamyl hydrolase                166   8e-44    
ref|XP_008067304.1|  PREDICTED: gamma-glutamyl hydrolase                164   9e-44    
ref|XP_006204797.1|  PREDICTED: gamma-glutamyl hydrolase                168   9e-44    
ref|XP_004327416.1|  PREDICTED: gamma-glutamyl hydrolase isoform 1      165   1e-43    
ref|XP_005919127.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    165   1e-43    
gb|EFZ17480.1|  hypothetical protein SINV_12245                         166   1e-43    
ref|XP_002679966.1|  predicted protein                                  164   1e-43    
ref|XP_004047140.1|  PREDICTED: gamma-glutamyl hydrolase                167   2e-43    
gb|KDD75679.1|  hypothetical protein H632_c555p0                        166   2e-43    
ref|XP_005643894.1|  class I glutamine amidotransferase-like protein    166   2e-43    
ref|XP_008861998.1|  hypothetical protein H310_00846                    165   2e-43    
ref|XP_004697814.1|  PREDICTED: gamma-glutamyl hydrolase                163   2e-43    
ref|XP_008835805.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     165   2e-43    
ref|XP_008406524.1|  PREDICTED: gamma-glutamyl hydrolase-like           164   3e-43    
ref|XP_007559766.1|  PREDICTED: gamma-glutamyl hydrolase-like           164   3e-43    
ref|XP_008589768.1|  PREDICTED: gamma-glutamyl hydrolase                164   4e-43    
ref|XP_005972129.1|  PREDICTED: gamma-glutamyl hydrolase                163   4e-43    
ref|XP_010741409.1|  PREDICTED: gamma-glutamyl hydrolase-like           164   4e-43    
ref|XP_008214314.1|  PREDICTED: gamma-glutamyl hydrolase A-like i...    162   4e-43    
gb|EHH64195.1|  Gamma-glutamyl hydrolase                                163   4e-43    
ref|XP_011914007.1|  PREDICTED: gamma-glutamyl hydrolase                164   5e-43    
ref|XP_003902852.1|  PREDICTED: gamma-glutamyl hydrolase                163   5e-43    
ref|XP_004842191.1|  PREDICTED: gamma-glutamyl hydrolase                163   5e-43    
ref|XP_011304818.1|  PREDICTED: gamma-glutamyl hydrolase B-like i...    163   6e-43    
ref|XP_004068950.1|  PREDICTED: gamma-glutamyl hydrolase-like           163   8e-43    
ref|NP_001247641.1|  gamma-glutamyl hydrolase precursor                 163   8e-43    
ref|NP_001098864.1|  gamma-glutamyl hydrolase precursor                 163   8e-43    
ref|XP_011139565.1|  PREDICTED: gamma-glutamyl hydrolase A-like         163   1e-42    
ref|XP_006055980.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     162   1e-42    
ref|XP_004894417.1|  PREDICTED: gamma-glutamyl hydrolase                162   1e-42    
ref|XP_008609246.1|  hypothetical protein SDRG_05311                    162   2e-42    
ref|XP_010731504.1|  PREDICTED: gamma-glutamyl hydrolase-like           163   2e-42    
ref|XP_003480001.1|  PREDICTED: gamma-glutamyl hydrolase isoform X1     162   2e-42    
ref|XP_005613149.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     161   2e-42    
ref|XP_006055981.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     160   2e-42    
ref|XP_008544457.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    162   3e-42    
ref|XP_007117832.1|  PREDICTED: gamma-glutamyl hydrolase                162   3e-42    
ref|XP_002118342.1|  hypothetical protein TRIADDRAFT_34071              160   3e-42    
ref|XP_005008316.1|  PREDICTED: gamma-glutamyl hydrolase isoform X2     161   3e-42    
ref|XP_004551884.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    160   4e-42    
ref|XP_005730486.1|  PREDICTED: gamma-glutamyl hydrolase-like iso...    160   4e-42    
ref|XP_003596309.1|  Gamma-glutamyl hydrolase                           155   4e-42    
ref|XP_004209779.1|  PREDICTED: gamma-glutamyl hydrolase A-like         161   4e-42    
ref|XP_006994586.1|  PREDICTED: gamma-glutamyl hydrolase                160   4e-42    
ref|XP_008141528.1|  PREDICTED: gamma-glutamyl hydrolase                161   4e-42    
ref|XP_009829556.1|  hypothetical protein H257_06133                    161   5e-42    
ref|XP_011837579.1|  PREDICTED: gamma-glutamyl hydrolase                163   7e-42    
ref|XP_008306468.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-glutam...    160   7e-42    
gb|EHB09195.1|  Gamma-glutamyl hydrolase                                159   9e-42    
ref|XP_005689147.1|  PREDICTED: gamma-glutamyl hydrolase                160   1e-41    
ref|XP_007892422.1|  PREDICTED: gamma-glutamyl hydrolase-like           160   1e-41    
ref|XP_001700978.1|  gamma-glutamyl hydrolase                           161   1e-41    



>dbj|BAO57292.1| gamma-glutamyl hydrolase [Ipomoea nil]
Length=343

 Score =   459 bits (1180),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 221/306 (72%), Positives = 260/306 (85%), Gaps = 0/306 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPD  LNYRPVIGIVSHPGDGA  R SNA+ VSYIAAS VKFVESAGARVIPLIYNEP
Sbjct  37    CPAPDGDLNYRPVIGIVSHPGDGAKSRFSNASDVSYIAASYVKFVESAGARVIPLIYNEP  96

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E LI+KLNLVNGV+F GGS +KG Y E +K I++KVLEKND GD+FPLLAI LGF+LLT
Sbjct  97    PEILIQKLNLVNGVLFTGGSSKKGLYFEVVKGIFQKVLEKNDAGDHFPLLAICLGFELLT  156

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+++DN ILE F+A+NQAS LQ VEG N EGTLFQRFP ELL+K+ ++CLVMQNH +GI
Sbjct  157   MIITKDNNILEGFNAANQASKLQFVEGANFEGTLFQRFPSELLKKMSKDCLVMQNHHYGI  216

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE F+A+ADL NFF +LTTS D+DNK+YVST+Q + YPV AVQW PE+NAFEW LSEIP
Sbjct  217   SPEKFRANADLCNFFKILTTSADQDNKIYVSTVQAEHYPVTAVQWHPEKNAFEWGLSEIP  276

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS*  123
             H+EDAILV+Q+VANYF+SEARKS N P+  +V +NLIYNY+ SYSGK GSGF EVYIF+ 
Sbjct  277   HTEDAILVTQNVANYFISEARKSLNRPDAQEVLNNLIYNYSPSYSGKSGSGFDEVYIFTQ  336

Query  122   DYGVIS  105
             + G+ S
Sbjct  337   NSGLSS  342



>ref|XP_006348322.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Solanum tuberosum]
Length=340

 Score =   425 bits (1093),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 251/312 (80%), Gaps = 0/312 (0%)
 Frame = -3

Query  1061  SYLLNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVES  882
             S L  +N  L   CPAPDP+LNYRP+IGIVSHPGDGA+GR+SNAT VSYIAAS VKF E 
Sbjct  21    SQLFVSNQILPPSCPAPDPTLNYRPIIGIVSHPGDGATGRLSNATNVSYIAASYVKFAEM  80

Query  881   AGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNF  702
             AGARVIPLIY EP E L +KLNLVNG++F GG  + G Y + +K I++KVLEKND G++F
Sbjct  81    AGARVIPLIYTEPPEVLNQKLNLVNGIIFTGGWAKDGLYFDVIKGIFQKVLEKNDAGEHF  140

Query  701   PLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVG  522
             PLLAI LG++LLT+I++ DN ILE+FSA++QAST+Q VE +N++GT+F RFP  LL+K+ 
Sbjct  141   PLLAICLGYELLTMIITNDNNILEEFSAASQASTVQFVENVNIDGTVFGRFPPVLLKKMS  200

Query  521   EECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAP  342
              +CLVMQNH +GISPE FQA+ DLS+FF VLTTS D++NKVYVSTIQ  +YP+ A QW P
Sbjct  201   IDCLVMQNHHFGISPERFQANKDLSSFFRVLTTSTDENNKVYVSTIQATRYPIAAFQWHP  260

Query  341   ERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGK  162
             E+NAFEW  S IPHSEDAI V+  VANYF+SEARKSSN P   +V D+LIYNYN +Y GK
Sbjct  261   EKNAFEWGSSRIPHSEDAIQVTTHVANYFISEARKSSNKPVAREVLDSLIYNYNPTYGGK  320

Query  161   DGSGFVEVYIFS  126
              G G+ EVY+F+
Sbjct  321   AGKGYDEVYLFT  332



>emb|CDP06032.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   426 bits (1094),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 203/304 (67%), Positives = 246/304 (81%), Gaps = 0/304 (0%)
 Frame = -3

Query  1037  KLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPL  858
             +LS  CPAPDP LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPL
Sbjct  94    RLSPSCPAPDPKLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPL  153

Query  857   IYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  678
             IYNEP E L  KL+LVNGV+F GG  + G Y + +  ++K+VLEKND GD+FPL+AI LG
Sbjct  154   IYNEPLEVLEMKLSLVNGVLFTGGWAKSGLYFDVVGTVFKRVLEKNDAGDHFPLVAICLG  213

Query  677   FQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQN  498
             F+LLT+I+S+DN ILE+FSA++QASTLQ V  +N+EGT+FQRFP +LL+K+  +CLVMQN
Sbjct  214   FELLTMIISKDNDILEQFSAADQASTLQFVGSINLEGTVFQRFPPDLLKKLSTDCLVMQN  273

Query  497   HKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWA  318
             H +GISPE+F+  A L NFF +LTTS D+++KVYVST++   YPV A QW PE+NAFEW 
Sbjct  274   HHYGISPETFRKTAALCNFFQILTTSADENDKVYVSTVKANDYPVTAFQWHPEKNAFEWG  333

Query  317   LSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEV  138
             LS IPHSEDAI V+Q VAN+FVSEARKS N P    V DNLIYNY  +Y GK G G+ EV
Sbjct  334   LSMIPHSEDAIQVTQYVANFFVSEARKSLNRPPARKVLDNLIYNYTPTYCGKAGRGYDEV  393

Query  137   YIFS  126
             YIF+
Sbjct  394   YIFT  397



>ref|NP_001234434.1| gamma-glutamylhydrolase 1 precursor [Solanum lycopersicum]
 gb|ACC86848.1| gamma-glutamylhydrolase 1 [Solanum lycopersicum]
Length=340

 Score =   422 bits (1085),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 249/311 (80%), Gaps = 0/311 (0%)
 Frame = -3

Query  1061  SYLLNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVES  882
             S L N+   L   CPAPDP+LNYRP+IGIVSHPGDGA+GR+SNAT VSYIAAS VKF E 
Sbjct  21    SQLFNSYLTLPSSCPAPDPALNYRPIIGIVSHPGDGATGRLSNATNVSYIAASYVKFAEM  80

Query  881   AGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNF  702
             AGARVIPLIY EP + L +KLNLVNG++F GG  + G Y + +K I++KVLEKND G++F
Sbjct  81    AGARVIPLIYTEPPQVLNQKLNLVNGIIFTGGWAKDGLYFDVIKGIFQKVLEKNDAGEHF  140

Query  701   PLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVG  522
             PLLAI LG++LLT+I++ DN ILE+FSA++QAST+Q VE +N+EGT+F RFP  LL+K+ 
Sbjct  141   PLLAICLGYELLTMIITNDNNILEEFSAASQASTVQFVENVNIEGTIFGRFPPVLLKKMS  200

Query  521   EECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAP  342
              +CLVMQNH +GISPE FQ + DLS+FF VLTTS D++NKVYVSTIQ ++YP+ A QW P
Sbjct  201   IDCLVMQNHHFGISPERFQVNKDLSSFFRVLTTSTDENNKVYVSTIQAQRYPIAAFQWHP  260

Query  341   ERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGK  162
             E+NAFEW  S IPHSEDAI V+  VANYF+SEARKSSN P   +V D+LIYN N +Y GK
Sbjct  261   EKNAFEWGSSRIPHSEDAIQVTTHVANYFISEARKSSNKPVAREVLDSLIYNNNPTYGGK  320

Query  161   DGSGFVEVYIF  129
              G G+ EVY+F
Sbjct  321   AGKGYDEVYLF  331



>ref|XP_009769712.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Nicotiana sylvestris]
 gb|AIE54277.1| gamma-glutamylhydrolase 2 [Nicotiana tabacum]
Length=342

 Score =   422 bits (1084),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/299 (67%), Positives = 241/299 (81%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PDP+LNYRPVIGIVSHPGDGASGR++N T VSYIAAS VKF E AGARVIPLIY EP
Sbjct  36    CPGPDPTLNYRPVIGIVSHPGDGASGRLNNGTDVSYIAASYVKFAEMAGARVIPLIYTEP  95

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y E +K I++KVLEKND G++FPLLAI LGF+LLT
Sbjct  96    PEILNQKLNLVNGVIFTGGRVKDGLYFEVVKGIFQKVLEKNDAGEHFPLLAICLGFELLT  155

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE+FSA+NQAST+Q VE + +E T+F RFP  L++K+  +CLVMQNH +GI
Sbjct  156   MIISKDNNILEEFSAANQASTVQFVENVKLERTVFGRFPSVLIKKMSTDCLVMQNHHFGI  215

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  QA+ DL +FF +LTTS DK NKVYVST Q ++YPV AVQW PE+N FEW  S+IP
Sbjct  216   SPERLQANKDLCSFFRILTTSTDKKNKVYVSTAQARRYPVTAVQWHPEKNVFEWRSSQIP  275

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             H+EDAI V+Q VANYFVSEARKSSN P    + DNLIYNY+ S++GK G  F EVY+FS
Sbjct  276   HTEDAIQVTQHVANYFVSEARKSSNKPAPSKLLDNLIYNYSPSFAGKAGGSFDEVYLFS  334



>ref|XP_006442404.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 ref|XP_006442407.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55644.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55647.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=380

 Score =   423 bits (1087),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/303 (66%), Positives = 242/303 (80%), Gaps = 0/303 (0%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
              S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  78    FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  137

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             +NEP E L +KL LVNG+++PGG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  138   FNEPEEILFEKLELVNGILYPGGWAKNGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  197

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +CLVMQNH
Sbjct  198   ELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNH  257

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
              +GISPE  QA+ +L+ FF +LTTS+D+ NKVYVST+Q   YPV A QW PE+NAFEW  
Sbjct  258   HYGISPERMQANQELAKFFKILTTSMDEYNKVYVSTVQAYNYPVTAFQWHPEKNAFEWGP  317

Query  314   SEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
               IPH+EDAI V+Q  AN+F+SEARKSSN P    V DNLIYNY+ +Y GK G G+ EVY
Sbjct  318   KAIPHTEDAIRVTQQAANFFISEARKSSNRPPARKVLDNLIYNYSPTYCGKAGKGYDEVY  377

Query  134   IFS  126
             IF+
Sbjct  378   IFT  380



>ref|XP_009605608.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Nicotiana tomentosiformis]
Length=340

 Score =   421 bits (1082),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/300 (67%), Positives = 244/300 (81%), Gaps = 0/300 (0%)
 Frame = -3

Query  1028  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
              GCP PDP LNYRPVIGIVSHPGDGASGRI N+T VSYIAAS VKFVESAGARVIPL++ 
Sbjct  33    AGCPVPDPRLNYRPVIGIVSHPGDGASGRIVNSTSVSYIAASYVKFVESAGARVIPLLFE  92

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             +  + L +KLNLVNGV+FPGG  +KG+Y E +K I+KKVLEKND  ++FPLLAINLGF+L
Sbjct  93    DSPQVLNQKLNLVNGVIFPGGWAKKGKYFETIKAIFKKVLEKNDADEHFPLLAINLGFEL  152

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             L +IVS+DN ILEKFS SNQAS L  VE +N+E T+F RFP  LL+K+ +ECLV+Q +K+
Sbjct  153   LMMIVSKDNNILEKFSVSNQASKLHFVETVNIEDTVFGRFPPTLLKKLSKECLVLQRNKY  212

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             G+SPE FQA+ DLS+FF +LTTS D  NKV+VST+Q + YP+ A+QW PE++AFEW  S 
Sbjct  213   GLSPEKFQANDDLSSFFIMLTTSTDTRNKVFVSTLQAENYPITALQWHPEKSAFEWGSSA  272

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPHSEDA+ V+Q VANYFVSEARKSSN P+   V DNLIYNY+ +YSG  G G+ EVYIF
Sbjct  273   IPHSEDAVQVTQLVANYFVSEARKSSNKPDAQKVLDNLIYNYSPTYSGNAGKGYDEVYIF  332



>ref|XP_009803991.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Nicotiana sylvestris]
Length=337

 Score =   419 bits (1078),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 198/300 (66%), Positives = 246/300 (82%), Gaps = 0/300 (0%)
 Frame = -3

Query  1028  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
              GCP PDP LNYRPVIGI+SHPGDGASGRI N+T VSY+AAS VKFVESAGARVIPL+++
Sbjct  30    AGCPVPDPRLNYRPVIGIISHPGDGASGRIVNSTSVSYVAASYVKFVESAGARVIPLLFD  89

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             +  + L +KL+LVNGV+FPGG   KG+Y E +K I+KKVLEKND G++FPLLAINLGF+L
Sbjct  90    DSPQVLNQKLDLVNGVIFPGGWARKGKYFETVKAIFKKVLEKNDAGEHFPLLAINLGFEL  149

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             L +IVS+DN ILEKFS SNQAS L  VE +N+E T+F RFP  L++K+ +ECLV+Q +K+
Sbjct  150   LMMIVSKDNNILEKFSVSNQASKLHFVETVNIEDTVFGRFPPTLIKKLSKECLVLQRNKY  209

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             G+SPE FQA+ DLS+FF +LTTS D  NKV+VST+Q + YP+ A+QW PE++AFEW  + 
Sbjct  210   GLSPEKFQANDDLSSFFIMLTTSTDTRNKVFVSTLQAENYPITALQWHPEKSAFEWGSAA  269

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPHSEDA+ V+Q VANYFVSEARKSSN P+   V D+LIYNY+ +YSGK G G+ EVYIF
Sbjct  270   IPHSEDAVQVTQLVANYFVSEARKSSNKPDAQKVLDSLIYNYSPTYSGKAGKGYDEVYIF  329



>ref|XP_011098203.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Sesamum indicum]
Length=390

 Score =   421 bits (1083),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 201/299 (67%), Positives = 243/299 (81%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP+ DP+LN+RPVIGI+SHPGDGASGR++N T  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  92    CPSGDPNLNFRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPLIYNEP  151

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KLNLVNGV+F GG  + G Y E ++ I+K +L KND GD+FPLLAI LGF+LLT
Sbjct  152   PQILNEKLNLVNGVIFTGGWAKSGLYFEVVESIFKNILRKNDAGDHFPLLAICLGFELLT  211

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVSEDN ILE+FSA++QASTLQ VE +++ GT+FQRFP  LL+K+  ECLVMQNH++GI
Sbjct  212   MIVSEDNNILEQFSAADQASTLQFVENIDINGTVFQRFPPILLKKLNTECLVMQNHRYGI  271

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE FQ +  L +FF +LTTS+D+D+KVYVST+Q  +YPV AVQW PE+NAFEW LS IP
Sbjct  272   SPEKFQKNKSLCSFFKILTTSVDEDDKVYVSTVQACRYPVTAVQWHPEKNAFEWGLSRIP  331

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VAN+F+ EAR S N P    V DNLIYNY+ +Y GK G GF EVYIFS
Sbjct  332   HSEDAIQVTQHVANFFIREARMSINRPPAKKVLDNLIYNYSPTYCGKAGRGFDEVYIFS  390



>ref|XP_012074574.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Jatropha curcas]
 gb|KDP46038.1| hypothetical protein JCGZ_13484 [Jatropha curcas]
Length=385

 Score =   421 bits (1082),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/299 (67%), Positives = 242/299 (81%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP LNYRPVIGI+SHPGDGAS R++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  85    CPAPDPKLNYRPVIGILSHPGDGASRRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  144

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y + +K I+K+VL KND G +FPL AI LGF+LLT
Sbjct  145   PEVLFEKLNLVNGVLFTGGRVKTGLYYDIVKAIFKRVLAKNDAGYHFPLYAICLGFELLT  204

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE F+A++QASTLQ ++ +N+EGT+FQRFP +LL+K+  +CLVMQNH +GI
Sbjct  205   MIISKDNNILESFNATDQASTLQFMKNINIEGTVFQRFPPDLLKKLSTDCLVMQNHHYGI  264

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+  Q + DLS+FF +LTTS D DNKVYVST+Q  +YPV A QW PE+NAFEW LS IP
Sbjct  265   SPQRLQENHDLSSFFKILTTSADTDNKVYVSTVQAHRYPVSAFQWHPEKNAFEWGLSMIP  324

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VAN+FVSEARKS N P    V DNLIYN++ +Y GK G G+ EVYIF+
Sbjct  325   HSEDAIQVTQHVANFFVSEARKSLNRPPARKVLDNLIYNFSPTYCGKAGRGYDEVYIFT  383



>ref|XP_009630845.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Nicotiana tomentosiformis]
Length=341

 Score =   417 bits (1072),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 199/299 (67%), Positives = 241/299 (81%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PDP+LNYRPVIGIVSHPGDGASGR++N T VSYIAAS VKF E AGARVIPLIY+EP
Sbjct  35    CPGPDPTLNYRPVIGIVSHPGDGASGRLNNGTDVSYIAASYVKFAEMAGARVIPLIYSEP  94

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y E +K I++KVLEKND G++FPLLAI LGF+LLT
Sbjct  95    PEILNQKLNLVNGVIFTGGRVKDGLYFEVVKGIFQKVLEKNDAGEHFPLLAICLGFELLT  154

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE+FSA+NQAST+Q +E + +E T+F RFP  L++K+   CLVMQNH +GI
Sbjct  155   MIISKDNNILEEFSAANQASTVQFMENIKLERTVFGRFPPVLIKKMSTLCLVMQNHHFGI  214

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  QA+ DL +FF +LTTS DK NKVYVST Q ++YPV A+QW PE+N FEW  S+IP
Sbjct  215   SPERLQANKDLCSFFRILTTSTDKKNKVYVSTAQARRYPVTALQWHPEKNVFEWRSSQIP  274

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             H+EDAI V+Q VANYFVSEARKSSN P    + DNLIYNY+ S++GK G  F EVY+FS
Sbjct  275   HTEDAIQVTQHVANYFVSEARKSSNKPAPSKLLDNLIYNYSPSFAGKAGGSFDEVYLFS  333



>ref|XP_010060723.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Eucalyptus 
grandis]
Length=360

 Score =   417 bits (1073),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 239/302 (79%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             +  CPAPDP LN+RPVIGI+SHPGDGASGR+SNA+  S+I AS VKFVESAGA VIPLIY
Sbjct  59    AADCPAPDPKLNFRPVIGILSHPGDGASGRLSNASDASFIPASYVKFVESAGATVIPLIY  118

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L++KLN+VNGV+F GG    G Y E ++ I+KKVL KND GD+FPL A  LGFQ
Sbjct  119   NEPREVLLEKLNMVNGVLFTGGWASTGLYYETVEAIFKKVLAKNDAGDHFPLYATCLGFQ  178

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+IVS+D  ILE+F+A++QASTLQ +   N+EGT+FQRFP +LL+K+  +CLVMQNH 
Sbjct  179   LLTMIVSKDKGILEEFNAAHQASTLQFMRNTNIEGTVFQRFPPDLLKKLSTDCLVMQNHH  238

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE      DL+NFF VLTTS D+DNKVYVST+Q   YP+ A QW PE+NAFEW LS
Sbjct  239   YGISPERLMQSTDLTNFFKVLTTSTDRDNKVYVSTVQAHSYPITAFQWHPEKNAFEWGLS  298

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G G+ EVYI
Sbjct  299   MIPHSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGKGYDEVYI  358

Query  131   FS  126
             F+
Sbjct  359   FT  360



>ref|XP_010060720.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Eucalyptus grandis]
 gb|KCW67545.1| hypothetical protein EUGRSUZ_F01299 [Eucalyptus grandis]
Length=394

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 244/306 (80%), Gaps = 4/306 (1%)
 Frame = -3

Query  1031  SGG----CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVI  864
             SGG    CPA DP LN+RPVIGI+SHPGDGASGR++NA+  SYIAAS VKFVESAGARVI
Sbjct  89    SGGVVPSCPAADPKLNFRPVIGILSHPGDGASGRLNNASNASYIAASYVKFVESAGARVI  148

Query  863   PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
             PLIYNEP E L++KLN+VNGV+F GG  + G Y E ++ I+KKVL KND GD+FPL AI 
Sbjct  149   PLIYNEPREVLLEKLNMVNGVLFTGGWAKTGLYYETVEAIFKKVLAKNDAGDHFPLYAIC  208

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             LGF+LLT+IVS+D  ILE+F+A++QASTLQ +   N+EGT+FQRFP +LL+K+  +CLVM
Sbjct  209   LGFELLTMIVSKDKSILEEFNAADQASTLQFMRNTNIEGTVFQRFPPDLLKKLSTDCLVM  268

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             QNH +GISPE      DL+NFF VLTTS+D DNKVYVST+Q   YPV A QW PE+NAFE
Sbjct  269   QNHHYGISPERLIRSTDLTNFFKVLTTSMDGDNKVYVSTVQAHSYPVTAFQWHPEKNAFE  328

Query  323   WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
             W LS IPHS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G G+ 
Sbjct  329   WGLSMIPHSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGKGYD  388

Query  143   EVYIFS  126
             EVYIF+
Sbjct  389   EVYIFT  394



>ref|XP_006348321.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Solanum tuberosum]
Length=335

 Score =   416 bits (1069),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 245/301 (81%), Gaps = 0/301 (0%)
 Frame = -3

Query  1028  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
              GCP PD +LNYRPVIGI+SHPG G SGRI+N+TGVSYIAAS VK VES GARVIPL+++
Sbjct  30    AGCPLPDHNLNYRPVIGIISHPGHGDSGRINNSTGVSYIAASYVKLVESGGARVIPLLFD  89

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             +  + L +KLNLVNGV+FPGG  +KG Y E +K I++KVLEKND G++FPLLAIN GF+L
Sbjct  90    DSPQLLNQKLNLVNGVIFPGGWAKKGHYFETIKAIFRKVLEKNDAGEHFPLLAINHGFEL  149

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             L +IVS+DN ILEKFS SNQA+ L  VE +N+E T+F RFP  L++K+ +ECLV+Q+HK+
Sbjct  150   LMMIVSKDNNILEKFSVSNQATKLHFVETVNIEDTVFGRFPPTLIKKLSKECLVLQSHKY  209

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             G+SP+ FQA+ DLS+FF +LTTS D  NKVYVST++ + YP+ A+QW PE++AFEW LS 
Sbjct  210   GLSPDKFQANDDLSSFFIMLTTSTDTRNKVYVSTVKAENYPITALQWHPEKSAFEWGLSA  269

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPHSEDA+ V+Q VANYFVSEARKSSN P    V DNLIYNYN +YSGK G G+ EVY+F
Sbjct  270   IPHSEDAVQVTQLVANYFVSEARKSSNKPEAQKVLDNLIYNYNPTYSGKTGKGYDEVYVF  329

Query  128   S  126
             +
Sbjct  330   N  330



>gb|AFK48386.1| unknown [Lotus japonicus]
Length=342

 Score =   414 bits (1064),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 241/299 (81%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAP+P+L Y+PVIGIV+HPGDGA+GR+SN TG SYIAAS VKFVE+AGARV+PLIYNEP
Sbjct  42    CPAPNPNLYYQPVIGIVTHPGDGATGRLSNTTGASYIAASYVKFVEAAGARVVPLIYNEP  101

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
             TE L KKL LVNGV+F GG  + G Y E +  I+KK LEKND GD+FP+ AI LGF+L+T
Sbjct  102   TEKLFKKLELVNGVLFTGGWAKSGLYFETIGRIFKKALEKNDAGDHFPIYAICLGFELIT  161

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVS+DN ILE+F ASNQASTLQ VE  N++GTLFQRFP +LL+K+  +CLVMQNH++GI
Sbjct  162   MIVSKDNNILEEFCASNQASTLQFVENANIKGTLFQRFPPDLLKKLSTDCLVMQNHRYGI  221

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP   Q +  LS+FF +LTT  D+D+ VYVST++ + YPV A QW PE+NAFEWA SEIP
Sbjct  222   SPGKLQGNHKLSSFFEILTTCEDEDDMVYVSTMRSRNYPVSAFQWHPEKNAFEWASSEIP  281

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             H++DAI ++Q  AN+ VSEARKS N P   +VRDNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  282   HTKDAIQITQYAANFLVSEARKSINRPVAQEVRDNLIYNYSPTYCGKAGKGYDEVYIFA  340



>ref|XP_002285525.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X1 [Vitis vinifera]
Length=384

 Score =   415 bits (1066),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 198/302 (66%), Positives = 240/302 (79%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  CPAPDP LN+RPV+GI++HPGDGASGR++N T  SYIAAS VKFVESAGARVIPLIY
Sbjct  83    SPSCPAPDPKLNFRPVVGILTHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPLIY  142

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KLNLVNGV+F GG  + G Y   + EI+KK LEKND GD+FP+LA  LGF+
Sbjct  143   NEPLEILHEKLNLVNGVIFTGGWAKSGLYYTTVGEIFKKSLEKNDVGDHFPVLATCLGFE  202

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+S+D  ILE+FSA++QASTL  ++  ++ GT+FQRFP +LLRK+  +CLVMQNH 
Sbjct  203   LLTMIISKDIKILEEFSAADQASTLNFMKNTDIRGTVFQRFPPDLLRKLSTDCLVMQNHH  262

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE FQ + DLS+FF +LTTS D+D+KVYVST Q   YPV A QW PE+NAFEW LS
Sbjct  263   YGISPERFQENTDLSSFFKILTTSTDEDDKVYVSTAQAHSYPVTAFQWHPEKNAFEWGLS  322

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDA+ V+Q VAN+F+SEARKS N P    V DNLIYNY+ +Y GK G G+ EVYI
Sbjct  323   RIPHSEDAVQVTQHVANFFISEARKSLNRPPARKVLDNLIYNYSPTYCGKAGKGYDEVYI  382

Query  131   FS  126
             FS
Sbjct  383   FS  384



>ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis]
 gb|EEF37850.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis]
Length=388

 Score =   414 bits (1065),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 202/299 (68%), Positives = 238/299 (80%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP LNYRPVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  88    CLAPDPKLNYRPVIGIVSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIYNEP  147

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KLNLVNGV+F GG  + G Y + +K I+KKVL+KND G +FPL AI LGF+LLT
Sbjct  148   PDILFEKLNLVNGVLFTGGWAKNGLYYDIVKAIFKKVLDKNDAGYHFPLYAICLGFELLT  207

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+D  ILE F+A++QASTLQ +  +N+EGT+FQRFP  LL+K+  +CLVMQNH +GI
Sbjct  208   MIISKDRNILESFNAADQASTLQFMGNINIEGTVFQRFPPGLLKKLSTDCLVMQNHHYGI  267

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  Q + DLS FF +LTTS D DNKVYVST+Q   YPV A QW PE+NAFEW LS IP
Sbjct  268   SPERLQENQDLSGFFKILTTSADADNKVYVSTVQALSYPVTAFQWHPEKNAFEWGLSMIP  327

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VAN+FVSEARKS N P    V DNLIYN++ +Y GK G G+ EVYIF+
Sbjct  328   HSEDAIQVTQHVANFFVSEARKSLNRPPARKVLDNLIYNFSPTYCGKAGKGYDEVYIFT  386



>ref|NP_001234438.1| gamma-glutamylhydrolase 3 precursor [Solanum lycopersicum]
 gb|ACC86849.1| gamma-glutamylhydrolase 3 [Solanum lycopersicum]
Length=337

 Score =   410 bits (1055),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/300 (65%), Positives = 242/300 (81%), Gaps = 0/300 (0%)
 Frame = -3

Query  1028  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
              GCP PD +LNYRPVIGI+SHPGDG SGRI+N+TGVSYIAAS VK VES GARVIPL+++
Sbjct  30    AGCPLPDHNLNYRPVIGIISHPGDGDSGRINNSTGVSYIAASYVKLVESGGARVIPLLFD  89

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             +  + L +KLNLVNGV+FPGG  +KG Y E +K I+ KVLEKND G++FPLLAIN GF+L
Sbjct  90    DSPQLLNQKLNLVNGVIFPGGWAKKGHYFETIKAIFGKVLEKNDAGEHFPLLAINHGFEL  149

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             L +IVS+DN ILEKFS SNQA+ L  VE +N+E T+F RFP  L++K+ +ECLV+Q+HK+
Sbjct  150   LMMIVSKDNNILEKFSVSNQATKLHFVETVNIEDTIFGRFPPTLVKKLSKECLVLQSHKY  209

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             G+SPE FQA+ DLS+FF +LTTS D  NKVYVST++ + YP+ A+QW PE++AFEW  S 
Sbjct  210   GLSPEKFQANDDLSSFFIMLTTSTDTRNKVYVSTLKAENYPITALQWHPEKSAFEWGSSA  269

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPHSEDA+ V+Q VANYFVSEARKSSN P    V DNLIYNY  +YSGK G G+ EVY+F
Sbjct  270   IPHSEDAVQVTQLVANYFVSEARKSSNKPEAQKVLDNLIYNYEPTYSGKIGIGYDEVYVF  329



>ref|XP_004294089.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=388

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 238/301 (79%), Gaps = 0/301 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C   DP LNYRPVIGI+SHPGDGASGR+SN TG SYIAAS VKFVESAGARVIPLIY
Sbjct  80    SPRCTPLDPKLNYRPVIGILSHPGDGASGRLSNVTGTSYIAASYVKFVESAGARVIPLIY  139

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP++ L +KLNLVNGV+F GG  + G Y +  ++I+K +LE+ND GD+FPL AI LGF+
Sbjct  140   NEPSDVLFQKLNLVNGVLFTGGWAKSGRYYDVAEKIFKMILERNDAGDHFPLYAICLGFE  199

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+S++  ILE FSA++ ASTLQ  E +N+EGT+FQRFP +LLRK+  +C+VMQNH 
Sbjct  200   LLTMIISKNKKILESFSAADMASTLQFTENMNIEGTVFQRFPPDLLRKLSTDCIVMQNHH  259

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE+ Q + DLS+FF +LTTS D+D+KVYVST+    YPV A QW PE+NAFEW L 
Sbjct  260   YGISPETLQQNPDLSSFFKILTTSTDEDDKVYVSTVHAYHYPVTAFQWHPEKNAFEWGLQ  319

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDAI V+Q +AN+ VSEARKS N P   DV DNLIYNY+ ++ GK G G+ EVYI
Sbjct  320   MIPHSEDAIQVTQHIANFLVSEARKSLNRPPLQDVLDNLIYNYSPTFCGKAGKGYDEVYI  379

Query  131   F  129
             F
Sbjct  380   F  380



>ref|XP_006477853.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=354

 Score =   411 bits (1056),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 239/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
              S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  52    FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  111

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             +NEP E L +KL LVNG+++ GG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  112   FNEPEEILFEKLELVNGILYTGGWAKNGLYYDIVEKIFKKILEKNDVGDHFPVYAICLGF  171

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +CLVMQNH
Sbjct  172   ELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNH  231

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
              +GISPE  QA+ +L+ FF +LTTS+D+ NKVYV T+Q   YPV A QW  E+NAFEW  
Sbjct  232   HYGISPERMQANQELAKFFKILTTSVDEYNKVYVLTVQAYNYPVTAFQWHSEKNAFEWGP  291

Query  314   SEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
               IPH+EDAI V+Q  AN+F+SEARKSSN P    V DNLIYNY+ +Y GK G G+ EVY
Sbjct  292   KAIPHTEDAIRVTQQAANFFISEARKSSNRPPARKVLDNLIYNYSPTYCGKAGKGYDEVY  351

Query  134   IFS  126
             IF+
Sbjct  352   IFT  354



>emb|CBI20168.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   416 bits (1070),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 198/302 (66%), Positives = 240/302 (79%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  CPAPDP LN+RPV+GI++HPGDGASGR++N T  SYIAAS VKFVESAGARVIPLIY
Sbjct  213   SPSCPAPDPKLNFRPVVGILTHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPLIY  272

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KLNLVNGV+F GG  + G Y   + EI+KK LEKND GD+FP+LA  LGF+
Sbjct  273   NEPLEILHEKLNLVNGVIFTGGWAKSGLYYTTVGEIFKKSLEKNDVGDHFPVLATCLGFE  332

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+S+D  ILE+FSA++QASTL  ++  ++ GT+FQRFP +LLRK+  +CLVMQNH 
Sbjct  333   LLTMIISKDIKILEEFSAADQASTLNFMKNTDIRGTVFQRFPPDLLRKLSTDCLVMQNHH  392

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE FQ + DLS+FF +LTTS D+D+KVYVST Q   YPV A QW PE+NAFEW LS
Sbjct  393   YGISPERFQENTDLSSFFKILTTSTDEDDKVYVSTAQAHSYPVTAFQWHPEKNAFEWGLS  452

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDA+ V+Q VAN+F+SEARKS N P    V DNLIYNY+ +Y GK G G+ EVYI
Sbjct  453   RIPHSEDAVQVTQHVANFFISEARKSLNRPPARKVLDNLIYNYSPTYCGKAGKGYDEVYI  512

Query  131   FS  126
             FS
Sbjct  513   FS  514



>ref|XP_007149562.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris]
 gb|ESW21556.1| hypothetical protein PHAVU_005G080700g [Phaseolus vulgaris]
Length=342

 Score =   410 bits (1053),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 192/299 (64%), Positives = 240/299 (80%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP+L Y+PVIGIVSHPGDGASGR+SN TGVSYIAAS VKFVE+AGARV+PLIYNEP
Sbjct  42    CPAPDPNLYYQPVIGIVSHPGDGASGRLSNETGVSYIAASYVKFVEAAGARVVPLIYNEP  101

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L+KKL LVNGV+F GG  + G Y E + +I+KK+LEKND GD+FPL A+ LGF+L+T
Sbjct  102   PEKLLKKLELVNGVLFTGGWAKNGLYFETVTKIFKKILEKNDAGDHFPLYAVCLGFELIT  161

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SEDN ILE+F+ASNQAST+Q VE  N+E +LFQRFP ELLRK+  +CLVMQNH++GI
Sbjct  162   MIISEDNNILEEFTASNQASTIQFVESANIEESLFQRFPPELLRKMTTDCLVMQNHRYGI  221

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+NAFEW    IP
Sbjct  222   SPGKLLDNRKLSSFFEILTTCSDEDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGSPRIP  281

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             H+EDA+ ++Q VAN+ VSEARKS N P   +V DNL+YNY+ +Y GK G G+ EVY+F+
Sbjct  282   HTEDAVQITQHVANFLVSEARKSINRPFTQEVLDNLVYNYSPTYGGKAGKGYDEVYLFA  340



>ref|XP_006360033.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Solanum tuberosum]
Length=344

 Score =   410 bits (1053),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 199/300 (66%), Positives = 241/300 (80%), Gaps = 1/300 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPA DP+LNYRPVIGIVSHPGDGASGR++NA+ VSYIAAS VKF E AGARVIP+IY EP
Sbjct  37    CPATDPALNYRPVIGIVSHPGDGASGRLNNASDVSYIAASYVKFAEMAGARVIPIIYTEP  96

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E + +KLNLVNG++F GG  +KG Y E +K I++KVLEKND G++FPLLAI LGF+LLT
Sbjct  97    PEIINQKLNLVNGIIFTGGWSKKGLYFEVVKGIFEKVLEKNDAGEHFPLLAICLGFELLT  156

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE+FSAS+QAST+Q VE +  +GT+F RFP  LL+K+   CLVMQNH +GI
Sbjct  157   MIISKDNNILEEFSASHQASTVQFVENIKFDGTVFGRFPPVLLKKMSTHCLVMQNHHFGI  216

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  QA+ DL  FF VLTTS+DK NKVYVS++Q + YPV A+QW PE+N FEW  S+IP
Sbjct  217   SPERLQANNDLCGFFRVLTTSVDKKNKVYVSSVQAQHYPVTALQWHPEKNVFEWGSSQIP  276

Query  302   HSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             H+EDAI V+Q VANYFVSEARKSS N P    V DNLIYNY+ SY+GK    F EVY+F+
Sbjct  277   HTEDAIQVTQHVANYFVSEARKSSNNKPATSKVLDNLIYNYSPSYAGKVRGSFEEVYLFT  336



>ref|NP_001234440.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum]
 gb|ACC86850.1| gamma-glutamylhydrolase 2 [Solanum lycopersicum]
Length=344

 Score =   409 bits (1052),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 197/300 (66%), Positives = 241/300 (80%), Gaps = 1/300 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPA DP+LNYRPVIGIVSHPGDGASGR++NA+ VSYIAAS VKF E AGARVIP+IY EP
Sbjct  37    CPATDPALNYRPVIGIVSHPGDGASGRLNNASDVSYIAASYVKFAEMAGARVIPIIYTEP  96

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E + +KLNLVNG++F GG  +KG Y E +K I++KVLEKND G++FPLLAI LGF+LLT
Sbjct  97    PEIINQKLNLVNGIIFTGGWSKKGLYFEVVKGIFEKVLEKNDAGEHFPLLAICLGFELLT  156

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE+FSA +QAST+Q VE +  EGT+F RFP  LL+K+   CLVMQNH++GI
Sbjct  157   MIISKDNNILEEFSALHQASTVQFVENIKFEGTVFGRFPPVLLKKMTTHCLVMQNHRFGI  216

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  QA+ DL  FF +LTTS+DK NKVYVS++Q + YP+ A+QW PE+N FEW  S+IP
Sbjct  217   SPERLQANNDLCGFFKILTTSVDKKNKVYVSSVQAQHYPITALQWHPEKNVFEWGSSQIP  276

Query  302   HSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             H+EDAI VSQ VANYF+SEARKSS N P    V DNLIYNY+ SY+GK    F EVY+F+
Sbjct  277   HTEDAIQVSQHVANYFISEARKSSNNKPATSKVLDNLIYNYSPSYAGKVRGSFEEVYLFT  336



>ref|XP_010675311.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Beta vulgaris subsp. 
vulgaris]
Length=376

 Score =   410 bits (1053),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/299 (65%), Positives = 238/299 (80%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APD +LN+RPVIGI+SHPGDGASGR+ N T VSYIA+S VKFVESAGARVIPLIY +P
Sbjct  78    CSAPDSTLNFRPVIGILSHPGDGASGRLKNGTNVSYIASSYVKFVESAGARVIPLIYTDP  137

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
                L+ KL LVNGV+F GG  ++G Y E ++EI+K+VLEKND G  FP  AI LGF+LLT
Sbjct  138   LHILLDKLELVNGVLFTGGWAKRGLYFEVVREIFKRVLEKNDAGQFFPCYAICLGFELLT  197

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE FSAS Q STLQ V+ +N+ GT+FQRFP ELLRK+  +CLVMQNHK+G+
Sbjct  198   MIISKDNNILESFSASYQPSTLQFVKNININGTVFQRFPPELLRKLNTDCLVMQNHKYGL  257

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE+ Q +  LS+FFN+LTTS D+D+KVYVST+Q + YP+ A QW PE+NAFEW  + IP
Sbjct  258   SPETLQGNQRLSSFFNILTTSTDRDDKVYVSTVQAQHYPITAFQWHPEKNAFEWGYAMIP  317

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VAN F+SEARKS N P   DV +N+IYNY+ +Y GK G G+ EVYIF+
Sbjct  318   HSEDAIQVTQHVANSFISEARKSPNRPPARDVLENVIYNYSPTYCGKQGRGYDEVYIFA  376



>ref|XP_006442395.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
 gb|ESR55635.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
Length=352

 Score =   407 bits (1047),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 238/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             L   CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLI
Sbjct  46    LGPRCPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLI  105

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             YNEP + L +KL LVNGV++ GG  + G Y E +++++KK+LEKND GD+FPL A  LGF
Sbjct  106   YNEPEDVLFEKLELVNGVLYTGGWAKDGLYYEIVEKVFKKILEKNDAGDHFPLYAHCLGF  165

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +LLT+I+ +D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH
Sbjct  166   ELLTMIIGKDKNILESFNAADQASTLQFIENTSIEGTVFQRFPPQLIKKLSTDCLVMQNH  225

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
              +GISPE+ + + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE+NAFEW  
Sbjct  226   HYGISPETLRKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPEKNAFEWGS  285

Query  314   SEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
             S IPHSEDAI V+Q VANYF+SEAR+S N P    V DNLIYNY  ++ GK G GF EVY
Sbjct  286   SAIPHSEDAIEVTQHVANYFISEARRSVNRPPAQKVLDNLIYNYRPTFCGKAGKGFDEVY  345

Query  134   IFS  126
             IF+
Sbjct  346   IFT  348



>ref|XP_010060722.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Eucalyptus 
grandis]
Length=373

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 196/299 (66%), Positives = 238/299 (80%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPA DP LN+RPVIGI+SHPGDGASGR++NA+  S IAAS VKFVESAGARVIPLIYNEP
Sbjct  75    CPAADPKLNFRPVIGILSHPGDGASGRLNNASNASNIAASYVKFVESAGARVIPLIYNEP  134

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L++KL+LVNGV+F GG  + G Y E  + I+KKVL KND GD+FPL AI LGF+LLT
Sbjct  135   QEVLLEKLDLVNGVLFTGGWAKTGLYYETAEAIFKKVLAKNDAGDHFPLYAICLGFELLT  194

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVS+D  ILE+F+A+++ASTLQ +   N+EGTLFQRFP +LL+K+  +CLVMQNH +GI
Sbjct  195   MIVSKDKSILEEFNAADEASTLQFMRNTNIEGTLFQRFPPDLLKKLSTDCLVMQNHHYGI  254

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             S E    + +L+NFF VLTTS+D DNKVYVST Q   YPV A QW PE+NAFEW LS IP
Sbjct  255   SSERLMQNINLTNFFKVLTTSMDGDNKVYVSTAQAHSYPVTAFQWHPEKNAFEWGLSMIP  314

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  315   HSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGKGYDEVYIFT  373



>ref|XP_006377741.1| hypothetical protein POPTR_0011s10890g [Populus trichocarpa]
 gb|ERP55538.1| hypothetical protein POPTR_0011s10890g [Populus trichocarpa]
Length=412

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/299 (65%), Positives = 241/299 (81%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APD  LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  92    CSAPDIKLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  151

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y + +K I+K++L KND G +FP+ AI LGF++LT
Sbjct  152   REILFEKLNLVNGVLFTGGWAKTGLYFDTVKAIFKEILAKNDAGFHFPVYAICLGFEILT  211

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SEDN ILE F+A++QASTLQ +  +N++GT+F+RFP +LL+++  +CLVMQNH++GI
Sbjct  212   MIISEDNQILETFNAADQASTLQFMNNINIKGTVFRRFPPDLLKRLSTDCLVMQNHRYGI  271

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+ FQ +  LS+FF +LTTS D+DN+VYVST+Q   YPV A QW PE+NAFEW LS IP
Sbjct  272   SPQRFQENEHLSSFFEILTTSTDEDNQVYVSTVQACGYPVTAFQWHPEKNAFEWGLSMIP  331

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q +AN+FVSEARKS N P+   V  NLIYNY+ +Y GK G G+ EVYIFS
Sbjct  332   HSEDAIQVTQHIANFFVSEARKSLNRPSSRKVLANLIYNYSPTYCGKAGKGYDEVYIFS  390



>ref|XP_011002760.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Populus euphratica]
Length=407

 Score =   408 bits (1048),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/299 (65%), Positives = 240/299 (80%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPA D +LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  87    CPASDTNLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  146

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y +  K I+K+VL +ND G +FP+ AI LGF++LT
Sbjct  147   REILFEKLNLVNGVLFTGGWAKTGLYFDTAKAIFKEVLARNDAGFHFPVYAICLGFEILT  206

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SEDN ILE ++A++QASTLQ +E +++EGT+FQRFP  LL+K+  +CLVMQNH +GI
Sbjct  207   MIISEDNQILETYNATDQASTLQFMENISIEGTVFQRFPPVLLKKLSTDCLVMQNHHYGI  266

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+ FQ +  LS+FF +LT S D+DN+VYVST+Q + YPV A QW PE+NAFEW LS IP
Sbjct  267   SPQRFQENEHLSSFFEILTNSADEDNQVYVSTVQARNYPVTAFQWHPEKNAFEWGLSMIP  326

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VAN+FVSEARKS N P    V DNLIYNY+ ++ GK G G+ EVYIF+
Sbjct  327   HSEDAIQVTQHVANFFVSEARKSLNRPPARRVLDNLIYNYSPTFCGKAGKGYDEVYIFA  385



>ref|XP_006477852.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=348

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/299 (65%), Positives = 236/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50    CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110   EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH +GI
Sbjct  170   MIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHYGI  229

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE+ Q + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE+NAFEW  S IP
Sbjct  230   SPETLQKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPEKNAFEWGSSAIP  289

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VANYF+SEAR S N P    V DNLIYNY  ++ GK G GF EVYIF+
Sbjct  290   HSEDAIEVTQHVANYFISEARWSVNRPPAQKVLDNLIYNYRPTFCGKAGKGFDEVYIFT  348



>ref|XP_010106571.1| Gamma-glutamyl hydrolase [Morus notabilis]
 gb|EXC10782.1| Gamma-glutamyl hydrolase [Morus notabilis]
Length=401

 Score =   407 bits (1045),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/299 (67%), Positives = 239/299 (80%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPA DP LNYRPVIGIVSHPGDGASGR+SNA+  SYIAAS VKFVESAGARVIP+IYNEP
Sbjct  99    CPASDPKLNYRPVIGIVSHPGDGASGRLSNASSASYIAASYVKFVESAGARVIPIIYNEP  158

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E + +KLNLVNGV+F GG  + G Y E ++ I+KKVLE+ND G+ FPL AI LGF++LT
Sbjct  159   PEIIFQKLNLVNGVLFTGGWAKTGPYYEIVERIFKKVLERNDAGEYFPLYAICLGFEILT  218

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE FSAS+ ASTLQ  + +N+EGT+FQRFP +LLRK+  +CL+MQNHK+GI
Sbjct  219   MIISKDNKILESFSASDMASTLQFTQNVNIEGTVFQRFPPDLLRKLSTDCLIMQNHKYGI  278

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE FQ + DL  FF +LTTS D+DNKVYVST+    YPV A QW PE+NAFEW L +IP
Sbjct  279   SPERFQENRDLCQFFKILTTSADEDNKVYVSTVHAHNYPVTAFQWHPEKNAFEWGLKQIP  338

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  339   HSEDAIHVTQHVANFLVSEARKSLNRPPLQKVLDNLIYNYSPTYCGKAGKGYDEVYIFT  397



>gb|KJB13015.1| hypothetical protein B456_002G051200 [Gossypium raimondii]
Length=386

 Score =   406 bits (1043),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/299 (67%), Positives = 234/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIYNEP
Sbjct  82    CANADPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIYNEP  141

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  + G Y +  K+I+KKV+EKND GD+FPL AI LGF+LLT
Sbjct  142   EEILFQKLELVNGVLFTGGWSKYGLYYDIAKKIFKKVIEKNDRGDHFPLYAICLGFELLT  201

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVSED  ILE FSASNQAS+LQ VE +N+EGT+FQRFP  LL+K+G +CLVMQNH+ GI
Sbjct  202   MIVSEDKNILEPFSASNQASSLQFVENVNIEGTVFQRFPPNLLQKLGTDCLVMQNHRCGI  261

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  Q   +LS FF +LTTS DK+NKVYVST Q   YPV A QW PE+NAFEW LS IP
Sbjct  262   SPEKLQNTPNLSRFFKILTTSTDKNNKVYVSTAQAHGYPVTAFQWHPEKNAFEWGLSMIP  321

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HS+DAI V+Q VAN+F+ EAR+S N P    V D+LIYNY+ +Y GK G GF EVYIF+
Sbjct  322   HSDDAIEVTQHVANFFIREARRSLNRPAAQKVLDSLIYNYSPTYCGKAGKGFDEVYIFT  380



>ref|XP_003543198.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Glycine max]
Length=342

 Score =   402 bits (1034),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 191/299 (64%), Positives = 236/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP+L Y+PVIGIVSHPGDGASGR+SNATG SYIAAS VKFVE+AGARV+PLIY EP
Sbjct  42    CPAPDPNLYYKPVIGIVSHPGDGASGRLSNATGASYIAASYVKFVEAAGARVVPLIYTEP  101

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L+KKL LVNGV+F GG  + G Y E + +I+KK+LEKND GD+FPL A  LGF+L+T
Sbjct  102   PEKLLKKLELVNGVLFTGGWAKSGLYFETVTKIFKKILEKNDAGDHFPLFATCLGFELIT  161

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+DN ILE+FSASNQASTLQ VE  N+  ++FQRFP ELL K+  +CLVMQNH++GI
Sbjct  162   MIISQDNNILEEFSASNQASTLQFVENANIGESVFQRFPPELLGKMSTDCLVMQNHRYGI  221

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+NAFEW    IP
Sbjct  222   SPGKLLNNPKLSSFFEILTTCTDEDDKVYVSTVRSQNYPVTGFQWHPEKNAFEWGSPRIP  281

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             H+EDAI ++Q VAN+ VSEARKS N P   ++ DNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  282   HTEDAIQITQYVANFLVSEARKSLNRPVAQELLDNLIYNYSPTYCGKAGKGYDEVYIFA  340



>ref|XP_003596306.1| Gamma-glutamylhydrolase [Medicago truncatula]
 gb|AES66557.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=341

 Score =   402 bits (1032),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 189/298 (63%), Positives = 233/298 (78%), Gaps = 0/298 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP+L Y+PVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVE+AGARV+PLIY EP
Sbjct  43    CPAPDPNLYYQPVIGIVSHPGDGASGRLSNATDASYIAASYVKFVEAAGARVVPLIYTEP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L+KKL LVNGV+F GG  + G Y E ++ I+KKVLEKND GD FPL A  LGF+L++
Sbjct  103   EEILLKKLELVNGVLFTGGWAKDGLYFETVRRIFKKVLEKNDAGDYFPLYATCLGFELIS  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SEDN ILE+FSA NQAS+LQ V+   +EG++FQRFP +LL+K+  +CL+MQNH++GI
Sbjct  163   MIISEDNNILEEFSARNQASSLQFVKNAYIEGSVFQRFPPDLLKKLSTDCLIMQNHRYGI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP     +  L++FF +LTT  D+DNKVYVST++ + YPV   QW PE+NAFEW    IP
Sbjct  223   SPAKLLGNKKLASFFEILTTCNDEDNKVYVSTVRSRNYPVTGFQWHPEKNAFEWGTPSIP  282

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             H+EDAI  +Q VAN+ VSEARKSS  P   ++RDNLIYNY  +Y GK G GF EVYIF
Sbjct  283   HTEDAIRTTQYVANFLVSEARKSSKRPVAQELRDNLIYNYRPTYCGKAGKGFDEVYIF  340



>ref|XP_008386275.1| PREDICTED: gamma-glutamyl hydrolase 2 [Malus domestica]
Length=387

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/309 (63%), Positives = 238/309 (77%), Gaps = 0/309 (0%)
 Frame = -3

Query  1052  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  873
             L T+   S  C APDP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGA
Sbjct  72    LGTSDSSSTKCAAPDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGA  131

Query  872   RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  693
             RVIPLIYNEP + L +KL+LVNGV+F GG  ++G Y + ++ I++K++EKND GD+FPL 
Sbjct  132   RVIPLIYNEPRDILFQKLDLVNGVLFTGGWAKRGLYYDVVERIFQKIIEKNDAGDHFPLY  191

Query  692   AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             AI LGF+LLT+I+S++  ILE FSA + ASTLQ  E   +EGT+FQRFP +LLRK+  +C
Sbjct  192   AICLGFELLTMIISKNKKILESFSAVDVASTLQFTENTIIEGTVFQRFPPDLLRKLSTDC  251

Query  512   LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
             LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  252   LVMQNHKYGISPERLXXNENLSSFFKILTTCTDEDBKVYVSTAHAYNYPVTAFQWHPEKN  311

Query  332   AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             AFEW L  IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G 
Sbjct  312   AFEWGLPMIPHSEDAIQVTQHVANFLVSEARKSLNRPPVGQVLDNLIYNYSPTFCGKAGK  371

Query  152   GFVEVYIFS  126
             G+ EVYIF+
Sbjct  372   GYDEVYIFT  380



>gb|KHG06555.1| Gamma-glutamyl hydrolase -like protein [Gossypium arboreum]
Length=385

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/299 (65%), Positives = 233/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGAR+IPLIYNEP
Sbjct  81    CANADPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARIIPLIYNEP  140

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  + G Y +  K+I+KKV+EKND GD+FPL AI LGF+LLT
Sbjct  141   EEILFQKLELVNGVLFTGGWSKYGLYYDIAKKIFKKVIEKNDRGDHFPLYAICLGFELLT  200

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SED  ILE FSASNQAS+LQ VE +N+EGT+FQRFP  LL+K+G +CLVMQNH++GI
Sbjct  201   MIISEDKNILEPFSASNQASSLQFVENVNIEGTVFQRFPPNLLQKLGTDCLVMQNHRYGI  260

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  Q   +LS FF +LTTS DK+NKVYVST Q   YPV A QW PE+NAFEW L  IP
Sbjct  261   SPEKLQNTPNLSRFFKILTTSTDKNNKVYVSTAQAHGYPVTAFQWHPEKNAFEWGLPMIP  320

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HS+DAI V+Q VAN+ + EAR+S N P    V DNLIYNY+ ++ GK G GF EVYIF+
Sbjct  321   HSDDAIEVTQHVANFLIREARRSLNRPAAQKVLDNLIYNYSPTFCGKAGRGFDEVYIFT  379



>ref|XP_010644101.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X2 [Vitis vinifera]
Length=374

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 232/292 (79%), Gaps = 0/292 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  CPAPDP LN+RPV+GI++HPGDGASGR++N T  SYIAAS VKFVESAGARVIPLIY
Sbjct  83    SPSCPAPDPKLNFRPVVGILTHPGDGASGRLNNDTNASYIAASYVKFVESAGARVIPLIY  142

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KLNLVNGV+F GG  + G Y   + EI+KK LEKND GD+FP+LA  LGF+
Sbjct  143   NEPLEILHEKLNLVNGVIFTGGWAKSGLYYTTVGEIFKKSLEKNDVGDHFPVLATCLGFE  202

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+S+D  ILE+FSA++QASTL  ++  ++ GT+FQRFP +LLRK+  +CLVMQNH 
Sbjct  203   LLTMIISKDIKILEEFSAADQASTLNFMKNTDIRGTVFQRFPPDLLRKLSTDCLVMQNHH  262

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE FQ + DLS+FF +LTTS D+D+KVYVST Q   YPV A QW PE+NAFEW LS
Sbjct  263   YGISPERFQENTDLSSFFKILTTSTDEDDKVYVSTAQAHSYPVTAFQWHPEKNAFEWGLS  322

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
              IPHSEDA+ V+Q VAN+F+SEARKS N P    V DNLIYNY+ +Y GK G
Sbjct  323   RIPHSEDAVQVTQHVANFFISEARKSLNRPPARKVLDNLIYNYSPTYCGKAG  374



>ref|XP_004489007.1| PREDICTED: gamma-glutamyl hydrolase-like [Cicer arietinum]
Length=343

 Score =   400 bits (1027),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/300 (63%), Positives = 235/300 (78%), Gaps = 0/300 (0%)
 Frame = -3

Query  1028  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
               CPAP+P+L YRPVIGI+SHPGDGASGR++NAT +SYIAAS VKFVE+AGARV+PLI+ 
Sbjct  43    ASCPAPNPNLYYRPVIGILSHPGDGASGRLNNATDISYIAASYVKFVEAAGARVVPLIFT  102

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             EPTE L+KKL LVNGV+F GG  + G Y E +K I+KK LEKND GD+FPL  + LGF+L
Sbjct  103   EPTEKLLKKLELVNGVLFTGGWAKDGLYFETVKRIFKKALEKNDAGDHFPLYGVCLGFEL  162

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             +T+I+SEDN ILE+FS  NQAS+LQ+VE  N+EG++F RFP +LL+K+  ECLVMQNH +
Sbjct  163   ITMIISEDNNILEEFSGKNQASSLQIVENANIEGSVFGRFPPDLLKKLSTECLVMQNHCF  222

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             GISP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+NAFEW  S+
Sbjct  223   GISPAKLLDNPKLSSFFEILTTCNDEDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGSSK  282

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPH+EDAI ++Q VAN+ VSEARKS N P   ++ DNLIYNY  +Y G  G GF EVYIF
Sbjct  283   IPHTEDAIQITQHVANFLVSEARKSLNRPVSQELLDNLIYNYKPTYCGYAGKGFDEVYIF  342



>ref|XP_011044052.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Populus euphratica]
Length=408

 Score =   402 bits (1032),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 239/299 (80%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APD  LN+RPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  88    CSAPDIKLNFRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  147

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y + +K ++K++L KND G +FP+ AI LGF++LT
Sbjct  148   REILFEKLNLVNGVLFTGGWAKTGLYFDTVKAVFKEILAKNDAGFHFPVYAICLGFEILT  207

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SEDN ILE F+ ++QASTLQ +  +N+EGT+F+RFP +LL+++  +CLVMQNH++GI
Sbjct  208   MIISEDNQILETFNGADQASTLQFMNNINIEGTVFRRFPPDLLKRLSTDCLVMQNHRYGI  267

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+ F  +  LS+FF +LTTS D+DN+VYVST+Q   YPV A QW PE+NAFEW LS IP
Sbjct  268   SPQRFLENEHLSSFFEILTTSTDEDNQVYVSTVQACGYPVTAFQWHPEKNAFEWGLSMIP  327

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q +AN+FVSEARKS N P+   V  NLIYNY+ +Y GK G G+ EVYIF+
Sbjct  328   HSEDAIQVTQHIANFFVSEARKSLNRPSSRKVLANLIYNYSPTYCGKAGKGYDEVYIFA  386



>gb|EPS62480.1| hypothetical protein M569_12307, partial [Genlisea aurea]
Length=351

 Score =   399 bits (1025),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 233/298 (78%), Gaps = 4/298 (1%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C A +P LNYRPVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  58    CQAAEPGLNYRPVIGIVSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIYNEP  117

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E    KLNLVNGV+F GGS + G Y + ++ ++K +L++N+ GD+FPLLAI LGF+LLT
Sbjct  118   PE----KLNLVNGVIFTGGSVKTGPYFDIVESVFKTILQRNEAGDHFPLLAICLGFELLT  173

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVSEDN ILE FSA +Q S LQ V+  NV GT+FQRFP +LL K+  +CLVMQNH++GI
Sbjct  174   MIVSEDNEILENFSAVDQVSALQFVDNSNVNGTVFQRFPPDLLHKLSTDCLVMQNHRYGI  233

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+  Q +  L++FF  LTT+ D+D KVYVST Q  ++PV AVQW PE+NAFEW  S IP
Sbjct  234   SPDKLQNNEKLNDFFTTLTTTADEDGKVYVSTAQAHRFPVTAVQWHPEKNAFEWGSSRIP  293

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             HS+DA+ V+Q VAN+FV EAR S   P   +V DNLIYNY+ +YSGK GSGF EVYIF
Sbjct  294   HSDDAVRVTQHVANFFVREARLSKIRPQSKEVLDNLIYNYSPAYSGKAGSGFDEVYIF  351



>ref|XP_007021916.1| Gamma-glutamyl hydrolase 1 isoform 1 [Theobroma cacao]
 gb|EOY13441.1| Gamma-glutamyl hydrolase 1 isoform 1 [Theobroma cacao]
Length=388

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 236/302 (78%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81    ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KL LVNGV+F GG  + G Y E  ++I+KKVLEKND  D+FPL AI LGF+
Sbjct  141   NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFKKVLEKNDARDHFPLYAICLGFE  200

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+SED  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +CLVMQNH 
Sbjct  201   LLTMIISEDRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADCLVMQNHH  260

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE  + + +LS+FF +LTTS D +N+VYVST+Q   YPV A QW PE+NAFEW  +
Sbjct  261   YGISPERLRNNPNLSSFFKILTTSTDDNNEVYVSTVQAHGYPVTAFQWHPEKNAFEWGST  320

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDAI V+Q VAN+ +SEARKS N P    V DNLIYNY+ +Y GK G GF EVYI
Sbjct  321   MIPHSEDAIQVTQHVANFLISEARKSLNRPPPRKVLDNLIYNYSPTYCGKAGKGFDEVYI  380

Query  131   FS  126
             F+
Sbjct  381   FT  382



>ref|XP_010242157.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Nelumbo 
nucifera]
Length=384

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 193/298 (65%), Positives = 238/298 (80%), Gaps = 0/298 (0%)
 Frame = -3

Query  1019  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  840
             P  D +L +RPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  87    PTSDAALYFRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPA  146

Query  839   ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
             E L +KL+LVNGV+F GG  ++G Y E ++ I+K VLEKND GD+FPL AI LGF+LL++
Sbjct  147   EILAEKLSLVNGVLFTGGKTKRGLYYEIVERIFKHVLEKNDSGDHFPLFAICLGFELLSM  206

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             I+S+D+ ILE+F+A +QASTLQ  E  N+ GT+FQRFP ELL+K+  +CLVMQ+H++G+S
Sbjct  207   IISKDDGILERFNALDQASTLQFTEKSNIGGTVFQRFPPELLKKLTTDCLVMQHHQYGVS  266

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPH  300
             PE FQ +  LS+FF +LTTS D+D KVYVST+Q   YPV A QW PE+NAFEW LS IPH
Sbjct  267   PERFQENPLLSSFFRILTTSKDEDGKVYVSTVQAYNYPVSAFQWHPEKNAFEWGLSMIPH  326

Query  299   SEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             +EDA+ V+Q VAN F+SEARKSSN P    V DNLIYNY+ +Y GK G G+ EVYIFS
Sbjct  327   TEDAVQVTQLVANSFISEARKSSNRPPARKVLDNLIYNYSPTYCGKAGRGYDEVYIFS  384



>ref|XP_009342915.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 237/309 (77%), Gaps = 0/309 (0%)
 Frame = -3

Query  1052  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  873
             L T+   S  C APDP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGA
Sbjct  72    LGTSDSSSARCTAPDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGA  131

Query  872   RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  693
             RVIPLIYNEP + L +KL+LVNGV+F GG  ++G Y + ++ I++K++EKND GD+FPL 
Sbjct  132   RVIPLIYNEPRDILFQKLDLVNGVLFTGGWAKRGLYYDVVERIFQKIIEKNDAGDHFPLY  191

Query  692   AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             AI LGF+LLT+I+S++  ILE FSA +  STLQ  E   +EGT+FQRFP +LLRK+  +C
Sbjct  192   AICLGFELLTMIISKNKKILESFSAVDVPSTLQFTENTIIEGTVFQRFPPDLLRKLSTDC  251

Query  512   LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
             LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  252   LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTAHAYNYPVTAFQWHPEKN  311

Query  332   AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             AFEW L  IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G 
Sbjct  312   AFEWGLPMIPHSEDAIQVTQHVANFLVSEARKSLNRPPVGQVLDNLIYNYSPTFCGKVGK  371

Query  152   GFVEVYIFS  126
             G+ EVYIF+
Sbjct  372   GYDEVYIFT  380



>ref|XP_002318789.2| hypothetical protein POPTR_0012s11220g [Populus trichocarpa]
 gb|EEE97009.2| hypothetical protein POPTR_0012s11220g [Populus trichocarpa]
Length=411

 Score =   399 bits (1026),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 236/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APD  LNYRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  91    CSAPDIKLNYRPVIGILSHPGDGASGRLNNETNASYIAASYVKFVESAGARVIPLIYNEP  150

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y + +K I+K++L KND G +FP+ AI LGF++LT
Sbjct  151   REILFEKLNLVNGVLFTGGWAKTGLYFDTVKAIFKEILAKNDAGFHFPVYAICLGFEILT  210

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SEDN ILE F+ ++QASTLQ +  +N++GT+F+RFP +LL+++  +CLVMQNH +GI
Sbjct  211   MIISEDNQILETFNGADQASTLQFMNNINIKGTVFRRFPPDLLKRLSTDCLVMQNHHYGI  270

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+ FQ    LS+F  +LTTS D+DN+VYVST+Q   YPV A QW PE+NAFEW LS IP
Sbjct  271   SPQRFQESEHLSSFLEILTTSTDEDNQVYVSTVQACGYPVTAFQWHPEKNAFEWGLSMIP  330

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q +AN+FVSEARKS N P+   V  NLIYNY+ +Y GK G G+ EVYIF+
Sbjct  331   HSEDAIQVTQHIANFFVSEARKSLNRPSSRKVLANLIYNYSPTYCGKAGKGYDEVYIFA  389



>ref|XP_008345165.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 2-like 
[Malus domestica]
Length=382

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 234/309 (76%), Gaps = 0/309 (0%)
 Frame = -3

Query  1052  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  873
             L T+   S  C APDP +NYRPVIGI+SHPGDGASGR+SNA   SYIAAS VKFVESAGA
Sbjct  67    LRTSDSSSSKCTAPDPKINYRPVIGILSHPGDGASGRLSNAXTASYIAASYVKFVESAGA  126

Query  872   RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  693
             RVIPLIYNEP + L +KL+LVNGV+F GG  + G Y +  + I+KK++EKND GD+FPL 
Sbjct  127   RVIPLIYNEPPDVLFQKLDLVNGVLFTGGWAKSGLYYDVAERIFKKIIEKNDAGDHFPLY  186

Query  692   AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             A  LGF+LLT+I+S++  ILE FSA + ASTLQ  E   +EGT+FQRFP +LL+K+  +C
Sbjct  187   ATCLGFELLTMIISKNKKILETFSAVDVASTLQFTENAVIEGTVFQRFPPDLLKKLSTDC  246

Query  512   LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
             LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  247   LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTXHAYNYPVTAFQWHPEKN  306

Query  332   AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             AFEW L  IPHSEDAI V+Q  AN+ VSEARKS N P   +V DNLIYNY+ ++ GK G 
Sbjct  307   AFEWGLPMIPHSEDAIQVTQHAANFLVSEARKSLNRPPVREVLDNLIYNYSPTFCGKAGR  366

Query  152   GFVEVYIFS  126
             GF EVYIF+
Sbjct  367   GFDEVYIFT  375



>ref|XP_010429695.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=355

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/299 (62%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR++NAT  SYI +S VKF E+ GARVIPLIYNEP
Sbjct  51    CSAPDPNLNYRPVIGILSHPGDGASGRLNNATNASYITSSYVKFAEAGGARVIPLIYNEP  110

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  111   EELLFQKLELVNGVILTGGWAKEGLYFEIVKKIFHKVLERNDAGEHFPLYAICLGFELLT  170

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I +K  A N AS+LQ +E +N+EGT+FQRFP +L  K+  +CLVMQNH++GI
Sbjct  171   MIISQNRDIFKKVDARNCASSLQFIENVNIEGTVFQRFPPDLFNKLSTDCLVMQNHQFGI  230

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+SF+    LSNFFN++TT  D  NK+YVST++ K+YPV   QW PE+NAFEW LS IP
Sbjct  231   SPDSFEGTVALSNFFNIVTTCSDTHNKIYVSTVKSKQYPVTGFQWHPEKNAFEWGLSTIP  290

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VANY VSEARKS N P+   V  NLIYNY  +Y G +G G+ EVYIF+
Sbjct  291   HSEDAIQVTQHVANYLVSEARKSQNRPSSEKVLSNLIYNYTPTYCGYEGRGYDEVYIFT  349



>ref|XP_009334021.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Pyrus x bretschneideri]
Length=347

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/309 (62%), Positives = 236/309 (76%), Gaps = 0/309 (0%)
 Frame = -3

Query  1052  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  873
             L T+   S  C APDP +NYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGA
Sbjct  32    LGTSDSSSSKCTAPDPKINYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGA  91

Query  872   RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  693
             RVIPLIYNEP + L +KL+LVNGV+F GG  + G Y +  + I+KK++EKND GD+FPL 
Sbjct  92    RVIPLIYNEPPDILFQKLDLVNGVLFTGGWAKSGLYYDVAERIFKKIIEKNDAGDHFPLY  151

Query  692   AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             A  LGF+LLT+I+S++  ILE FSA + ASTLQ  +   +EGT+FQRFP +LL+K+  +C
Sbjct  152   ATCLGFELLTMIISKNKNILETFSAVDAASTLQFTKNAVIEGTVFQRFPPDLLKKLSTDC  211

Query  512   LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
             LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST+    YPV A QW PE+N
Sbjct  212   LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTVHAYNYPVTAFQWHPEKN  271

Query  332   AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             AFEW L  IPHSEDAI V+Q  AN+ VSEARKS N P   +V DNLIYNY+ ++ GK G 
Sbjct  272   AFEWGLPMIPHSEDAIQVTQHAANFLVSEARKSLNRPPVREVLDNLIYNYSPTFCGKAGR  331

Query  152   GFVEVYIFS  126
             GF EVYIF+
Sbjct  332   GFDEVYIFT  340



>ref|XP_007213890.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica]
 gb|EMJ15089.1| hypothetical protein PRUPE_ppa006962mg [Prunus persica]
Length=388

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/302 (64%), Positives = 233/302 (77%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGARVIPLIY
Sbjct  80    STRCTALDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGARVIPLIY  139

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP + L +KLNLVNGV+F GG  + G Y + ++ I++K++EKND GD+FPL A  LGF+
Sbjct  140   NEPPDVLFQKLNLVNGVLFTGGWAKSGLYYDIVERIFQKIIEKNDAGDHFPLYATCLGFE  199

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+S++  ILE FSA N ASTL   E   +EGT+FQRFP +LL+K+  +C+VMQNH 
Sbjct  200   LLTMIISKNKKILESFSAENMASTLLFTENTIIEGTVFQRFPPDLLKKLSTDCIVMQNHH  259

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE  Q + +LS+FF +LTTS DKDNKVYVST+    YPV A QW PE+NAFEW   
Sbjct  260   YGISPERLQENPNLSSFFKILTTSTDKDNKVYVSTVHAYSYPVTAFQWHPEKNAFEWGSP  319

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G+GF EVYI
Sbjct  320   MIPHSEDAIQVTQHVANFLVSEARKSLNRPPVRKVLDNLIYNYSPTFCGKAGNGFDEVYI  379

Query  131   FS  126
             F+
Sbjct  380   FT  381



>ref|XP_002862660.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38918.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
Length=347

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 235/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLIYN+P
Sbjct  43    CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIYNDP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103   EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ +E +N++GT+FQRFP ELL+K+G +CLVMQNH++GI
Sbjct  163   MIISQNRDIFEKMDARNSASSLQFLENVNIQGTIFQRFPPELLKKLGTDCLVMQNHRFGI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPESF+ +  LS+FF ++TTS+D ++KVYVST+Q KKYPV   QW PE+NAFEW  S+IP
Sbjct  223   SPESFEGNVALSSFFKIVTTSVDNNSKVYVSTVQSKKYPVTGFQWHPEKNAFEWGSSKIP  282

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  AN+ VSEARKS N P+   V   LIYNY  +Y G  G+G+ EVYIF+
Sbjct  283   HSEDAIQVTQHAANHLVSEARKSLNRPDSKKVLSYLIYNYKPTYCGYAGNGYDEVYIFT  341



>ref|XP_009342914.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=387

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 236/309 (76%), Gaps = 0/309 (0%)
 Frame = -3

Query  1052  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  873
             L T+   S  C APDP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGA
Sbjct  72    LGTSDSSSARCTAPDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGA  131

Query  872   RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  693
             RVIPLIYNEP + L +KL+LVNGV+F GG  ++G Y + ++ I++K++EKND GD+FPL 
Sbjct  132   RVIPLIYNEPRDILFQKLDLVNGVLFTGGWAKRGLYYDVVERIFQKIIEKNDAGDHFPLY  191

Query  692   AINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEEC  513
             AI LGF+LLT+I+S++  ILE FSA +  STLQ  E   +EGT+FQRFP +LLRK+  +C
Sbjct  192   AICLGFELLTMIISKNKKILESFSAVDVPSTLQFTENTIIEGTVFQRFPPDLLRKLSTDC  251

Query  512   LVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERN  333
             LVMQNHK+GISPE    + +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+N
Sbjct  252   LVMQNHKYGISPERLMENENLSSFFKILTTCTDEDDKVYVSTAHAYNYPVTAFQWHPEKN  311

Query  332   AFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGS  153
             AFEW L  IPHSEDAI V+Q VAN+ VSEA KS N P    V DNLIYNY+ ++ GK G 
Sbjct  312   AFEWGLPMIPHSEDAIQVTQHVANFLVSEAGKSLNRPPVGQVLDNLIYNYSPTFCGKAGK  371

Query  152   GFVEVYIFS  126
             G+ EVYIF+
Sbjct  372   GYDEVYIFT  380



>gb|AAC83041.1| Strong similarity to gb|AF067141 gamma-glutamyl hydrolase from 
Arabidopsis thaliana. ESTs gb|R83955, gb|T45062, gb|T22220, 
gb|AA586207, gb|AI099851 and gb|AI00672 come from this gene 
[Arabidopsis thaliana]
Length=327

 Score =   393 bits (1010),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLI+NEP
Sbjct  23    CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEP  82

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  83    EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  142

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ VE +N++GT+FQRFP ELL+K+G +CLVMQNH++GI
Sbjct  143   MIISQNRDIFEKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNHRFGI  202

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+SF+ +  LSNFF ++TT +D + KVYVST+Q  KYPV   QW PE+NAFEW  S+IP
Sbjct  203   SPQSFEGNIALSNFFKIVTTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKNAFEWGSSKIP  262

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  AN+ VSEARKS N P    V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  263   HSEDAIQVTQHAANHLVSEARKSLNRPESKKVLSNLIYNYKPTYCGYAGIGYDEVYIFT  321



>ref|XP_008463749.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Cucumis melo]
Length=364

 Score =   394 bits (1013),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 235/302 (78%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DP+LNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIY
Sbjct  63    SPSCTAMDPTLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIY  122

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E + +KL+LVNGV+F GG  +KG Y    ++I+KK+LE+ND GD FPL  + LGF+
Sbjct  123   NEPLEVIFEKLSLVNGVLFTGGWAKKGLYYLVAEKIFKKMLERNDAGDRFPLYGVCLGFE  182

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             +L++I+S++  ILE F+AS  ASTLQ V+ +N++GT+FQRFP+ LL K+  +C+V QNH 
Sbjct  183   ILSMIISKNRNILEPFNASYMASTLQFVDNVNIQGTVFQRFPHYLLEKLSTDCIVFQNHL  242

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE F  + +LS FF +LTTS DKDNKVYVS++Q   YPV A QW PE+NAFEW  S
Sbjct  243   YGISPERFAHNEELSRFFQILTTSSDKDNKVYVSSVQAWDYPVTAFQWHPEKNAFEWGYS  302

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPH+E AI V+Q VANY VSEARKSSN P    V +NLIYNY+ ++ GK G GF EVYI
Sbjct  303   VIPHTEHAIEVTQHVANYLVSEARKSSNRPPAQKVIENLIYNYSPTFGGKAGKGFDEVYI  362

Query  131   FS  126
             F+
Sbjct  363   FT  364



>ref|XP_009128305.1| PREDICTED: gamma-glutamyl hydrolase 1 [Brassica rapa]
 emb|CDY26875.1| BnaA02g19000D [Brassica napus]
Length=344

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C +PDP LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  40    CSSPDPKLNYRPVIGILSHPGDGASGRLTNDTTSTYIAASYVKFAEAGGARVIPLIYNEP  99

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L KKL LVNGV+F GG  +K EY + + +I+KK LE+ND G++FP+  I LGF+L++
Sbjct  100   EDVLFKKLELVNGVIFTGGWAKKYEYFDMVTKIFKKALERNDAGEHFPIYGICLGFELMS  159

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             IIVS+D  IL++F A + AS+LQ VE +N+EGTLFQRFP ELLRK+  +CLVMQ H+WGI
Sbjct  160   IIVSQDRGILQRFDAEDNASSLQFVENVNIEGTLFQRFPPELLRKLSTDCLVMQKHRWGI  219

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +PE F+A+  LS+FF ++TT +D+++K YVST++ KKYP+   QW PE+NAFEW  S+IP
Sbjct  220   TPEKFKANHALSSFFEIVTTCIDENSKTYVSTVKAKKYPITGFQWHPEKNAFEWGSSQIP  279

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HS DAI V+Q  A+Y VSEARKS N P+   V  NLIYNY  +Y G  G G+ EVY+F+
Sbjct  280   HSADAIQVTQYAASYLVSEARKSLNRPSSEKVLKNLIYNYKPTYCGYAGKGYDEVYLFT  338



>ref|NP_565186.2| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
 sp|O65355.2|GGH2_ARATH RecName: Full=Gamma-glutamyl hydrolase 2; Short=AtGGH2; AltName: 
Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49804.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana]
 gb|AAM20068.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana]
 gb|AEE36137.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
Length=347

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLI+NEP
Sbjct  43    CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103   EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ VE +N++GT+FQRFP ELL+K+G +CLVMQNH++GI
Sbjct  163   MIISQNRDIFEKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNHRFGI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+SF+ +  LSNFF ++TT +D + KVYVST+Q  KYPV   QW PE+NAFEW  S+IP
Sbjct  223   SPQSFEGNIALSNFFKIVTTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKNAFEWGSSKIP  282

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  AN+ VSEARKS N P    V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  283   HSEDAIQVTQHAANHLVSEARKSLNRPESKKVLSNLIYNYKPTYCGYAGIGYDEVYIFT  341



>ref|XP_010540146.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Tarenaya hassleriana]
Length=405

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/299 (62%), Positives = 235/299 (79%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP+ +P+LNY+PVIGI+SHPGDGASGR++NAT  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  101   CPSLNPNLNYQPVIGILSHPGDGASGRLNNATNASYIAASYVKLAEAGGARVIPLIYNEP  160

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  ++G Y E +K+I+ K LE+ND G++FP+ AI LGF+LL+
Sbjct  161   EEVLFQKLELVNGVIFTGGWAKRGLYYETVKKIFNKALERNDAGEHFPVYAICLGFELLS  220

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+D  ILE+F+A + ASTLQ VE +N+EGT+FQRFP +LLRK+  +CLVMQNH++GI
Sbjct  221   MIISQDRNILEEFAAEDAASTLQFVENINIEGTVFQRFPPQLLRKLSTDCLVMQNHRYGI  280

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE    +  LS+FFN+LTT +D+ +K YVST+Q K+YPV   QW PE+NAFEW  S+IP
Sbjct  281   SPERLLGNPALSSFFNILTTCIDEHDKTYVSTVQSKRYPVTGFQWHPEKNAFEWGSSKIP  340

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  ANY VSEARKS N P    V +NLIYNY+ +Y G  G GF EVYIF+
Sbjct  341   HSEDAIQVTQHAANYLVSEARKSLNRPPSQKVLENLIYNYSPTYCGYAGRGFDEVYIFT  399



>ref|XP_002887752.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64011.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/299 (62%), Positives = 234/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLIYN+P
Sbjct  43    CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIYNDP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103   EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ +E +N++GT+FQRFP ELL+K+G +CLVMQNH++GI
Sbjct  163   MIISQNRDIFEKMDARNSASSLQFLENVNIQGTIFQRFPPELLKKLGTDCLVMQNHRFGI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPESF+ +  LS+FF ++TT +D +NKVYVST+Q KKYPV   QW PE+NAFEW  S+IP
Sbjct  223   SPESFEGNVALSSFFKIVTTCVDNNNKVYVSTVQSKKYPVTGFQWHPEKNAFEWGSSKIP  282

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  AN+ VSEARKS N P+   V   LIY+Y  +Y G  G+G+ EVYIF+
Sbjct  283   HSEDAIQVTQHAANHLVSEARKSLNRPDSKKVLSYLIYSYKPTYCGYAGNGYDEVYIFT  341



>ref|XP_008226384.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Prunus mume]
Length=388

 Score =   394 bits (1011),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 191/302 (63%), Positives = 232/302 (77%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DP LNYRPVIGI+SHPGDGASGR+SNA+  SYIAAS VKFVESAGARVIPLIY
Sbjct  80    STRCTALDPKLNYRPVIGILSHPGDGASGRLSNASTASYIAASYVKFVESAGARVIPLIY  139

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP   L +KLNLVNGV+F GG  + G Y + ++ I++K++EKND GD+FPL A  LGF+
Sbjct  140   NEPPYVLFQKLNLVNGVLFTGGWAKSGLYYDIVERIFQKIIEKNDAGDHFPLYATCLGFE  199

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+S++  ILE FSA N ASTLQ  E   +EGT+FQRFP +LL+K+  +C+VMQNH 
Sbjct  200   LLTMIISKNKEILESFSAENMASTLQFTENAIIEGTVFQRFPPDLLKKLSTDCIVMQNHH  259

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISP   Q + +LS+FF +LTTS D+DNKVYVST+    YPV A QW PE+NAFEW   
Sbjct  260   YGISPVRLQENPNLSSFFKILTTSTDEDNKVYVSTVHAYSYPVTAFQWHPEKNAFEWGSP  319

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDAI V+Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G+GF EVYI
Sbjct  320   MIPHSEDAIQVTQHVANFLVSEARKSLNRPPVRKVLDNLIYNYSPTFCGKAGTGFDEVYI  379

Query  131   FS  126
             F+
Sbjct  380   FT  381



>emb|CDY14595.1| BnaC02g25180D [Brassica napus]
Length=344

 Score =   392 bits (1006),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 233/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C +PDP+LN+RPVIGI+SHPGDGASGR+SN T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  40    CSSPDPNLNHRPVIGILSHPGDGASGRLSNDTTSTYIAASYVKFAEAGGARVIPLIYNEP  99

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L KKL LVNGV+F GG  +K EY + + +I+KK LE+ND G++FP+  I LGF+L++
Sbjct  100   EDVLFKKLELVNGVIFTGGWAKKYEYFDMVTKIFKKTLERNDAGEHFPIYGICLGFELMS  159

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             IIVS+D  IL++F A + AS+LQ VE +N+EGTLFQRFP ELLRK+  +CLVMQ H+WGI
Sbjct  160   IIVSQDRGILQRFDAEDNASSLQFVENVNIEGTLFQRFPPELLRKLSTDCLVMQKHRWGI  219

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +PE F+A+  LS+FF ++TT +D+++K YVST++ KKYP+   QW PE+NAFEW  S+IP
Sbjct  220   TPEKFKANHALSSFFEIVTTCIDENSKTYVSTVKAKKYPITGFQWHPEKNAFEWGSSQIP  279

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HS DAI V+Q  A+Y VSEARKS N P+   V  NLIYNY  +Y G  G G+ EVY+F+
Sbjct  280   HSADAIQVTQYAASYLVSEARKSLNRPSSEKVLKNLIYNYKPTYCGYAGKGYDEVYLFT  338



>ref|XP_006389965.1| hypothetical protein EUTSA_v10018776mg [Eutrema salsugineum]
 gb|ESQ27251.1| hypothetical protein EUTSA_v10018776mg [Eutrema salsugineum]
Length=355

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/299 (62%), Positives = 234/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNY+PVIGI+SHPGDGASGR++NAT  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  51    CSAPDPNLNYKPVIGILSHPGDGASGRLNNATNASYIAASYVKLAEAGGARVIPLIYNEP  110

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL+LVNGV+F GG  ++G Y + +K+I+ K LE+ND G++FP+ AI LGF+LLT
Sbjct  111   EEFLFQKLDLVNGVIFTGGWAKQGLYYDIVKKIFNKALERNDAGEHFPVYAICLGFELLT  170

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  ILEK  A N AS+LQ VE ++ EGT+FQRFP ELL+K+  +CLVMQNH++GI
Sbjct  171   MIISQNTDILEKVDAKNSASSLQFVENVSTEGTVFQRFPPELLKKLSTDCLVMQNHQFGI  230

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+SF+ +  LS FF ++TT  D ++K YVST+Q KKYPV   QW PE+NAFEW LS IP
Sbjct  231   SPDSFEGNIALSRFFKIVTTCTDDNSKAYVSTVQSKKYPVTGFQWHPEKNAFEWGLSRIP  290

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  AN+ VSEARKS N P+  +V  NLIYNY  +Y G +G G+ EVYIF+
Sbjct  291   HSEDAIQVTQLAANHLVSEARKSLNRPSPKEVLSNLIYNYKPTYCGYEGRGYDEVYIFT  349



>ref|XP_003596308.1| Gamma-glutamylhydrolase [Medicago truncatula]
 gb|AES66559.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=340

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/298 (62%), Positives = 228/298 (77%), Gaps = 0/298 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPD SL YRPVIGIVSHPGDGASGR+SNATG +YIAAS VKFVE+ GARV+PLIY EP
Sbjct  42    CPAPDASLYYRPVIGIVSHPGDGASGRLSNATGANYIAASYVKFVEAGGARVVPLIYTEP  101

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L KKL LVNGV+F GG  ++G Y E +K I+K  LEKND GD FP+  + LGF+L++
Sbjct  102   WEILRKKLELVNGVLFTGGWAKEGLYFETVKRIFKIALEKNDAGDYFPVYGVCLGFELIS  161

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVSEDN ILE+FSA +QAS+LQ VE   +EG++FQRFP +LL+K+  +CLVMQNH++GI
Sbjct  162   MIVSEDNDILEEFSARSQASSLQFVENTKIEGSVFQRFPPDLLKKLSTDCLVMQNHRYGI  221

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP    ++  LS+FF +LT   D+D+KVYVST++ + YPV   QW PE+NAFEW    IP
Sbjct  222   SPGKLLSNQKLSSFFEILTICSDEDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGPKSIP  281

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             H+EDAI  +Q +AN+ VSEARKS N P   DV DNLIYNY  +Y G  G G+ EVYIF
Sbjct  282   HTEDAIRTTQYIANFLVSEARKSLNRPVAQDVLDNLIYNYRPTYCGYAGKGYDEVYIF  339



>ref|XP_010472700.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=368

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 230/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APD +LNYRPVIGI+SHPGDGASGR++NAT  S IAAS VK  E+ GARVIPLIYNEP
Sbjct  64    CSAPDLNLNYRPVIGILSHPGDGASGRLNNATNASNIAASYVKLAEAGGARVIPLIYNEP  123

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  124   EELLFQKLELVNGVILTGGWAKEGLYFEIVKKIFYKVLERNDAGEHFPLYAICLGFELLT  183

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVS++  I EK  A N AS+LQ +E +N+EGT+FQRFP EL  ++  +CLVMQNH++GI
Sbjct  184   MIVSQNRGIFEKVDARNCASSLQFIENVNIEGTVFQRFPPELFNQLSTDCLVMQNHQYGI  243

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+SF+    LSNFFN++TT  D  NK+YVST++ K+YPV   QW PE+NAFEW LS IP
Sbjct  244   SPDSFEGTVALSNFFNIVTTCSDNHNKIYVSTVKSKQYPVTGFQWHPEKNAFEWGLSGIP  303

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VANY VSEARKS N P+   V  NLIYNY  +Y G +G G+ EVYIF+
Sbjct  304   HSEDAIQVTQHVANYLVSEARKSQNRPSSEKVLSNLIYNYTPTYCGYEGRGYDEVYIFT  362



>ref|XP_008792313.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Phoenix dactylifera]
Length=394

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 234/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP+PDPSL YRPVIGIV+HPGDGASGR+SNAT  S I AS VKFVESAGAR+IPLIYNEP
Sbjct  96    CPSPDPSLYYRPVIGIVTHPGDGASGRLSNATNASNIPASYVKFVESAGARIIPLIYNEP  155

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E ++ KL+LVNGV+F GG  ++G Y E +K+I++  L++ND GD+FPL  I LGF+L++
Sbjct  156   WEVILDKLSLVNGVLFTGGWCKRGLYFETVKKIFQITLDRNDAGDHFPLFGICLGFELIS  215

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+++DN   E+FS  +QASTL+  + +N++G++F+RFP ELL+K+  +CL MQNH +GI
Sbjct  216   MIITKDNNFCERFSGEDQASTLEFPDHVNMQGSVFERFPSELLKKLSTDCLAMQNHMFGI  275

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+S Q +  LS+FF +LTTS D + +VYVST Q   YPV   QW PE+NAFEW L  IP
Sbjct  276   SPKSLQENDALSSFFRILTTSTDANGEVYVSTAQAYNYPVTGFQWHPEKNAFEWGLPMIP  335

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q +ANYF+SEARKSSN P+   V DNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  336   HSEDAIRVTQHIANYFISEARKSSNRPSARKVLDNLIYNYSPTYGGKAGKGYDEVYIFT  394



>emb|CDX87442.1| BnaA07g34310D [Brassica napus]
Length=344

 Score =   387 bits (995),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDPSLNY+PVIGI++HPGDGA+GR++N T  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  40    CSAPDPSLNYKPVIGILTHPGDGATGRLNNDTNASYIAASYVKLAEAGGARVIPLIYNEP  99

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L KKL LVNGV+F GG  +KG Y + +K+I+ + LE+NDGG++FP+ AI LGF+LLT
Sbjct  100   EELLFKKLELVNGVIFTGGWAKKGLYFDVVKKIFTRALERNDGGEHFPVYAICLGFELLT  159

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ VE ++ +GT+FQRFP ELL+K+  +CLVMQNH++GI
Sbjct  160   MIISQNTDIFEKVDAKNAASSLQFVENVSTQGTVFQRFPPELLKKLTTDCLVMQNHQFGI  219

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP++F+ +  LS FF ++TT LD + K YVST+Q KKYPV   QW PE+NAFEW  S+IP
Sbjct  220   SPDNFEGNIALSRFFKIVTTCLDGNRKAYVSTVQSKKYPVTGFQWHPEKNAFEWGSSKIP  279

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDA+ V+Q  ANY VSEARKS N P+   V  NLIYN+  +Y G +G G+ EVYIF+
Sbjct  280   HSEDAVHVTQLTANYLVSEARKSQNRPSPEKVLSNLIYNFKPTYCGYEGRGYDEVYIFT  338



>ref|XP_010924708.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 2-like 
[Elaeis guineensis]
Length=363

 Score =   388 bits (997),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 232/299 (78%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP+PD SL YRPVIGIV+HPGDGASGR+SNAT  S I AS VKFVESAGARVIPLIYNEP
Sbjct  65    CPSPDLSLYYRPVIGIVTHPGDGASGRLSNATNASNIPASYVKFVESAGARVIPLIYNEP  124

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E ++ KL+LVNGV++ GG  +KG Y E +K+I++  L++ND GD+FPL  I LGF+LL+
Sbjct  125   WEVILDKLSLVNGVLYTGGWCKKGLYFETVKKIFQITLDRNDAGDHFPLFGICLGFELLS  184

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+++DN   E+FS  NQASTLQ  + +N++G++F+RFP ELL+K+  +CL MQNH +GI
Sbjct  185   MIITQDNNFCERFSGENQASTLQFPDYVNIQGSVFERFPSELLKKLSTDCLAMQNHMYGI  244

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+S Q +  LS+FF +LTTS D + +VY+ST Q   YPV   QW PE+NAFEW  S IP
Sbjct  245   SPKSLQENDALSSFFRILTTSTDANGEVYISTAQAYNYPVTGFQWHPEKNAFEWGPSMIP  304

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDA+ V+Q  ANYF+SEARKSSN P+   V DNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  305   HSEDAVRVTQHTANYFISEARKSSNRPSARKVLDNLIYNYSPTYGGKAGKGYDEVYIFT  363



>gb|KEH38596.1| gamma-glutamylhydrolase [Medicago truncatula]
Length=340

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 187/301 (62%), Positives = 228/301 (76%), Gaps = 0/301 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  CPAPD SL Y+PVIGI+SHPGDGASGR+SNAT  SY+AAS VKFVE+ GARV+PLIY
Sbjct  39    SVNCPAPDSSLYYQPVIGILSHPGDGASGRLSNATDASYLAASYVKFVEAGGARVVPLIY  98

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
              EP E L+KKL LVNGV+F GG    G Y E +  I+KKVLEKND GD FPL A  LGF+
Sbjct  99    TEPWEILLKKLELVNGVLFTGGVANDGLYFEIVGRIFKKVLEKNDAGDYFPLYATCLGFE  158

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             L+T+IVSEDN ILE F+A NQAS+LQ VE +N++ ++FQRFP +LL+K+  +C+VMQNH+
Sbjct  159   LITMIVSEDNDILEDFAAENQASSLQFVENVNIKESVFQRFPPDLLKKLSTDCIVMQNHQ  218

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISP     +  LS+FF +LTTS D+D+KVYVST++ + YPV   QW PE+NAFEW   
Sbjct  219   YGISPVKLLGNQKLSSFFEILTTSNDQDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGSP  278

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPH+EDAI  +Q  ANY VSEARKS N P   ++ DNLIYNY  +Y G  G GF EVYI
Sbjct  279   SIPHTEDAIRTTQYAANYLVSEARKSLNRPVAQELLDNLIYNYRPTYCGYAGKGFDEVYI  338

Query  131   F  129
             F
Sbjct  339   F  339



>ref|XP_006302531.1| hypothetical protein CARUB_v10020631mg, partial [Capsella rubella]
 gb|EOA35429.1| hypothetical protein CARUB_v10020631mg, partial [Capsella rubella]
Length=331

 Score =   386 bits (992),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  27    CSAPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  86

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  87    EELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFELMS  146

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             II+S++  ILE+F A + AS+LQ V+ +N++GTLFQRFP +LL+K+  +CLVMQ HK+GI
Sbjct  147   IIISQNRDILERFDAEDNASSLQFVDNVNLDGTLFQRFPPQLLKKLSTDCLVMQKHKYGI  206

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +P +FQ +  LS+FF +LTT +D+++K YVST++ KKYP+   QW PE+NAFEW  SEIP
Sbjct  207   TPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKKYPITGFQWHPEKNAFEWGSSEIP  266

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  A+Y VSEARKS N P    V  NLIY Y  +Y G  G G+ EVYIF+
Sbjct  267   HSEDAIQVTQHAASYLVSEARKSLNRPPSKKVLSNLIYKYKPTYCGYAGRGYDEVYIFT  325



>ref|XP_010417473.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Camelina sativa]
Length=368

 Score =   387 bits (995),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 184/299 (62%), Positives = 230/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APD +LNYRPVIGI+SHPGDGASGR++NAT  S IAAS VK  E+ GARVIPLIYNEP
Sbjct  64    CSAPDLNLNYRPVIGILSHPGDGASGRLNNATNASNIAASYVKLAETGGARVIPLIYNEP  123

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  124   EELLFQKLELVNGVILTGGWAKQGLYFEIVKKIFYKVLERNDAGEHFPLYAICLGFELLT  183

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ ++ +N+EGT+FQRFP EL +++  +CLVMQNH++GI
Sbjct  184   MIISQNRDIFEKVDARNCASSLQFIKNVNIEGTVFQRFPPELFKQLSTDCLVMQNHQYGI  243

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+SF+    LSNFFN++TT  D  NK YVSTI+ K+YPV   QW PE+NAFEW LS IP
Sbjct  244   SPDSFEGTVALSNFFNIVTTCSDNHNKTYVSTIKSKQYPVTGFQWHPEKNAFEWGLSGIP  303

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q VANY VSEARKS N P+   V  NLIYN+  +Y G +G G+ EVYIF+
Sbjct  304   HSEDAIQVTQHVANYLVSEARKSQNRPSSEKVLSNLIYNHTPTYCGYEGRGYDEVYIFT  362



>gb|AFK41094.1| unknown [Medicago truncatula]
Length=340

 Score =   385 bits (989),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/301 (62%), Positives = 227/301 (75%), Gaps = 0/301 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  CPAPD SL Y+PVIGI+SHPGDGASGR+SNAT  SY+AAS VKFVE+ GARV+PLIY
Sbjct  39    SVNCPAPDSSLYYQPVIGILSHPGDGASGRLSNATDASYLAASYVKFVEAGGARVVPLIY  98

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
              EP E L+KKL LVNGV+F GG    G Y E +  I+KKVLEKND GD FPL A  LGF+
Sbjct  99    TEPWEILLKKLELVNGVLFTGGVANDGLYFEIVGRIFKKVLEKNDAGDYFPLYATCLGFE  158

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             L+T+IVSEDN  LE F+A NQAS+LQ VE +N++ ++FQRFP +LL+K+  +C+VMQNH+
Sbjct  159   LITMIVSEDNDTLEDFAAENQASSLQFVENVNIKESVFQRFPPDLLKKLSTDCIVMQNHQ  218

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISP     +  LS+FF +LTTS D+D+KVYVST++ + YPV   QW PE+NAFEW   
Sbjct  219   YGISPVKLLGNQKLSSFFEILTTSNDQDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGSP  278

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPH+EDAI  +Q  ANY VSEARKS N P   ++ DNLIYNY  +Y G  G GF EVYI
Sbjct  279   SIPHTEDAIRTTQYAANYLVSEARKSLNRPVAQELLDNLIYNYRPTYCGYAGKGFDEVYI  338

Query  131   F  129
             F
Sbjct  339   F  339



>ref|XP_004146022.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Cucumis sativus]
 gb|KGN55057.1| hypothetical protein Csa_4G626100 [Cucumis sativus]
Length=375

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 233/302 (77%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DP LNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVESAGARVIPLIY
Sbjct  74    SPSCTAMDPRLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIY  133

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
              EP E + +KL+LVNGV+F GG  ++G Y    ++I++K+LE+ND GD FPL  + LGF+
Sbjct  134   TEPLEVIFEKLSLVNGVLFTGGWAKEGLYYSVAQKIFEKILERNDAGDRFPLYGVCLGFE  193

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             +L++I+S++  ILE F+AS  ASTLQ V+ +N++GT+FQRFP+ LL K+  +C+V QNH 
Sbjct  194   ILSMIISKNRNILEPFNASYMASTLQFVDNVNIQGTVFQRFPHYLLEKLSTDCIVFQNHY  253

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE+F  + +L+ FF +LTTS DKDNKVYVS++Q   YPV A QW PE+NAFEW  S
Sbjct  254   FGISPETFAQNEELTKFFQILTTSSDKDNKVYVSSVQAWHYPVTAFQWHPEKNAFEWGYS  313

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPH+E A+ V+Q VANY VSEARKS N P    V +NLIYNY+ ++ GK G GF EVYI
Sbjct  314   VIPHTEHAVEVTQHVANYLVSEARKSLNKPPAQKVIENLIYNYSPTFGGKAGKGFDEVYI  373

Query  131   FS  126
             F+
Sbjct  374   FA  375



>ref|XP_009106586.1| PREDICTED: gamma-glutamyl hydrolase 2 [Brassica rapa]
Length=344

 Score =   385 bits (988),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 230/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDPSLNY+PVIGI+SHPGDGA+GR++N T  SYIAAS VK  E+ GARVIPLIYNEP
Sbjct  40    CSAPDPSLNYKPVIGILSHPGDGATGRLNNDTNASYIAASYVKLAEAGGARVIPLIYNEP  99

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L KKL LVNGV+F GG  +KG Y + +K+I+ + LE+NDGG++FP+ AI LGF+LLT
Sbjct  100   EELLFKKLELVNGVIFTGGWAKKGLYFDVVKKIFTRALERNDGGEHFPVYAICLGFELLT  159

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ V  ++ +GT+FQRFP ELL+K+  +CLVMQNH++GI
Sbjct  160   MIISQNTDIFEKVDAKNAASSLQFVGNVSTQGTVFQRFPPELLKKLTTDCLVMQNHQFGI  219

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP++F+ +  LS FF ++TT LD + K YVST+Q KKYPV   QW PE+NAFEW  S+IP
Sbjct  220   SPDNFEGNIALSRFFKIVTTCLDGNRKAYVSTVQSKKYPVTGFQWHPEKNAFEWGSSKIP  279

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDA+ V+Q  ANY VSEARKS N P+   V  NLIYN+  +Y G +G G+ EVYIF+
Sbjct  280   HSEDAVHVTQLTANYLVSEARKSQNRPSPEKVLSNLIYNFKPTYCGYEGRGYDEVYIFT  338



>ref|XP_002887750.1| ATGGH1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64009.1| ATGGH1 [Arabidopsis lyrata subsp. lyrata]
Length=344

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  40    CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  99

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +K +Y E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  100   EELLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFNKALERNDAGEHFPVYGICLGFELMS  159

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             II+S++  ILE+F A + ASTLQ V+ +N++GTLFQRFP ELL+K+  +CLVMQ HK+GI
Sbjct  160   IIISQNRDILERFDAEDNASTLQFVDNVNIDGTLFQRFPPELLKKLSTDCLVMQKHKYGI  219

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+NAFEW  S IP
Sbjct  220   TPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSSAIP  279

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  280   HSEDAIQVTQHAASYLVSEARKSLNRPPSKKVLSNLIYNYKPTYCGYAGRGYDEVYIFT  338



>gb|AFK48342.1| unknown [Medicago truncatula]
Length=340

 Score =   384 bits (986),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/298 (61%), Positives = 228/298 (77%), Gaps = 0/298 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPD SL YRPVIGIVSHPGDGASGR+SNATG +YIAAS VKFVE+ GARV+PLI+ EP
Sbjct  42    CPAPDASLYYRPVIGIVSHPGDGASGRLSNATGANYIAASYVKFVEAGGARVVPLIHTEP  101

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L KKL LVNGV+F GG  ++G Y E +K I+K  LEK+D GD FP+  + LGF+L++
Sbjct  102   WEILRKKLELVNGVLFTGGWAKEGLYFETVKRIFKIALEKSDAGDYFPVYGVCLGFELIS  161

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVSEDN ILE+FSA +QAS+LQ VE   +EG++FQRFP +LL+K+  +CLVMQNH++GI
Sbjct  162   MIVSEDNDILEEFSARSQASSLQFVENTKIEGSVFQRFPPDLLKKLSTDCLVMQNHRYGI  221

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP    ++  LS+FF +LT   D+D+KVYVST++ + YPV   QW PE+NAFEW    IP
Sbjct  222   SPGKLLSNQKLSSFFEILTICSDEDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGPKSIP  281

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             H+EDAI  +Q +AN+ VSEARKS N P   DV DNLIYNY  +Y G  G G+ EVYIF
Sbjct  282   HTEDAIRTTQYIANFLVSEARKSLNRPVAQDVLDNLIYNYRPTYCGYVGKGYDEVYIF  339



>ref|NP_177987.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 ref|NP_974172.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 sp|Q9SYL6.1|GGH1_ARATH RecName: Full=Gamma-glutamyl hydrolase 1; Short=AtGGH1; AltName: 
Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD30570.1|AC007260_1 putative gamma-glutamyl hydrolase [Arabidopsis thaliana]
 gb|AEE36133.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 gb|AEE36135.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
Length=348

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  44    CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  103

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +K +Y E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  104   EEVLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFELMS  163

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             II+S++  ILE+F A + AS+LQ V+ +N +GTLFQRFP ELL+K+  +CLVMQ HK+GI
Sbjct  164   IIISQNRDILERFDAEDNASSLQFVDNVNNDGTLFQRFPPELLKKLSTDCLVMQKHKYGI  223

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +P +FQA+  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+NAFEW  S IP
Sbjct  224   TPANFQANPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSSAIP  283

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  284   HSEDAIQVTQHAASYLVSEARKSLNRPESQKVLSNLIYNYKPTYCGYAGRGYDEVYIFT  342



>gb|KFK42251.1| hypothetical protein AALP_AA2G230800 [Arabis alpina]
Length=352

 Score =   384 bits (986),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 227/299 (76%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP++NY+PVIGI+SHPGDGASGR+SN T  +YIAAS VKF ES GARVIPLIYNEP
Sbjct  48    CSAPDPNMNYKPVIGILSHPGDGASGRLSNDTSSTYIAASYVKFAESGGARVIPLIYNEP  107

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG   +G Y + +K+I+ + LE+ND G++FP+ AI LGF+LLT
Sbjct  108   EELLFQKLELVNGVIFTGGWAMEGLYYDIVKKIFNRALERNDDGEHFPVYAICLGFELLT  167

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  ILE   A N A++LQ VE  ++ GT+FQRFP EL +K+  +CLVMQNH++GI
Sbjct  168   MIISQNRDILEHVDAKNSATSLQFVENAHINGTVFQRFPTELFKKLSTDCLVMQNHQYGI  227

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP  ++++  LS+FF+++TT  D  NK YVST+Q KKYPV   QW PE+NAFEW LS IP
Sbjct  228   SPGRYESNIALSSFFSIITTCTDNHNKAYVSTVQSKKYPVTGFQWHPEKNAFEWGLSRIP  287

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  ANY VSEARKS N P    V  NLIYNY  +Y G +G GF EVYIF+
Sbjct  288   HSEDAIQVTQLAANYLVSEARKSKNRPPAKKVLSNLIYNYKPTYCGYEGRGFDEVYIFT  346



>emb|CDX88464.1| BnaC06g39080D [Brassica napus]
Length=344

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDPSLNY+PVIGI++HPGDGA+GR++N T  SYIAAS VK  E+ GARV+PLIYNEP
Sbjct  40    CSAPDPSLNYKPVIGILTHPGDGATGRLNNDTNASYIAASYVKLAEAGGARVVPLIYNEP  99

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +KG Y + +K+I+ + LE+NDGG++FP+ AI LGF+LLT
Sbjct  100   EELLFQKLELVNGVIFTGGWAKKGLYFDVVKKIFTRALERNDGGEHFPVYAICLGFELLT  159

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ VE ++++GT+FQRFP ELL+K+  +CLVMQNH++GI
Sbjct  160   MIISQNTDIFEKVDAKNAASSLQFVEIVSIQGTVFQRFPPELLKKLTTDCLVMQNHQFGI  219

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP++F+ +  LS FF ++TT LD + K YVST+Q K YPV   QW PE+NAFEW  S+IP
Sbjct  220   SPDNFEGNIALSRFFKIVTTCLDGNRKAYVSTVQSKTYPVTGFQWHPEKNAFEWGSSKIP  279

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDA+ V+Q +ANY V EARKS N P+   V  NLIYNY  +Y G +G G+ EVYIF+
Sbjct  280   HSEDAVHVTQLIANYLVGEARKSQNRPSPEKVLSNLIYNYKPTYCGYEGRGYDEVYIFA  338



>ref|NP_849900.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
 gb|ABD59075.1| At1g78660 [Arabidopsis thaliana]
 dbj|BAH19882.1| AT1G78660 [Arabidopsis thaliana]
 gb|AEE36134.1| gamma-glutamyl hydrolase 1 [Arabidopsis thaliana]
Length=347

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 231/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  43    CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +K +Y E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  103   EEVLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFELMS  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             II+S++  ILE+F A + AS+LQ V+ +N +GTLFQRFP ELL+K+  +CLVMQ HK+GI
Sbjct  163   IIISQNRDILERFDAEDNASSLQFVDNVNNDGTLFQRFPPELLKKLSTDCLVMQKHKYGI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +P +FQA+  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+NAFEW  S IP
Sbjct  223   TPANFQANPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSSAIP  282

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  A+Y VSEARKS N P    V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  283   HSEDAIQVTQHAASYLVSEARKSLNRPESQKVLSNLIYNYKPTYCGYAGRGYDEVYIFT  341



>gb|KFK42250.1| hypothetical protein AALP_AA2G230700 [Arabis alpina]
Length=336

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 228/303 (75%), Gaps = 0/303 (0%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             LS  C +PDP+LNYRPVIGI+SHPGDGASGR+SN T  +YIAAS VKF E+ GARVIPLI
Sbjct  34    LSPVCSSPDPNLNYRPVIGILSHPGDGASGRLSNDTSATYIAASYVKFAEAGGARVIPLI  93

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             Y EP E L KKL LVNGV+F GG  ++G Y + +K+I+ K LE+NDGG++FP+  I LGF
Sbjct  94    YTEPEEVLFKKLELVNGVIFTGGWAKEGLYYDIVKKIFNKALERNDGGEHFPVYGICLGF  153

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +L+++IVS++  ILE F + N AS+LQ  E +N++GT+FQRFP ELL K+  +CL MQNH
Sbjct  154   ELISMIVSQNRDILENFDSENSASSLQFFENVNIQGTVFQRFPPELLTKLSTDCLTMQNH  213

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
              +GISP  FQ++  LS+FF ++TT +D  NK YVST++  KYP+   QW PE+NAFEW  
Sbjct  214   YFGISPARFQSNPGLSSFFEIVTTCIDGKNKTYVSTVKATKYPITGFQWHPEKNAFEWGS  273

Query  314   SEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
             S+IPHSEDAI V+Q  A+Y VSEARKS N PN   V  NLIYNY  +Y G  G G+ EVY
Sbjct  274   SKIPHSEDAIQVTQQAASYLVSEARKSKNRPNSKQVLSNLIYNYKPTYCGYAGRGYDEVY  333

Query  134   IFS  126
             IF+
Sbjct  334   IFT  336



>ref|XP_010417472.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Camelina sativa]
Length=347

 Score =   382 bits (980),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 229/302 (76%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIY
Sbjct  40    SSVCSAQDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIY  99

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+
Sbjct  100   NEPEELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFE  159

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             L++II+S++  ILE+F A + AS+LQ V+ +N+EGTLFQRFP  LL+KV  +CLVMQ HK
Sbjct  160   LMSIIISQNRDILERFDAEDNASSLQFVDNVNLEGTLFQRFPPPLLKKVSSDCLVMQKHK  219

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GI+P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+NAFEW  S
Sbjct  220   YGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSS  279

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDAI V+Q  ANY VSEARKS N      V  NLIYNY  +Y G  G G+ EVYI
Sbjct  280   AIPHSEDAIQVTQHAANYLVSEARKSLNRAPPKKVLSNLIYNYKPTYCGYAGRGYDEVYI  339

Query  131   FS  126
             F+
Sbjct  340   FT  341



>ref|NP_001185429.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
 gb|AEE36138.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana]
Length=333

 Score =   381 bits (978),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 223/289 (77%), Gaps = 0/289 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR+SNAT  S IAAS VK  ES GARVIPLI+NEP
Sbjct  43    CSAPDPNLNYRPVIGILSHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FP+ AI LGF+LLT
Sbjct  103   EEILFQKLELVNGVILTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLT  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ VE +N++GT+FQRFP ELL+K+G +CLVMQNH++GI
Sbjct  163   MIISQNRDIFEKMDARNSASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNHRFGI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+SF+ +  LSNFF ++TT +D + KVYVST+Q  KYPV   QW PE+NAFEW  S+IP
Sbjct  223   SPQSFEGNIALSNFFKIVTTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKNAFEWGSSKIP  282

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
             HSEDAI V+Q  AN+ VSEARKS N P    V  NLIYNY  +Y G  G
Sbjct  283   HSEDAIQVTQHAANHLVSEARKSLNRPESKKVLSNLIYNYKPTYCGYAG  331



>ref|XP_010429696.1| PREDICTED: gamma-glutamyl hydrolase 1-like [Camelina sativa]
Length=347

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DP+LNYRP+IGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIY
Sbjct  40    SSVCSAQDPNLNYRPIIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIY  99

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KL LVNGV+F GG  +K EY + +K+I+KK LE+ND G++FP+  I LGF+
Sbjct  100   NEPEELLFQKLELVNGVIFTGGWAKKYEYFDTVKKIFKKALERNDAGEHFPVYGICLGFE  159

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             L++II+S++  ILE+F A + AS+LQ V+ +N+EGTLFQRFP  LL+K+  +CLVMQ HK
Sbjct  160   LMSIIISQNRDILERFDAEDNASSLQFVDNVNLEGTLFQRFPPPLLKKLSTDCLVMQKHK  219

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GI+P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+NAFEW  S
Sbjct  220   YGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSS  279

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDAI V+Q  ANY VSEARKS N      V  NLIYNY  +Y G  G G+ EVYI
Sbjct  280   AIPHSEDAIQVTQHAANYLVSEARKSLNRAPPKKVLSNLIYNYKPTYCGYAGRGYDEVYI  339

Query  131   FS  126
             F+
Sbjct  340   FT  341



>ref|XP_010472701.1| PREDICTED: gamma-glutamyl hydrolase 1 [Camelina sativa]
Length=347

 Score =   381 bits (979),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/299 (60%), Positives = 228/299 (76%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C A DP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  43    CSAQDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  103   EELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFELMS  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             II+S++  ILE+F A + AS+LQ V+ +N+EGTLFQRFP  LL+KV  +CLVMQ HK+GI
Sbjct  163   IIISQNRDILERFDAEDNASSLQFVDNVNLEGTLFQRFPPPLLKKVSTDCLVMQKHKYGI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +P +FQ +  LS+FF +LTT +D+++K YVST++ K+YP+   QW PE+NAFEW  S IP
Sbjct  223   TPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSSAIP  282

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+Q  ANY VSEARKS N      V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  283   HSEDAIQVTQHAANYLVSEARKSLNRAPPKKVLSNLIYNYKPTYCGYAGRGYDEVYIFT  341



>ref|XP_006833066.2| PREDICTED: gamma-glutamyl hydrolase 2 isoform X1 [Amborella trichopoda]
Length=382

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 232/298 (78%), Gaps = 0/298 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP+L Y+PVIGI++HPGDGASGR+ N + VSYIAAS VKF E+AGARVIPLIYNE 
Sbjct  84    CPAPDPALYYQPVIGILTHPGDGASGRLMNGSHVSYIAASYVKFCEAAGARVIPLIYNER  143

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L++KLNLVNG++  GG  ++G Y + ++ I+K VLE+ND GD+FPL+AI L F+L++
Sbjct  144   REVLLEKLNLVNGMLLTGGWCKRGLYYDTVEMIFKHVLERNDAGDHFPLVAICLNFELIS  203

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             IIVS+D  I E++SA +  STLQ  + + +  T+F+RF  ELL+KV  ECL+MQ+H++G+
Sbjct  204   IIVSQDRSIFERYSALDLPSTLQFKQNIELNNTVFRRFSSELLKKVSTECLIMQSHRFGV  263

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE+F+++  LSNFF +LTT  DK+ KVYVST Q  +YP+   QW PE+NAFEW L  IP
Sbjct  264   SPETFESNHALSNFFKILTTCADKNGKVYVSTTQAYRYPIFGFQWHPEKNAFEWGLPNIP  323

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             HSEDA+ V+Q VAN+F+SEARKSSN P    V DNLIYN++ +Y GK G G+ EVY+F
Sbjct  324   HSEDAVQVTQHVANFFISEARKSSNRPPTTRVLDNLIYNHSPTYCGKAGKGYDEVYLF  381



>ref|XP_009406770.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   380 bits (976),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/299 (61%), Positives = 225/299 (75%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP+ DPSL Y PVIGIV+HPGDGASGR+SN T  S I AS VKFVESAGARVIPLIYNEP
Sbjct  57    CPSTDPSLYYLPVIGIVTHPGDGASGRLSNVTSASNIPASYVKFVESAGARVIPLIYNEP  116

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              ETL+ KL+LVNGV+F GG  +KG Y E + ++++  LE+ND GD+FPL AI LGF+L++
Sbjct  117   EETLLDKLSLVNGVLFTGGWAKKGLYFETITKLFQVTLERNDAGDHFPLFAICLGFELVS  176

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S D  I E+F   NQASTL   +   ++G++F+RFP ELL K+  ECL MQNHK+G+
Sbjct  177   MIISNDCDICERFKGENQASTLYFPDYAEIKGSVFERFPLELLWKLSTECLAMQNHKYGL  236

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP+  Q +  LS+FF +LTTS D++ K YVST Q   YPV   QW PE+NAFEW LS IP
Sbjct  237   SPKRLQDNVALSSFFRILTTSKDENGKDYVSTAQAYNYPVTGFQWHPEKNAFEWGLSMIP  296

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDA+ V+Q VANY +SEARKSSN P    V DNLIYNY+ +Y GK G G+ EVYIFS
Sbjct  297   HSEDAVRVTQHVANYLISEARKSSNRPPTEKVLDNLIYNYSPTYCGKAGRGYDEVYIFS  355



>ref|XP_010248391.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Nelumbo 
nucifera]
Length=346

 Score =   379 bits (973),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 186/306 (61%), Positives = 234/306 (76%), Gaps = 2/306 (1%)
 Frame = -3

Query  1043  NWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVI  864
             +W+ S  C APDP+L +RPVIGI++HP  GAS    NA+  S I AS VKFVESAGARVI
Sbjct  43    SWR-SSSCQAPDPALYFRPVIGILTHPAHGASNG-PNASNASLITASYVKFVESAGARVI  100

Query  863   PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
             PLIYNEP E L +KL+LVNGV+ PGG  + G + E +++++K  LEKND GD+FP+ AI 
Sbjct  101   PLIYNEPPEILAEKLSLVNGVLLPGGWAKTGLFYEIVEKVFKHALEKNDSGDHFPVFAIC  160

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             L F+LLT+I+S+D  ILE+F+A NQASTLQ  E   +EGT+FQRF  ELL+K+  +C+VM
Sbjct  161   LSFELLTMIISKDVNILERFNALNQASTLQFTENSIIEGTVFQRFSPELLKKLTTDCIVM  220

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             +NH++GIS E FQ +  LS+FF +LTTS D+D KVYVST++   YPV A QW PE+NAFE
Sbjct  221   ENHQYGISLERFQKNPSLSSFFRILTTSKDRDGKVYVSTVKSHNYPVSAFQWHPEKNAFE  280

Query  323   WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
             W LS IPH+EDA+LV+Q VANYF+SEARKS N P    V DNLIYNY  +YSGK G+G+ 
Sbjct  281   WGLSMIPHTEDAVLVTQHVANYFISEARKSLNRPPAQKVLDNLIYNYRPTYSGKAGTGYD  340

Query  143   EVYIFS  126
             EVYIFS
Sbjct  341   EVYIFS  346



>ref|XP_004489008.1| PREDICTED: gamma-glutamyl hydrolase-like [Cicer arietinum]
Length=327

 Score =   378 bits (970),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/289 (62%), Positives = 226/289 (78%), Gaps = 0/289 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAP+P+L Y+PVIGI+SHPGD ASGR+SNAT  S+I AS VKFVE+AGARVIPLIYNEP
Sbjct  39    CPAPNPNLYYQPVIGILSHPGDSASGRLSNATSASFIIASYVKFVEAAGARVIPLIYNEP  98

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
             T+ L+KKL+LVNGV+F GGS   G Y E +  I+KK LEKND GDNFPL AI LGF+L+T
Sbjct  99    TDKLLKKLDLVNGVLFTGGSVNSGLYFETVGRIFKKALEKNDAGDNFPLYAICLGFELIT  158

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S D  ILE+F A +QASTLQ VE  N+EGT+FQRFP +LL+K+  +CL  QNH +G+
Sbjct  159   MIISGDKNILEEFKAQDQASTLQFVENANLEGTVFQRFPPDLLKKLSTDCLARQNHAYGV  218

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP  F A+ +LS+FF +LTTS D+++KVYVSTI+ +KYPV   QW PE+N F W+   IP
Sbjct  219   SPTKFLANQNLSSFFEILTTSNDEEDKVYVSTIRSRKYPVTGFQWHPEKNPFGWSSPTIP  278

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
             H+EDAI  +Q VAN+ VSEARKS   P+  ++ DNLIYNY+ ++ GK G
Sbjct  279   HTEDAIQTTQYVANFLVSEARKSLTRPDAQELIDNLIYNYSPTFYGKAG  327



>ref|XP_006477848.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=371

 Score =   379 bits (972),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 228/297 (77%), Gaps = 0/297 (0%)
 Frame = -3

Query  1016  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
             A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75    ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  836   TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  657
              L +KL LVNGV+  GG  +KG Y + +++I+KK+LEKND G+ FPL AI LGF+L+++I
Sbjct  135   ILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKKILEKNDAGEYFPLYAICLGFELISMI  194

Query  656   VSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISP  477
             +S+D  ILE+F+ ++QASTL+ ++   +EGT+FQRF  ELL+K+  +CLVMQ H +GISP
Sbjct  195   ISKDRNILERFNGADQASTLKFIKNSKIEGTVFQRFVPELLKKLSTDCLVMQKHIYGISP  254

Query  476   ESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHS  297
             E  Q + DLS FF +LTTS D  NKVYVST+Q   YP    QW PE+NAFEW  S +PHS
Sbjct  255   ERMQENLDLSKFFRILTTSEDIYNKVYVSTVQAYNYPFTGFQWHPEKNAFEWGFSGVPHS  314

Query  296   EDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             EDAILV+Q VAN+FVSEARKS N P    V DNLIYNY+  Y GKDG G+ EVYIF+
Sbjct  315   EDAILVTQHVANFFVSEARKSLNRPPARKVLDNLIYNYSPIYCGKDGRGYDEVYIFT  371



>gb|EYU29531.1| hypothetical protein MIMGU_mgv1a009742mg [Erythranthe guttata]
Length=333

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 230/301 (76%), Gaps = 3/301 (1%)
 Frame = -3

Query  1019  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  840
             P     LNY P+IGI+SHPGDGASGR++N+T  SYIAAS VKFVES GARVIPLIYNEP 
Sbjct  33    PPSGMKLNYHPIIGIISHPGDGASGRLNNSTKASYIAASYVKFVESGGARVIPLIYNEPP  92

Query  839   ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
             E L KKLNLVNGV+FPGGS ++G + E ++ I+K V++KNDGGD+FPLLA+ LGF+LL +
Sbjct  93    EILNKKLNLVNGVLFPGGSIKRGHFFEVVESIFKNVVKKNDGGDHFPLLAVCLGFELLAM  152

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             IVS+D  ILE+FSA +  STL     +N+ GT F+RFP  LL+K+ +E +VM++H++GIS
Sbjct  153   IVSKDKNILEEFSAIDYPSTLMFPRNINLNGTAFERFPPYLLQKMAKENIVMEHHQYGIS  212

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPH  300
             PE F  + +LSNFF ++TTS  K+ K+YVST+Q +KYPV   QW PE+NA+EW L  IPH
Sbjct  213   PEKFHKNKNLSNFFKIVTTSTCKNRKIYVSTVQARKYPVTGFQWHPEKNAYEWGLPGIPH  272

Query  299   SEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFV---EVYIF  129
             SE AI V+Q+ AN+FV E+RKSSN P+  +V D LIYNY  +Y GK G GF    +VYIF
Sbjct  273   SESAIQVTQNAANFFVRESRKSSNRPSNGEVLDKLIYNYKPTYCGKAGRGFESFDQVYIF  332

Query  128   S  126
             S
Sbjct  333   S  333



>gb|KFK42249.1| hypothetical protein AALP_AA2G230600 [Arabis alpina]
Length=326

 Score =   373 bits (958),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 229/299 (77%), Gaps = 0/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C + DP+LNY+P+IGI+SHPGDGASGR++N +  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  22    CSSQDPNLNYKPIIGILSHPGDGASGRLTNDSSSTYIAASYVKFAEAGGARVIPLIYNEP  81

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +K EY + +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  82    EELLFQKLELVNGVIFTGGWAKKYEYFDIVKKIFNKALERNDAGEHFPVYGICLGFELMS  141

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             II+S++  ILE+F A + AS+LQ VE +N++GTLFQ FP ELL+K+  +CLVMQ HK+GI
Sbjct  142   IIISQNRDILERFDAEDNASSLQFVENVNIQGTLFQSFPQELLKKISTDCLVMQKHKYGI  201

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +PE+F+ +  LS+FF ++TT +D+++K YVST++ KKYP+   QW PE+NAFEW  S IP
Sbjct  202   TPENFRGNPALSSFFEIITTCVDENSKTYVSTVKAKKYPITGFQWHPEKNAFEWGSSAIP  261

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDAI V+   A+Y VSEAR S N P+   V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  262   HSEDAIQVTLHAASYLVSEARMSKNKPDCKKVLSNLIYNYKPTYCGYAGRGYDEVYIFT  320



>ref|XP_011082781.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Sesamum indicum]
Length=326

 Score =   373 bits (958),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/288 (61%), Positives = 221/288 (77%), Gaps = 0/288 (0%)
 Frame = -3

Query  1019  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  840
             P PDP +NYRP+IGI+SHPGDGASGR++NAT  SYIAAS VKFVES GARVIPLIYNEP 
Sbjct  39    PPPDPKVNYRPIIGILSHPGDGASGRLNNATNASYIAASYVKFVESGGARVIPLIYNEPP  98

Query  839   ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
             E L KKL LVNGV+ PGGS ++G + E ++ I+K VL KND GD FPLLAI LGF+LL +
Sbjct  99    EILHKKLKLVNGVLLPGGSTKRGVHFEIVESIFKSVLLKNDAGDRFPLLAICLGFELLAM  158

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             IV++D  ILE+F++ +  S L     LN+ GT+F+RFP  LL+K+  +CLVM++H+ GIS
Sbjct  159   IVAKDRSILEEFNSKDDPSPLHFKRHLNIHGTVFERFPPLLLKKLTVDCLVMEHHRHGIS  218

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPH  300
             PE F+ + +L +FF +LTTS  KDNK YVST+Q ++YP+ A QW PE+NAFEW   +IPH
Sbjct  219   PERFRKNKNLKSFFKILTTSTCKDNKTYVSTVQARRYPMTAFQWHPEKNAFEWGSPKIPH  278

Query  299   SEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
             SEDA+ V+Q+VAN+ V EARKS N P+  DV DNLIY Y  +Y GK G
Sbjct  279   SEDAVQVTQNVANFLVREARKSVNRPSSVDVLDNLIYKYKPTYCGKAG  326



>gb|KJB13019.1| hypothetical protein B456_002G051600 [Gossypium raimondii]
Length=379

 Score =   372 bits (956),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 223/299 (75%), Gaps = 7/299 (2%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C   DP L YRPVIGI+SHP  GASG      G SYI AS VKFVE+AG RVIPLIYNEP
Sbjct  82    CANADPKLYYRPVIGILSHPVGGASG------GRSYIVASYVKFVEAAGGRVIPLIYNEP  135

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L + L LVNGV+ PGG  + G Y +  ++I+KKV+EKND GD+FPL AI LGF+LLT
Sbjct  136   EEILFQ-LELVNGVLLPGGRSKSGLYYDIAEKIFKKVIEKNDRGDHFPLYAICLGFELLT  194

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SED  ILE+FSA N+AS+LQ VE +N+EGT+FQRFP  LL+K+G + LVMQNH WGI
Sbjct  195   MIISEDKKILERFSALNRASSLQFVENVNIEGTVFQRFPPNLLQKLGTDLLVMQNHCWGI  254

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE  Q   +LS FF +LTTS DK+NKVYVST Q  +YPV A QW PE+NAFE  LS IP
Sbjct  255   SPEKLQNTPNLSRFFKILTTSTDKNNKVYVSTAQAHRYPVTAFQWHPEKNAFESGLSMIP  314

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HS+DAI V+Q VAN+F+ EAR+S N P    VRD+LIYNY   Y GK G GF +VYIF+
Sbjct  315   HSDDAIEVTQHVANFFIREARRSLNRPAAQKVRDSLIYNYRPKYYGKAGKGFDQVYIFT  373



>ref|XP_002887751.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64010.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 232/304 (76%), Gaps = 6/304 (2%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGA--SGRIS----NATGVSYIAASNVKFVESAGARVIP  861
             C +PDP+LNY+PVIGI++HPG+G   +GR S     +T +SYIAAS VK  E+ GARVIP
Sbjct  46    CSSPDPNLNYKPVIGILTHPGEGRWDAGRHSLSYAYSTNISYIAASYVKLAETGGARVIP  105

Query  860   LIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
             LIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KVLEKND G++FP+ A+ L
Sbjct  106   LIYNEPEELLFQKLELVNGVIFTGGWAKTGLYYDIVEKIFNKVLEKNDAGEHFPVYAMCL  165

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             GF++L++I+S++  ILE+F + N AS+LQ  E +N+E T+FQRFP ELL+K+  +CLVMQ
Sbjct  166   GFEILSMIISQNRDILERFDSVNYASSLQFFENVNIEATVFQRFPPELLKKLSTDCLVMQ  225

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
             NH +GISP++FQ +  LS+FFN+LTTS DKD+K +VSTI+ K YPV A QW PE+NAFEW
Sbjct  226   NHYFGISPDNFQGNPSLSSFFNILTTSADKDSKTFVSTIRSKGYPVTAFQWHPEKNAFEW  285

Query  320   ALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVE  141
               SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  GSG  E
Sbjct  286   GSSEIPHSEDAIQVTQYAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKGSGDDE  345

Query  140   VYIF  129
             VYIF
Sbjct  346   VYIF  349



>gb|ERM98344.1| hypothetical protein AMTR_s00170p00050820, partial [Amborella 
trichopoda]
Length=372

 Score =   371 bits (953),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 225/289 (78%), Gaps = 0/289 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP+L Y+PVIGI++HPGDGASGR+ N + VSYIAAS VKF E+AGARVIPLIYNE 
Sbjct  84    CPAPDPALYYQPVIGILTHPGDGASGRLMNGSHVSYIAASYVKFCEAAGARVIPLIYNER  143

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L++KLNLVNG++  GG  ++G Y + ++ I+K VLE+ND GD+FPL+AI L F+L++
Sbjct  144   REVLLEKLNLVNGMLLTGGWCKRGLYYDTVEMIFKHVLERNDAGDHFPLVAICLNFELIS  203

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             IIVS+D  I E++SA +  STLQ  + + +  T+F+RF  ELL+KV  ECL+MQ+H++G+
Sbjct  204   IIVSQDRSIFERYSALDLPSTLQFKQNIELNNTVFRRFSSELLKKVSTECLIMQSHRFGV  263

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE+F+++  LSNFF +LTT  DK+ KVYVST Q  +YP+   QW PE+NAFEW L  IP
Sbjct  264   SPETFESNHALSNFFKILTTCADKNGKVYVSTTQAYRYPIFGFQWHPEKNAFEWGLPNIP  323

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
             HSEDA+ V+Q VAN+F+SEARKSSN P    V DNLIYN++ +Y GK G
Sbjct  324   HSEDAVQVTQHVANFFISEARKSSNRPPTTRVLDNLIYNHSPTYCGKAG  372



>ref|XP_002862659.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38917.1| gamma-glutamyl hydrolase 3 [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/304 (60%), Positives = 232/304 (76%), Gaps = 6/304 (2%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGA--SGRIS----NATGVSYIAASNVKFVESAGARVIP  861
             C +PDP+LNY+PVIGI++HPG+G   +GR S     +T +SYIAAS VK  E+ GARVIP
Sbjct  46    CSSPDPNLNYKPVIGILTHPGEGRWDAGRHSLSYAYSTNISYIAASYVKLAETGGARVIP  105

Query  860   LIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
             LIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KVLEKND G++FP+ A+ L
Sbjct  106   LIYNEPEELLFQKLELVNGVIFTGGWAKTGLYYDIVEKIFNKVLEKNDAGEHFPVYAMCL  165

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             GF++L++I+S++  ILE+F++ N AS+LQ  E +N+E T+FQRFP ELL+K+  +CLVMQ
Sbjct  166   GFEILSMIISQNRDILERFNSVNYASSLQFFENVNIEATVFQRFPPELLKKLSTDCLVMQ  225

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
             NH +GISP++FQ    LS+FFN+LTTS DKD+K +VSTI+ K YPV A QW PE+NAFEW
Sbjct  226   NHYFGISPDNFQGKPSLSSFFNILTTSADKDSKTFVSTIRSKGYPVTAFQWHPEKNAFEW  285

Query  320   ALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVE  141
               SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  GSG  E
Sbjct  286   GSSEIPHSEDAIQVTQYAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKGSGDDE  345

Query  140   VYIF  129
             VYIF
Sbjct  346   VYIF  349



>ref|XP_003568092.2| PREDICTED: gamma-glutamyl hydrolase 2-like [Brachypodium distachyon]
Length=352

 Score =   370 bits (949),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 230/301 (76%), Gaps = 1/301 (0%)
 Frame = -3

Query  1025  GCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
              C AP DP++  RPVIGIVSHPGDGASG+ISN T  SYIAAS VKF+ESAGARVIPLIYN
Sbjct  52    ACAAPPDPAVYDRPVIGIVSHPGDGASGKISNGTATSYIAASYVKFIESAGARVIPLIYN  111

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             EP E L++KL+LVNGV+F GGS + G Y E +K++++ V++KND G   PL A  LGF+L
Sbjct  112   EPEERLLEKLSLVNGVLFTGGSQKSGIYFETIKKVFQYVVDKNDAGVILPLFAQCLGFEL  171

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             +++IVS+DN ILE FSASNQASTLQ     ++EG++F+RF  +L++K+   CLVMQNHK+
Sbjct  172   ISMIVSKDNNILESFSASNQASTLQFPNYSSLEGSVFERFHPDLIKKLSTSCLVMQNHKY  231

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             GISP+  + +  LS+FF +LTTS D++ +VYVST+Q +KYP+   QW PE+  FEW    
Sbjct  232   GISPKRLRENGALSSFFRILTTSPDENGEVYVSTVQAQKYPITCTQWHPEKAIFEWGKPM  291

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPHSEDA+ V+Q+ ANYFVS+ARKS N P    V DNLIYNY+ ++SGK    F EVYIF
Sbjct  292   IPHSEDAVQVTQNFANYFVSQARKSPNRPPADKVLDNLIYNYSPTFSGKTSKSFDEVYIF  351

Query  128   S  126
             S
Sbjct  352   S  352



>gb|AAM65646.1| gamma glutamyl hydrolase, putative [Arabidopsis thaliana]
Length=352

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 235/310 (76%), Gaps = 7/310 (2%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGA-SGRISN------ATGVSYIAASNVKFVESAG  876
             LS  C A DP+LNY+PVIGI++HPG+G    R+ +      AT +SYIAAS VK  E+ G
Sbjct  43    LSPVCSAADPNLNYKPVIGILTHPGEGRWDARLHSLKNYAYATNISYIAASYVKLAETGG  102

Query  875   ARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPL  696
             ARVIPLIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KV+EKND G++FP+
Sbjct  103   ARVIPLIYNEPEEILFQKLELVNGVIFTGGWAKTGLYYDVVEKIFNKVMEKNDAGEHFPV  162

Query  695   LAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEE  516
              A+ LGF++L++I+S++  ILE+F++ N AS+LQ  + +N+E T+FQRFP ELL+K+  +
Sbjct  163   YAMCLGFEILSMIISQNRDILERFNSVNYASSLQFFKNVNIEATVFQRFPPELLKKLSAD  222

Query  515   CLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPER  336
             CLVMQNH +GISP++FQ +  LS+FFN++TTS DKD+K +VSTI+ K+YPV A QW PE+
Sbjct  223   CLVMQNHYFGISPDNFQGNPYLSSFFNIVTTSADKDSKTFVSTIRSKRYPVTAFQWHPEK  282

Query  335   NAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
             NAFEW  SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  G
Sbjct  283   NAFEWGSSEIPHSEDAIQVTQHAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKG  342

Query  155   SGFVEVYIFS  126
             SG  EVYIF+
Sbjct  343   SGDDEVYIFT  352



>ref|NP_177988.1| gamma-glutamyl hydrolase 3 [Arabidopsis thaliana]
 sp|Q9ZV85.1|GGH3_ARATH RecName: Full=Probable gamma-glutamyl hydrolase 3; Short=AtGGH3; 
AltName: Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X 
carboxypeptidase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK63854.1|AF389281_1 At1g78670/F9K20_29 [Arabidopsis thaliana]
 gb|AAC83042.1| Similar to gb|AF067141 gamma-glutamyl hydrolase from Arabidopsis 
thaliana. ESTs gb|T46595 and gb|AI09918 come from this gene 
[Arabidopsis thaliana]
 gb|AAN18123.1| At1g78670/F9K20_29 [Arabidopsis thaliana]
 gb|AEE36136.1| gamma-glutamyl hydrolase 3 [Arabidopsis thaliana]
Length=352

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/310 (58%), Positives = 235/310 (76%), Gaps = 7/310 (2%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGA-SGRISN------ATGVSYIAASNVKFVESAG  876
             LS  C A DP+LNY+PVIGI++HPG+G    R+ +      AT +SYIAAS VK  E+ G
Sbjct  43    LSPVCSAADPNLNYKPVIGILTHPGEGRWDARLHSLKNYAYATNISYIAASYVKLAETGG  102

Query  875   ARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPL  696
             ARVIPLIYNEP E L +KL LVNGV+F GG  + G Y + +++I+ KV+EKND G++FP+
Sbjct  103   ARVIPLIYNEPEEILFQKLELVNGVIFTGGWAKTGLYYDVVEKIFNKVMEKNDAGEHFPV  162

Query  695   LAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEE  516
              A+ LGF++L++I+S++  ILE+F++ N AS+LQ  + +N+E T+FQRFP ELL+K+  +
Sbjct  163   YAMCLGFEILSMIISQNRDILERFNSVNYASSLQFFKNVNIEATVFQRFPPELLKKLSAD  222

Query  515   CLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPER  336
             CLVMQNH +GISP++FQ +  LS+FFN++TTS DKD+K +VSTI+ K+YPV A QW PE+
Sbjct  223   CLVMQNHYFGISPDNFQGNPYLSSFFNIVTTSADKDSKTFVSTIRSKRYPVTAFQWHPEK  282

Query  335   NAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
             NAFEW  SEIPHSEDAI V+Q  ANY VSEARKS N P+   V  NLIYNY  +YSG  G
Sbjct  283   NAFEWGSSEIPHSEDAIQVTQHAANYLVSEARKSMNRPSSEKVLSNLIYNYKPTYSGYKG  342

Query  155   SGFVEVYIFS  126
             SG  EVYIF+
Sbjct  343   SGDDEVYIFT  352



>ref|XP_009406768.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 226/320 (71%), Gaps = 21/320 (7%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP+ DPSL Y PVIGIV+HPGDGASGR+SN T  S I AS VKFVESAGARVIPLIYNEP
Sbjct  57    CPSTDPSLYYLPVIGIVTHPGDGASGRLSNVTSASNIPASYVKFVESAGARVIPLIYNEP  116

Query  842   TETLI---------------------KKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLE  726
              ETL+                     +KL+LVNGV+F GG  +KG Y E + ++++  LE
Sbjct  117   EETLLDVGPFLLSFLLPNSVSQSKKLRKLSLVNGVLFTGGWAKKGLYFETITKLFQVTLE  176

Query  725   KNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFP  546
             +ND GD+FPL AI LGF+L+++I+S D  I E+F   NQASTL   +   ++G++F+RFP
Sbjct  177   RNDAGDHFPLFAICLGFELVSMIISNDCDICERFKGENQASTLYFPDYAEIKGSVFERFP  236

Query  545   YELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYP  366
              ELL K+  ECL MQNHK+G+SP+  Q +  LS+FF +LTTS D++ K YVST Q   YP
Sbjct  237   LELLWKLSTECLAMQNHKYGLSPKRLQDNVALSSFFRILTTSKDENGKDYVSTAQAYNYP  296

Query  365   VVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYN  186
             V   QW PE+NAFEW LS IPHSEDA+ V+Q VANY +SEARKSSN P    V DNLIYN
Sbjct  297   VTGFQWHPEKNAFEWGLSMIPHSEDAVRVTQHVANYLISEARKSSNRPPTEKVLDNLIYN  356

Query  185   YNTSYSGKDGSGFVEVYIFS  126
             Y+ +Y GK G G+ EVYIFS
Sbjct  357   YSPTYCGKAGRGYDEVYIFS  376



>ref|XP_006593481.1| PREDICTED: gamma-glutamyl hydrolase isoform X1 [Glycine max]
Length=342

 Score =   367 bits (941),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 225/302 (75%), Gaps = 1/302 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DPSLNY+PVIGI++HPGDGASGR+SNATGVSYIAAS VKFVES GARVIPLIY
Sbjct  40    SVSCTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIY  99

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NE  E L KKL+LVNGV+F GG    G YL+ L   ++K LEKND GD+FP++A NLG  
Sbjct  100   NESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGTFFQKALEKNDAGDHFPVIAFNLGGN  159

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             L+  IVSE   ILE F+AS+  S+L + +  N +G+LFQRFP +LL ++  +CLV+ NH+
Sbjct  160   LVIRIVSEQTDILEPFTASSLPSSLVLWKEANAKGSLFQRFPSDLLTQLKTDCLVLHNHR  219

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             + ISP   Q +  LS+FF +L TS D+D K +VST +G+KYPV    W PE+NAFEWA S
Sbjct  220   YAISPRKLQYNTKLSDFFEILATSEDRDGKTFVSTARGRKYPVTVNLWQPEKNAFEWATS  279

Query  311   -EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
              + PH+EDAI V+QS AN+F+SEARKS+N P+   VRDNLIYNY  ++ G  G G+ +VY
Sbjct  280   LKAPHTEDAIRVTQSTANFFISEARKSTNTPDAQKVRDNLIYNYKPTFGGTAGKGYDQVY  339

Query  134   IF  129
             +F
Sbjct  340   LF  341



>ref|NP_001235549.1| gamma-glutamyl hydrolase precursor [Glycine max]
 sp|P93164.1|GGH_SOYBN RecName: Full=Gamma-glutamyl hydrolase; AltName: Full=Conjugase; 
AltName: Full=GH; AltName: Full=Gamma-Glu-X carboxypeptidase; 
Flags: Precursor [Glycine max]
 gb|AAB26960.1| gamma glutamyl hydrolase [Glycine max]
Length=342

 Score =   366 bits (940),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 177/299 (59%), Positives = 224/299 (75%), Gaps = 1/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C A DPSLNY+PVIGI++HPGDGASGR+SNATGVSYIAAS VKFVES GARVIPLIYNE 
Sbjct  43    CTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIYNES  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L KKL+LVNGV+F GG    G YL+ L  I+KK LE+ND GD+FP++A NLG  L+ 
Sbjct  103   PENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLVI  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
              IVSE   ILE F+AS+  S+L +    N +G+LFQRFP +LL ++  +CLV+ NH++ I
Sbjct  163   RIVSEQTDILEPFTASSLPSSLVLWNEANAKGSLFQRFPSDLLTQLKTDCLVLHNHRYAI  222

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EI  306
             SP   Q +  LS+FF +L TS D+D K +VST +G+KYPV    W PE+NAFEWA S + 
Sbjct  223   SPRKLQYNTKLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNLWQPEKNAFEWATSLKA  282

Query  305   PHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             PH+EDAI V+QS AN+F+SEARKS+N P+   VRD+LIYNY  ++ G  G G+ +VY+F
Sbjct  283   PHTEDAIRVTQSTANFFISEARKSTNTPDAQKVRDSLIYNYKPTFGGTAGKGYDQVYLF  341



>ref|XP_009406769.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 227/323 (70%), Gaps = 21/323 (7%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             +  CP+ DPSL Y PVIGIV+HPGDGASGR+SN T  S I AS VKFVESAGARVIPLIY
Sbjct  54    ASSCPSTDPSLYYLPVIGIVTHPGDGASGRLSNVTSASNIPASYVKFVESAGARVIPLIY  113

Query  851   NEPTETLI---------------------KKLNLVNGVVFPGGSFEKGEYLEALKEIYKK  735
             NEP ETL+                     +KL+LVNGV+F GG  +KG Y E + ++++ 
Sbjct  114   NEPEETLLDVGPFLLSFLLPNSVSQSKKLRKLSLVNGVLFTGGWAKKGLYFETITKLFQV  173

Query  734   VLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQ  555
              LE+ND GD+FPL AI LGF+L+++I+S D  I E+F   NQASTL   +   ++G++F+
Sbjct  174   TLERNDAGDHFPLFAICLGFELVSMIISNDCDICERFKGENQASTLYFPDYAEIKGSVFE  233

Query  554   RFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGK  375
             RFP ELL K+  ECL MQNHK+G+SP+  Q +  LS+FF +LTTS D++ + YVST Q  
Sbjct  234   RFPLELLWKLSTECLAMQNHKYGLSPKRLQDNVALSSFFRILTTSKDENVQDYVSTAQAY  293

Query  374   KYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNL  195
              YPV   QW PE+NAFEW LS IPHSEDA+ V+Q VANY +SEARKSSN P    V DNL
Sbjct  294   NYPVTGFQWHPEKNAFEWGLSMIPHSEDAVRVTQHVANYLISEARKSSNRPPTEKVLDNL  353

Query  194   IYNYNTSYSGKDGSGFVEVYIFS  126
             IYNY+ +Y GK G G+ EVYIFS
Sbjct  354   IYNYSPTYCGKAGRGYDEVYIFS  376



>ref|XP_002441386.1| hypothetical protein SORBIDRAFT_09g025690 [Sorghum bicolor]
 gb|EES19816.1| hypothetical protein SORBIDRAFT_09g025690 [Sorghum bicolor]
Length=342

 Score =   364 bits (935),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/300 (58%), Positives = 224/300 (75%), Gaps = 1/300 (0%)
 Frame = -3

Query  1025  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  846
              C  PDP+L  RPVIGIVSHPGDGA GRISN T  SYI AS VKFVE+AGARVIPL+YNE
Sbjct  44    ACAPPDPALYDRPVIGIVSHPGDGAGGRISNTTATSYIGASYVKFVEAAGARVIPLVYNE  103

Query  845   PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  666
             P E L++KL+L+NGV+F GGS ++G Y E +K++++ VL+KND G+ FPL A  LGF+L+
Sbjct  104   PEERLLEKLSLLNGVLFTGGSEKQGVYFETIKKVFQYVLDKNDAGEPFPLFAQCLGFELI  163

Query  665   TIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWG  486
             ++IVS+DN ILE F A NQASTLQ      +EG++FQRF   L++KV   CLVMQNH++G
Sbjct  164   SMIVSKDNNILETFDAQNQASTLQ-FPSYALEGSVFQRFDPALIKKVSTSCLVMQNHRYG  222

Query  485   ISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEI  306
             ISP  ++ +  LS+FF +LTTS D++ KVYVST+Q   YP+ + QW PE+  FEW    I
Sbjct  223   ISPRRYRENDALSSFFKILTTSPDENGKVYVSTVQAYNYPITSTQWHPEKAIFEWRKPMI  282

Query  305   PHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             PHSEDA+ V+Q  AN+F+S+ARKS N P    V DNLIYNY+ ++SGK    F EVYIF+
Sbjct  283   PHSEDAVQVTQHFANHFISQARKSPNRPPADKVLDNLIYNYSPTFSGKKSKSFEEVYIFA  342



>ref|XP_011460803.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=397

 Score =   365 bits (938),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 169/261 (65%), Positives = 209/261 (80%), Gaps = 0/261 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C   DP LNYRPVIGI+SHPGDGASGR+SN TG SYIAAS VKFVESAGARVIPLIY
Sbjct  80    SPRCTPLDPKLNYRPVIGILSHPGDGASGRLSNVTGTSYIAASYVKFVESAGARVIPLIY  139

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP++ L +KLNLVNGV+F GG  + G Y +  ++I+K +LE+ND GD+FPL AI LGF+
Sbjct  140   NEPSDVLFQKLNLVNGVLFTGGWAKSGRYYDVAEKIFKMILERNDAGDHFPLYAICLGFE  199

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+S++  ILE FSA++ ASTLQ  E +N+EGT+FQRFP +LLRK+  +C+VMQNH 
Sbjct  200   LLTMIISKNKKILESFSAADMASTLQFTENMNIEGTVFQRFPPDLLRKLSTDCIVMQNHH  259

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE+ Q + DLS+FF +LTTS D+D+KVYVST+    YPV A QW PE+NAFEW L 
Sbjct  260   YGISPETLQQNPDLSSFFKILTTSTDEDDKVYVSTVHAYHYPVTAFQWHPEKNAFEWGLQ  319

Query  311   EIPHSEDAILVSQSVANYFVS  249
              IPHSEDAI V+Q +AN+ VS
Sbjct  320   MIPHSEDAIQVTQHIANFLVS  340



>gb|KHN36905.1| Gamma-glutamyl hydrolase [Glycine soja]
Length=346

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 226/306 (74%), Gaps = 5/306 (2%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGD----GASGRISNATGVSYIAASNVKFVESAGARVI  864
             S  C A DP+LNY+PVIGI++HPGD    GASGR+SNATGVSYIAAS VKFVES GARVI
Sbjct  40    SVSCTATDPNLNYKPVIGILTHPGDAPDDGASGRLSNATGVSYIAASYVKFVESGGARVI  99

Query  863   PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
             PLIYNE  E L KKL+LVNGV+F GG    G YL+ L  I+KK LEKND GD+FP++A N
Sbjct  100   PLIYNESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALEKNDAGDHFPVIAFN  159

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             LG  L+  IVSE   ILE F+AS+  S+L + +  N +G+LFQRFP +LL ++  +CLV+
Sbjct  160   LGGNLVIRIVSEQTDILEPFTASSLPSSLILWKEANAKGSLFQRFPSDLLTQLKTDCLVL  219

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
              NH++ ISP   Q +  LS+FF +L TS D+D K +VST +G+KYPV    W PE+NAFE
Sbjct  220   HNHRYAISPRKLQYNTKLSDFFEILATSEDRDGKTFVSTARGRKYPVTVNLWQPEKNAFE  279

Query  323   WALS-EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
             WA S + PH+EDAI V+QS AN+F+SEARKS+N P+   VRDNLIYNY  ++ G  G G+
Sbjct  280   WATSLKAPHTEDAIRVTQSTANFFISEARKSTNTPDAQKVRDNLIYNYKPTFGGTAGKGY  339

Query  146   VEVYIF  129
              +VY+F
Sbjct  340   DQVYLF  345



>ref|XP_006655488.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Oryza brachyantha]
Length=320

 Score =   360 bits (925),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 223/289 (77%), Gaps = 0/289 (0%)
 Frame = -3

Query  992  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  813
            RPVIG+VSHPGDGA GRISN T  SYIAAS VKFVESAGARV+PL+YNEP E L++KLNL
Sbjct  32   RPVIGVVSHPGDGAGGRISNGTATSYIAASYVKFVESAGARVVPLVYNEPEERLLEKLNL  91

Query  812  VNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIIL  633
            VNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF+L+++I+S+DN IL
Sbjct  92   VNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGIPFPLFAQCLGFELVSMIISKDNNIL  151

Query  632  EKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADAD  453
            E FSA NQASTLQ     ++EG++F+RF  +L++K+   CLVMQNH++GISP++ + +A 
Sbjct  152  ETFSAENQASTLQFPNYSSLEGSVFERFDPDLIKKLSTSCLVMQNHRYGISPKTLRENAA  211

Query  452  LSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQ  273
            LS+FF +LTTS D++ +VYVST+Q  KYP+   QW PE+  FE+    IPHSEDA+ V+Q
Sbjct  212  LSSFFKILTTSPDENGEVYVSTVQANKYPITCTQWHPEKAIFEFGKPMIPHSEDAVQVTQ  271

Query  272  SVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            + ANYF+S+ARKS N P    V DNLIYNY+ +++GK    F EVYIFS
Sbjct  272  NFANYFISQARKSPNRPPADKVLDNLIYNYSPTFTGKKSKSFDEVYIFS  320



>ref|NP_001056052.1| Os05g0517500 [Oryza sativa Japonica Group]
 gb|AAT01320.1| putative gamma-glutamyl hydrolase [Oryza sativa Japonica Group]
 dbj|BAF17966.1| Os05g0517500 [Oryza sativa Japonica Group]
 dbj|BAG89432.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79535.1| hypothetical protein OsI_20640 [Oryza sativa Indica Group]
 gb|EEE64372.1| hypothetical protein OsJ_19214 [Oryza sativa Japonica Group]
Length=337

 Score =   360 bits (925),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 227/301 (75%), Gaps = 1/301 (0%)
 Frame = -3

Query  1025  GCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
              C AP DP+   RPVIGIVSHPGDGA GR+SN T  SYIAAS VKFVESAGARV+PLIYN
Sbjct  37    ACAAPTDPAAYDRPVIGIVSHPGDGAGGRVSNGTAASYIAASYVKFVESAGARVVPLIYN  96

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             EP E L++KL+LVNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF+L
Sbjct  97    EPEERLLEKLSLVNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGIPFPLFAQCLGFEL  156

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             +++IVS+DN ILE FSA+NQASTLQ     ++EG++F+RF  +L++K+   CLVMQNHK+
Sbjct  157   VSMIVSKDNNILESFSATNQASTLQFPNYSSLEGSVFERFDPDLIKKLSTSCLVMQNHKY  216

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             GISP++ + +  LS+FF +LTTS D++ +VYVST+Q  KYP+   QW PE+  FE+    
Sbjct  217   GISPKTLRENVALSSFFKILTTSPDENGEVYVSTVQANKYPITCTQWHPEKAIFEFGKQM  276

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPHSE+A+ V+Q+ ANYF+S+ARKS N P    V DNLIYNY+ ++ GK    F  VYIF
Sbjct  277   IPHSEEAVQVTQNFANYFISQARKSQNRPPADKVLDNLIYNYSPTFIGKKSKSFDVVYIF  336

Query  128   S  126
             S
Sbjct  337   S  337



>ref|XP_006442394.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
 gb|ESR55634.1| hypothetical protein CICLE_v10020872mg [Citrus clementina]
Length=321

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 208/257 (81%), Gaps = 0/257 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50    CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KL LVNGV++ GG  + G Y E +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110   EDVLFEKLELVNGVLYTGGWAKDGLYYEIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+ +D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH +GI
Sbjct  170   MIIGKDKNILESFNAADQASTLQFIENTSIEGTVFQRFPPQLIKKLSTDCLVMQNHHYGI  229

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE+ + + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE+NAFEW  S IP
Sbjct  230   SPETLRKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPEKNAFEWGSSAIP  289

Query  302   HSEDAILVSQSVANYFV  252
             HSEDAI V+Q VANYF+
Sbjct  290   HSEDAIEVTQHVANYFI  306



>dbj|BAJ93186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   359 bits (922),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 227/303 (75%), Gaps = 1/303 (0%)
 Frame = -3

Query  1031  SGGCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             +G C AP DP++  RPVIGIV+HPGDGA+GRI+N T  SYI AS VKFVE+ GARVIPLI
Sbjct  34    AGACAAPADPAVYDRPVIGIVTHPGDGAAGRINNGTSTSYIGASYVKFVEAGGARVIPLI  93

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             YNEP E L++KL+LVNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF
Sbjct  94    YNEPDERLLQKLSLVNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGVPFPLFAQCLGF  153

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +L+++IVS+DN ILE F AS+QASTLQ     +++G++F+RF  +L+RK+   CLVMQNH
Sbjct  154   ELVSMIVSKDNNILESFHASDQASTLQFPNYSSLQGSVFERFHPDLIRKLSTSCLVMQNH  213

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
             K+GISP+  + +  LS+FF +LTTS D++ +VYVST++ +KYP+   QW PE+  FEW  
Sbjct  214   KYGISPKRLRENDALSSFFKILTTSPDENGEVYVSTVEAQKYPITCTQWHPEKAIFEWRK  273

Query  314   SEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
               IPHSEDA+ V+Q  ANYF+S+ARKS N P    V DNLIYNY  ++SGK    F  VY
Sbjct  274   PMIPHSEDAVQVTQHFANYFISQARKSPNRPPADKVLDNLIYNYIPTFSGKTSKSFELVY  333

Query  134   IFS  126
             +FS
Sbjct  334   LFS  336



>ref|XP_009106581.1| PREDICTED: probable gamma-glutamyl hydrolase 3 [Brassica rapa]
Length=343

 Score =   359 bits (921),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 228/305 (75%), Gaps = 6/305 (2%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNAT------GVSYIAASNVKFVESAGARVIP  861
             C APD +LN +P+IGI++HPG G      + +       VSYIAAS VKF E+ GARVIP
Sbjct  39    CSAPDRNLNDKPIIGILTHPGVGTFDAPRDHSLSYYEKNVSYIAASYVKFAETGGARVIP  98

Query  860   LIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
             LIYNEP E L +KL LVNGV+F GG  ++G Y + +++I+ KVLEKND G++FP+ A+ L
Sbjct  99    LIYNEPQERLFQKLELVNGVIFTGGWAKEGLYFDIVQKIFGKVLEKNDAGEHFPVYAMCL  158

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             GF++L++I+S+   ILE+F++   AS+LQ +E  N+EGTLFQRF  ELL+K+  +CLV+Q
Sbjct  159   GFEILSMIISQSRDILERFNSVYYASSLQFIENANIEGTLFQRFSPELLKKISTDCLVLQ  218

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
             NH++GISP++F A+  LS+FF++LTTS DKD K YVSTI+ K+YPV A QW PE+NAFEW
Sbjct  219   NHQFGISPDNFLANPSLSSFFSILTTSADKDGKTYVSTIRSKRYPVTAFQWHPEKNAFEW  278

Query  320   ALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVE  141
               SEIPHSEDAI V+Q  ANY VSEARKS N P+  +V  NLIYNY  +YSG  GSG  E
Sbjct  279   GSSEIPHSEDAIQVTQHAANYLVSEARKSLNRPSHEEVLSNLIYNYKLTYSGYKGSGNDE  338

Query  140   VYIFS  126
              YIF+
Sbjct  339   AYIFT  343



>gb|ACG46729.1| gamma-glutamyl hydrolase precursor [Zea mays]
Length=342

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/299 (57%), Positives = 223/299 (75%), Gaps = 1/299 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C  PDP++  RPVIGIVSHPGDGA GRISN T  SYI AS VKFVE+AGARVIPL+YNEP
Sbjct  45    CAPPDPAVYDRPVIGIVSHPGDGAGGRISNTTATSYIGASYVKFVEAAGARVIPLVYNEP  104

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L++KL+L+NGV+F GGS ++G Y + +K +++ VL+KND G+ FPL A  LGF+L++
Sbjct  105   EDRLLEKLSLLNGVLFTGGSEKEGVYFDTIKRVFQYVLDKNDAGEPFPLFAQCLGFELVS  164

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +IVS+DN ILE F A +QASTLQ      +EG++FQRF  +L++KV   CLVMQNH++GI
Sbjct  165   MIVSKDNNILEAFDALDQASTLQ-FPSYALEGSVFQRFDTDLIKKVSTNCLVMQNHRYGI  223

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SP  ++ +  LS+FF +LTTS D++ KVYVST+Q   YP+   QW PE+  FEW    IP
Sbjct  224   SPRRYRENDALSSFFKILTTSPDENGKVYVSTVQANNYPITCTQWHPEKAIFEWRKPMIP  283

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             HSEDA+ V+Q  AN+F+S+ARKS N P    V DNLIYNY+ +++GK    F EVYIFS
Sbjct  284   HSEDAVQVTQHFANHFISQARKSPNRPPADKVLDNLIYNYSPTFTGKKSKSFEEVYIFS  342



>ref|XP_004961495.1| PREDICTED: gamma-glutamyl hydrolase-like [Setaria italica]
Length=346

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 219/289 (76%), Gaps = 1/289 (0%)
 Frame = -3

Query  992  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  813
            RPVIGIVSHPGDGA GRISN T  SYI AS VKFVE+AGARVIPL+YNEP E L++KL+L
Sbjct  59   RPVIGIVSHPGDGAGGRISNGTATSYIGASYVKFVEAAGARVIPLVYNEPEERLLEKLSL  118

Query  812  VNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIIL  633
            VNGV+F GGS ++G Y E +K+ ++  L++ND G+ FP+ A  LGF+L+++IVS+DN IL
Sbjct  119  VNGVLFTGGSEKQGVYFETIKKSFQYALDRNDAGEPFPVFAQCLGFELVSMIVSKDNNIL  178

Query  632  EKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADAD  453
            E F A NQASTLQ     + EGT+FQRF  +L++KV   CLVMQNH++GISP+ F+ + +
Sbjct  179  EMFDAQNQASTLQF-PSYSFEGTVFQRFDSDLIKKVSTSCLVMQNHRYGISPKRFRENGE  237

Query  452  LSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQ  273
            LS+FF +LTTS D++ KVYVST+Q  KYP+   QW PE+  FEW    IPHSE+A+ V+Q
Sbjct  238  LSSFFRILTTSPDENGKVYVSTVQANKYPITCTQWHPEKAIFEWRKPMIPHSEEAVQVTQ  297

Query  272  SVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
              AN+F+S+ARKS N P    V DNLIYNY+ ++SGK    F EVYIFS
Sbjct  298  HFANHFISQARKSPNRPPADKVLDNLIYNYSPTFSGKTSKSFEEVYIFS  346



>gb|AAC33745.1| gamma-glutamyl hydrolase [Arabidopsis thaliana]
Length=326

 Score =   352 bits (903),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/281 (60%), Positives = 211/281 (75%), Gaps = 0/281 (0%)
 Frame = -3

Query  968  HPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPG  789
            HPG+GASGR+SNA     IAAS VK  ES GARVIPLI+NEP E L +KL LVNGV+  G
Sbjct  40   HPGNGASGRLSNAIDAPSIAASYVKLAESGGARVIPLIFNEPGEILFQKLELVNGVILTG  99

Query  788  GSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQ  609
            G  ++G Y E +K+I  KVLE+ND G++FP+ AI LGF+LLT+I+S++  I EK  A N 
Sbjct  100  GWAKEGLYFEIVKKILNKVLERNDAGEHFPIYAICLGFELLTMIISQNRDIFEKMDARNS  159

Query  608  ASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVL  429
            AS+LQ VE +N++GT+FQRFP ELL+K+G +CLVMQNH++GISP+SF+ +  LSNFF ++
Sbjct  160  ASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNHRFGISPQSFEGNIALSNFFKIV  219

Query  428  TTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVS  249
            TT +D + KVYVST+Q  KYPV   QW PE+NAFEW  S+IPHSEDAI V+Q  AN+ VS
Sbjct  220  TTCVDDNGKVYVSTVQSTKYPVTGFQWHPEKNAFEWGSSKIPHSEDAIQVTQHAANHLVS  279

Query  248  EARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            EARKS N P    V  NLIYNY  +Y G  G G+ EVYIF+
Sbjct  280  EARKSLNRPESKKVLSNLIYNYKPTYCGYAGIGYDEVYIFT  320



>ref|XP_010324181.1| PREDICTED: gamma-glutamylhydrolase 3 isoform X1 [Solanum lycopersicum]
Length=307

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 215/300 (72%), Gaps = 30/300 (10%)
 Frame = -3

Query  1028  GGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYN  849
              GCP PD +LNYRPVIGI+SHPGDG SGRI+N+TGVSYIAAS VK VES GARVIPL+++
Sbjct  30    AGCPLPDHNLNYRPVIGIISHPGDGDSGRINNSTGVSYIAASYVKLVESGGARVIPLLFD  89

Query  848   EPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
             +  + L +KLNLVNGV+FPGG  +KG Y E +K I+                        
Sbjct  90    DSPQLLNQKLNLVNGVIFPGGWAKKGHYFETIKAIFG-----------------------  126

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
                    DN ILEKFS SNQA+ L  VE +N+E T+F RFP  L++K+ +ECLV+Q+HK+
Sbjct  127   -------DNNILEKFSVSNQATKLHFVETVNIEDTIFGRFPPTLVKKLSKECLVLQSHKY  179

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
             G+SPE FQA+ DLS+FF +LTTS D  NKVYVST++ + YP+ A+QW PE++AFEW  S 
Sbjct  180   GLSPEKFQANDDLSSFFIMLTTSTDTRNKVYVSTLKAENYPITALQWHPEKSAFEWGSSA  239

Query  308   IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             IPHSEDA+ V+Q VANYFVSEARKSSN P    V DNLIYNY  +YSGK G G+ EVY+F
Sbjct  240   IPHSEDAVQVTQLVANYFVSEARKSSNKPEAQKVLDNLIYNYEPTYSGKIGIGYDEVYVF  299



>gb|EYU26311.1| hypothetical protein MIMGU_mgv1a022410mg [Erythranthe guttata]
Length=393

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 220/298 (74%), Gaps = 3/298 (1%)
 Frame = -3

Query  1019  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  840
             P P P L + PVIGI+SHPG+G SG  + AT  SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  99    PRPIPKLKFTPVIGILSHPGNGGSGSSNKATKASYIAASYVKFVESAGARVIPLIYNEPL  158

Query  839   ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
             + + +KLNLVNGV+F GG+ + G Y + +K I+K VL +ND G+ FPLLAI LGF+L+T+
Sbjct  159   KVINEKLNLVNGVIFTGGTAKSGVYFDVVKSIFKSVLRRNDAGEQFPLLAICLGFELITM  218

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             IVSE   ILE F A N ASTL+++  ++V+ TLFQ FP +LL+K+ +E LVMQNH++GIS
Sbjct  219   IVSEKKNILETFDAKNHASTLKIMGNIDVKETLFQSFPPDLLKKLSKERLVMQNHRYGIS  278

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPH  300
             P+ F  +  L  FFN+LT + D+  ++YVST+Q  KYPV  VQW PE+NA++ +LS  P 
Sbjct  279   PKKFVKNDKLRGFFNILTITEDRKKQLYVSTVQAHKYPVTGVQWHPEKNAYDQSLSATPR  338

Query  299   SEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
             S+DA+ V++ VAN+FV EAR S N P+   V DNLIYNY+ +Y GK G    EVYIFS
Sbjct  339   SKDAVKVTKYVANFFVREARMSKNRPSTRKVLDNLIYNYSPTYCGKAGK---EVYIFS  393



>gb|AES66560.2| gamma-glutamylhydrolase [Medicago truncatula]
Length=311

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/301 (57%), Positives = 210/301 (70%), Gaps = 29/301 (10%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  CPAPD SL Y+PVIGI+SHPGDGASGR+SNAT  SY+AAS VKFVE+ GARV+PLIY
Sbjct  39    SVNCPAPDSSLYYQPVIGILSHPGDGASGRLSNATDASYLAASYVKFVEAGGARVVPLIY  98

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
              EP E L+                             KKVLEKND GD FPL A  LGF+
Sbjct  99    TEPWEILL-----------------------------KKVLEKNDAGDYFPLYATCLGFE  129

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             L+T+IVSEDN ILE F+A NQAS+LQ VE +N++ ++FQRFP +LL+K+  +C+VMQNH+
Sbjct  130   LITMIVSEDNDILEDFAAENQASSLQFVENVNIKESVFQRFPPDLLKKLSTDCIVMQNHQ  189

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISP     +  LS+FF +LTTS D+D+KVYVST++ + YPV   QW PE+NAFEW   
Sbjct  190   YGISPVKLLGNQKLSSFFEILTTSNDQDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGSP  249

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPH+EDAI  +Q  ANY VSEARKS N P   ++ DNLIYNY  +Y G  G GF EVYI
Sbjct  250   SIPHTEDAIRTTQYAANYLVSEARKSLNRPVAQELLDNLIYNYRPTYCGYAGKGFDEVYI  309

Query  131   F  129
             F
Sbjct  310   F  310



>ref|XP_006302530.1| hypothetical protein CARUB_v10020631mg [Capsella rubella]
 gb|EOA35428.1| hypothetical protein CARUB_v10020631mg [Capsella rubella]
Length=302

 Score =   345 bits (884),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 205/257 (80%), Gaps = 0/257 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C APDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  45    CSAPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  104

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+F GG  +K EY E +K+I+ K LE+ND G++FP+  I LGF+L++
Sbjct  105   EELLFQKLELVNGVIFTGGWAKKYEYFETVKKIFNKALERNDAGEHFPVYGICLGFELMS  164

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             II+S++  ILE+F A + AS+LQ V+ +N++GTLFQRFP +LL+K+  +CLVMQ HK+GI
Sbjct  165   IIISQNRDILERFDAEDNASSLQFVDNVNLDGTLFQRFPPQLLKKLSTDCLVMQKHKYGI  224

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             +P +FQ +  LS+FF +LTT +D+++K YVST++ KKYP+   QW PE+NAFEW  SEIP
Sbjct  225   TPANFQGNPALSSFFEILTTCIDENSKTYVSTVKAKKYPITGFQWHPEKNAFEWGSSEIP  284

Query  302   HSEDAILVSQSVANYFV  252
             HSEDAI V+Q  A+Y V
Sbjct  285   HSEDAIQVTQHAASYLV  301



>ref|XP_002441385.1| hypothetical protein SORBIDRAFT_09g025680 [Sorghum bicolor]
 gb|EES19815.1| hypothetical protein SORBIDRAFT_09g025680 [Sorghum bicolor]
Length=344

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/289 (59%), Positives = 214/289 (74%), Gaps = 3/289 (1%)
 Frame = -3

Query  992  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  813
            RPVIGIVSHPGDGA GRISN T  SYIAAS VKFVE+ GARVIP+IYNEP E L++KL+L
Sbjct  59   RPVIGIVSHPGDGAGGRISNTTATSYIAASYVKFVEAGGARVIPIIYNEPEEQLLEKLSL  118

Query  812  VNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIIL  633
            VNGV+F GGS ++G Y E +K++++ VL+KND G+ FPL A  LGF+L+++IVS+DN IL
Sbjct  119  VNGVLFTGGSAKQGLYFETIKKVFQYVLDKNDAGEQFPLFAQCLGFELVSMIVSKDNNIL  178

Query  632  EKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADAD  453
            EKF A NQASTLQ     + EG++FQRF  +L++KV   CLVMQ H++GISP   Q    
Sbjct  179  EKFDALNQASTLQ-FPSYDFEGSVFQRFDPDLIKKVSTSCLVMQQHRYGISPRRLQEKDA  237

Query  452  LSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQ  273
            LS+FF +LTTS D++ KVYVST+Q  KYP+   QW PE+  FEW    IPHS+DA+ V+Q
Sbjct  238  LSSFFKILTTSPDENGKVYVSTVQAHKYPITCTQWHPEKAIFEWRNPVIPHSKDAVQVTQ  297

Query  272  SVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
              AN+F+S+ARKS N P    V D LIYNY  S +GK    F EVY+FS
Sbjct  298  HFANHFISQARKSPNRPPADKVLDYLIYNY--SPTGKKLKSFEEVYVFS  344



>ref|XP_007021917.1| Gamma-glutamyl hydrolase 1 isoform 2 [Theobroma cacao]
 gb|EOY13442.1| Gamma-glutamyl hydrolase 1 isoform 2 [Theobroma cacao]
Length=358

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 210/302 (70%), Gaps = 30/302 (10%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81    ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KL LVNGV+F GG  + G Y E  ++I+K                      
Sbjct  141   NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFK----------------------  178

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
                     D  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +CLVMQNH 
Sbjct  179   --------DRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADCLVMQNHH  230

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +GISPE  + + +LS+FF +LTTS D +N+VYVST+Q   YPV A QW PE+NAFEW  +
Sbjct  231   YGISPERLRNNPNLSSFFKILTTSTDDNNEVYVSTVQAHGYPVTAFQWHPEKNAFEWGST  290

Query  311   EIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYI  132
              IPHSEDAI V+Q VAN+ +SEARKS N P    V DNLIYNY+ +Y GK G GF EVYI
Sbjct  291   MIPHSEDAIQVTQHVANFLISEARKSLNRPPPRKVLDNLIYNYSPTYCGKAGKGFDEVYI  350

Query  131   FS  126
             F+
Sbjct  351   FT  352



>emb|CDX87443.1| BnaA07g34300D [Brassica napus]
Length=294

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 204/266 (77%), Gaps = 0/266 (0%)
 Frame = -3

Query  923  VSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEI  744
            VSYIAAS VKF E+ GARVIPLIYNEP E L +KL LVNGV+F GG  ++G Y + +++I
Sbjct  29   VSYIAASYVKFAETGGARVIPLIYNEPQERLFQKLELVNGVIFTGGWAKEGLYFDIVQKI  88

Query  743  YKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGT  564
            + KVLEKND G++FP+ A+ LGF++L++I+S+   ILE+F++   AS+LQ +E  N+EGT
Sbjct  89   FGKVLEKNDAGEHFPVYAMCLGFEILSMIISQSRDILERFNSVYYASSLQFIENANIEGT  148

Query  563  LFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
            LFQRF  ELL+K+  +CLV+QNH++GISPE+F A+  LS+FF++LTTS DKD K YVSTI
Sbjct  149  LFQRFSSELLKKISTDCLVLQNHQFGISPENFLANPSLSSFFSILTTSADKDGKTYVSTI  208

Query  383  QGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVR  204
              K+YPV A QW PE+NAFEW  SEIPHSEDAI V+Q  ANY  SEARKS N P+  +V 
Sbjct  209  TSKRYPVTAFQWHPEKNAFEWGSSEIPHSEDAIQVTQHAANYLASEARKSLNRPSHEEVL  268

Query  203  DNLIYNYNTSYSGKDGSGFVEVYIFS  126
             NLIYNY   YSG  GSG  E YIF+
Sbjct  269  SNLIYNYKLVYSGYKGSGNDEAYIFT  294



>ref|XP_006442406.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55646.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=328

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
              S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  78    FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  137

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             +NEP E L +KL LVNG+++PGG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  138   FNEPEEILFEKLELVNGILYPGGWAKNGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  197

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +CLVMQNH
Sbjct  198   ELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNH  257

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
              +GISPE  QA+ +L+ FF +LTTS+D+ NKVYVST+Q   YPV A QW PE
Sbjct  258   HYGISPERMQANQELAKFFKILTTSMDEYNKVYVSTVQAYNYPVTAFQWHPE  309



>ref|XP_007149561.1| hypothetical protein PHAVU_005G080600g [Phaseolus vulgaris]
 gb|ESW21555.1| hypothetical protein PHAVU_005G080600g [Phaseolus vulgaris]
Length=346

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 218/292 (75%), Gaps = 1/292 (0%)
 Frame = -3

Query  1001  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
             LN RPVIGI+SHPGDG+SGR+SN + VSYIAAS VKFVES GARVIPL+YNE  + L KK
Sbjct  54    LNQRPVIGILSHPGDGSSGRLSNVSDVSYIAASYVKFVESGGARVIPLLYNESPQNLNKK  113

Query  821   LNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDN  642
             L+LVNGV+F GG    G YL+ L+ ++KK LE+ND GD+FP+L +NLG  LL  IV++  
Sbjct  114   LDLVNGVLFTGGWATSGPYLQTLQYVFKKALERNDAGDHFPVLGLNLGGNLLIKIVADQG  173

Query  641   IILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQA  462
              +LE F+AS+  S LQ+    N EG+L+QRFP +LL  +  E LV+ NHK+ I+P   Q 
Sbjct  174   DVLETFNASSLLSYLQLWSSANDEGSLYQRFPSDLLSLLSIETLVLHNHKYAITPRKLQY  233

Query  461   DADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIPHSEDAI  285
             + +L NFF++L TS D+D+K++V+T +GK YPV    W PE+NAFEWA S + PH+E+A+
Sbjct  234   NRNLGNFFDILATSTDRDDKIFVTTARGKNYPVTVNLWQPEKNAFEWATSLKAPHTENAV  293

Query  284   LVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
              V+QS AN+FVSEARKSSN PN  +VRDNLIYNY  +Y G  G G+ +VY+F
Sbjct  294   RVTQSTANFFVSEARKSSNKPNAQEVRDNLIYNYQPTYGGAAGKGYDQVYLF  345



>ref|XP_006389966.1| hypothetical protein EUTSA_v10018738mg [Eutrema salsugineum]
 gb|ESQ27252.1| hypothetical protein EUTSA_v10018738mg [Eutrema salsugineum]
Length=371

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/325 (50%), Positives = 216/325 (66%), Gaps = 28/325 (9%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C +PDP+LNYRPVIGI+SHPGDGASGR++N T  +YIAAS VKF E+ GARVIPLIYNEP
Sbjct  43    CSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYIAASYVKFAEAGGARVIPLIYNEP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIY--------------------------  741
                L +KL LVNGV+F GG  +K +Y + +K+I+                          
Sbjct  103   ERLLFQKLELVNGVIFTGGWAKKYQYFDIVKKIFNVLFGFVLPGTFSVYNTIPIFFMLLH  162

Query  740   KKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTL  561
             +K+  +      F  +A      L  + +  D  ILE+F A + AS+LQ VE +N++GTL
Sbjct  163   RKLWREMMLESIFQYMAFASDSSLCQLSLVRD--ILERFDAEDNASSLQFVENVNIQGTL  220

Query  560   FQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQ  381
             FQRFP ELL+K+  +CLVMQ HK+GI+P +F+ +  LS+FF ++TT +D+++K YVST++
Sbjct  221   FQRFPPELLKKLSTDCLVMQKHKYGITPANFRGNPALSSFFEIITTCVDENSKTYVSTVK  280

Query  380   GKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD  201
              K+YP+   QW PE+NAFEW  S+IPHSEDAI V+Q  A+Y VSEARKS N P    V  
Sbjct  281   AKRYPITGFQWHPEKNAFEWGSSQIPHSEDAIQVTQHAASYLVSEARKSKNRPESKKVLS  340

Query  200   NLIYNYNTSYSGKDGSGFVEVYIFS  126
             NLIYNY  +Y G  G G+ EVY+F+
Sbjct  341   NLIYNYKPTYCGYAGRGYDEVYLFT  365



>ref|XP_011654039.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Cucumis sativus]
 gb|KGN55059.1| hypothetical protein Csa_4G627100 [Cucumis sativus]
Length=355

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 214/298 (72%), Gaps = 0/298 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C   +P L+YRPVIGI+SHPGDGASGR +NA+  SYI AS VKF+ESAGARVIPLIYN+P
Sbjct  57    CTKVNPLLHYRPVIGILSHPGDGASGRHTNASNASYIPASYVKFIESAGARVIPLIYNDP  116

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +K+ LVNGV+F GG    G Y    ++I+K++L +N+ GD+ PL  I+LGFQ+++
Sbjct  117   PEVLEEKMGLVNGVIFTGGRVRDGLYYSVAEKIFKQILSRNEDGDHVPLYGISLGFQIIS  176

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
              +VS+   I+  F+AS   S L+  +  N+ GT+F+R P  L  +  E+C+  ++H +GI
Sbjct  177   AMVSQRYGIIVPFNASRFPSALKFNDFANIRGTVFERVPLSLRIRATEDCITWEDHGYGI  236

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE+F+ D  LS+FF +LTTS+DKDNKVYVST   + YP+   QW PE+N++EW +S IP
Sbjct  237   SPETFEQDERLSDFFQILTTSVDKDNKVYVSTANARNYPITIFQWNPEKNSYEWGISSIP  296

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             H+E AI ++  +A++ VSEAR+S+N P +  V + LIYNY   Y+GK G G+ +VY+F
Sbjct  297   HTEYAIELTHHIAHHLVSEARRSTNQPPKEKVLEKLIYNYTPIYNGKAGKGYDQVYLF  354



>gb|EYU26304.1| hypothetical protein MIMGU_mgv1a019206mg, partial [Erythranthe 
guttata]
Length=330

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 190/256 (74%), Gaps = 3/256 (1%)
 Frame = -3

Query  1019  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  840
             P  +P L   PVIGI+SHPGDG SG+ +NA   SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  78    PRANPELKLGPVIGILSHPGDGNSGKFNNAPSASYIAASYVKFVESAGARVIPLIYNEPL  137

Query  839   ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
             + + +KLNLVNGV+F GGS ++  Y   +K I++ V   ND G +FPLLAI LGF+LLT+
Sbjct  138   KVINEKLNLVNGVIFTGGSSKRTSYFNVVKSIFENVRRMNDAGHHFPLLAICLGFELLTM  197

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             +VSE   ILEKF A NQA+TL   + ++V G LFQRFP  L  K+  +CLVMQNH +GIS
Sbjct  198   VVSEKKNILEKFDALNQATTL---DNIDVNGNLFQRFPEVLRNKLSTKCLVMQNHSYGIS  254

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPH  300
             P  F+ D  L +FF +L TS DK  K YVST+Q +KYPV AVQW PE+NAFEW LSEIPH
Sbjct  255   PAKFRRDKRLDSFFKILATSRDKKGKDYVSTVQARKYPVTAVQWHPEKNAFEWGLSEIPH  314

Query  299   SEDAILVSQSVANYFV  252
             SEDA+ V+Q VAN+FV
Sbjct  315   SEDAVQVTQHVANFFV  330



>gb|ABK22567.1| unknown [Picea sitchensis]
Length=334

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 218/320 (68%), Gaps = 7/320 (2%)
 Frame = -3

Query  1064  FSYLLNTNWKLSGGCPAPDP----SLN---YRPVIGIVSHPGDGASGRISNATGVSYIAA  906
             F ++LN    L    P+ D     +LN   YRP+IGIV+HPGDGA G++S A   SYIAA
Sbjct  15    FIHVLNAQQSLRLRLPSEDAKAEKTLNSEFYRPLIGIVTHPGDGAHGKLSTAPNASYIAA  74

Query  905   SNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLE  726
             S VKFVES GARV+P IYNEP E L +K   VNG++F GGS + G Y + ++ ++++ LE
Sbjct  75    SYVKFVESGGARVVPFIYNEPPEVLEQKFRAVNGLLFTGGSAKYGPYHQTVENLFQRALE  134

Query  725   KNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFP  546
             +ND G+ FP+ A+ LGF++L++IVS+D  ILE+F A+N  STL          ++F+ F 
Sbjct  135   ENDNGEYFPVYAVCLGFEILSMIVSKDLNILERFDAANHPSTLFFESDAAKNTSIFKWFQ  194

Query  545   YELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYP  366
               +L K+  E L+ QNH +GISPE   A++ LS+FF +LTTS DK+NK YVSTI+  KYP
Sbjct  195   PHILSKMSSEPLLFQNHMFGISPERMSANSGLSSFFKILTTSCDKNNKTYVSTIEAYKYP  254

Query  365   VVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYN  186
             V AVQW PE+N FEW +  IPHS DAI V+QSVAN+ +SEARKSS+        + LIYN
Sbjct  255   VTAVQWHPEKNTFEWEIPTIPHSADAIQVTQSVANFVISEARKSSHRATFQQEEEYLIYN  314

Query  185   YNTSYSGKDGSGFVEVYIFS  126
             Y  +YSGK G  F +VY+F+
Sbjct  315   YFPAYSGKVGGSFDQVYLFT  334



>ref|XP_006370106.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
 gb|ERP66675.1| hypothetical protein POPTR_0001s39540g [Populus trichocarpa]
Length=322

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 186/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPD +LNYRPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGAR+IPLIYNEP
Sbjct  87    CPAPDTNLNYRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARIIPLIYNEP  146

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KLNLVNGV+F GG  + G Y +  K I+K+VL +ND G +FP+ AI LGF++LT
Sbjct  147   REILFEKLNLVNGVLFTGGWAKTGLYFDTAKAIFKEVLARNDAGFHFPVYAICLGFEILT  206

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+SEDN ILE ++A++QASTLQ +E +++EGT+FQRFP  LL+K+  +CLVMQNH +GI
Sbjct  207   MIISEDNQILETYNATDQASTLQFMENISIEGTVFQRFPPVLLKKLSTDCLVMQNHHYGI  266

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             SP+ FQ +  LS+FF +LT S D+DN+VYVST+Q + YPV A QW PE
Sbjct  267   SPQRFQGNEHLSSFFEILTNSADEDNQVYVSTVQARNYPVTAFQWHPE  314



>dbj|BAJ98663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 200/261 (77%), Gaps = 1/261 (0%)
 Frame = -3

Query  1031  SGGCPAP-DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             +G C AP DP++  RPVIGIV+HPGDGA+GRI+N T  SYI AS VKFVE+ GARVIPLI
Sbjct  34    AGACAAPADPAVYDRPVIGIVTHPGDGAAGRINNGTSTSYIGASYVKFVEAGGARVIPLI  93

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             YNEP E L++KL+LVNGV+F GGS + G Y E +K++++ VL+KND G  FPL A  LGF
Sbjct  94    YNEPDERLLQKLSLVNGVLFTGGSVKSGPYFETIKKVFQYVLDKNDAGVPFPLFAQCLGF  153

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +L+++IVS+DN ILE F AS+QASTLQ     +++G++F+RF  +L+RK+   CLVMQNH
Sbjct  154   ELVSMIVSKDNNILESFHASDQASTLQFPNYSSLQGSVFERFHPDLIRKLSTSCLVMQNH  213

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
             K+GISP+  + +  LS+FF +LTTS D++ +VYVST++ +KYP+   QW PE+  FEW  
Sbjct  214   KYGISPKRLRENDALSSFFKILTTSPDENGEVYVSTVEAQKYPITCTQWHPEKAIFEWRK  273

Query  314   SEIPHSEDAILVSQSVANYFV  252
               IPHSEDA+ V+Q  ANYF+
Sbjct  274   PMIPHSEDAVQVTQHFANYFI  294



>gb|EYU26310.1| hypothetical protein MIMGU_mgv1a022815mg [Erythranthe guttata]
Length=333

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/288 (57%), Positives = 202/288 (70%), Gaps = 11/288 (4%)
 Frame = -3

Query  989  PVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLV  810
            PVIGI+SHPGDG SG+ +NA   SYIAAS VKFVESAGARVIPLIYNEP+E   +KLNLV
Sbjct  57   PVIGILSHPGDGNSGKFNNAPSASYIAASYVKFVESAGARVIPLIYNEPSELRKEKLNLV  116

Query  809  NGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILE  630
            NGV+F GG  +K  Y + ++ I++ VL KN+ G++FPLLAI LGF+LL ++VSE+  ILE
Sbjct  117  NGVIFTGGRSKKTSYFDVVESIFEYVLRKNNAGNHFPLLAICLGFELLAMVVSENKNILE  176

Query  629  KFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADL  450
            KF A NQASTL+  + +N+ GTLFQ FP +LL K+  +CL  QNH +GISPE F+    L
Sbjct  177  KFDAKNQASTLKFTKNINLNGTLFQSFPPDLLEKLSTKCLAKQNHSYGISPEKFRKTKSL  236

Query  449  SNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQS  270
              FF +LTTS DK NK YVST+Q  KYPV AVQW PE+ A++  LS        + VS+ 
Sbjct  237  RRFFKILTTSADKKNKDYVSTVQAHKYPVTAVQWHPEKIAYDSGLS--------VQVSKQ  288

Query  269  VANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            VAN+FV EAR S N P+   V+ NLI N   +  G  G    EVYIFS
Sbjct  289  VANFFVREARMSKNRPSSRKVQANLIRNCRHTIRGNAGK---EVYIFS  333



>ref|XP_006494682.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494684.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X1 [Citrus 
sinensis]
Length=278

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50    CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110   EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH +GI
Sbjct  170   MIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHYGI  229

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             SPE+ Q + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE
Sbjct  230   SPETLQKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPE  277



>gb|KDO42395.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=278

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50    CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110   EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH +GI
Sbjct  170   MIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHYGI  229

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             SPE+ + + DLS FF +LTTS D+DNKVYVST+Q   YPV A QW PE
Sbjct  230   SPETLRKNLDLSRFFKMLTTSADEDNKVYVSTVQAYDYPVTAFQWHPE  277



>ref|XP_010242158.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Nelumbo 
nucifera]
Length=313

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = -3

Query  1019  PAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPT  840
             P  D +L +RPVIGI+SHPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP 
Sbjct  87    PTSDAALYFRPVIGILSHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEPA  146

Query  839   ETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
             E L +KL+LVNGV+F GG  ++G Y E ++ I+K VLEKND GD+FPL AI LGF+LL++
Sbjct  147   EILAEKLSLVNGVLFTGGKTKRGLYYEIVERIFKHVLEKNDSGDHFPLFAICLGFELLSM  206

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             I+S+D+ ILE+F+A +QASTLQ  E  N+ GT+FQRFP ELL+K+  +CLVMQ+H++G+S
Sbjct  207   IISKDDGILERFNALDQASTLQFTEKSNIGGTVFQRFPPELLKKLTTDCLVMQHHQYGVS  266

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             PE FQ +  LS+FF +LTTS D+D KVYVST+Q   YPV A QW PE
Sbjct  267   PERFQENPLLSSFFRILTTSKDEDGKVYVSTVQAYNYPVSAFQWHPE  313



>ref|XP_002441384.1| hypothetical protein SORBIDRAFT_09g025670 [Sorghum bicolor]
 gb|EES19814.1| hypothetical protein SORBIDRAFT_09g025670 [Sorghum bicolor]
Length=388

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 205/290 (71%), Gaps = 11/290 (4%)
 Frame = -3

Query  1010  DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  831
             DP++N RPVIGIV+HPGDG   R ++  G SYIAAS V+FV+SAGARVIPL+Y+EP E L
Sbjct  97    DPAVNDRPVIGIVTHPGDGTYERRTHGPG-SYIAASYVRFVQSAGARVIPLLYDEPEERL  155

Query  830   IKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
             ++KL LVNGV+F GGS + G Y E +K +++ VL++ND GD FPL A  LGF+L+++IVS
Sbjct  156   LEKLGLVNGVLFTGGSQKNGSYFETIKRVFQYVLDRNDAGDPFPLHAECLGFELISMIVS  215

Query  650   EDNIILEKFSASNQASTLQVVEGLNVEGTLFQ----------RFPYELLRKVGEECLVMQ  501
             +DN ILE F A NQ STLQ      ++G++FQ          RF  EL++K+  +CLVMQ
Sbjct  216   KDNNILESFHALNQTSTLQFPNYSFLKGSVFQSLTTEMIEIHRFNPELIKKLSTDCLVMQ  275

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
             NH +GISP+  Q +  LS+FF +LTTS D++ KVYVST+Q + YP++  QW PE+  FEW
Sbjct  276   NHGYGISPKRLQENVALSSFFKILTTSPDENGKVYVSTVQAQNYPIICTQWHPEKAIFEW  335

Query  320   ALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSY  171
                  PHSEDA+ V+Q  ANYFVS+ARKS N      V +NLI NY+  +
Sbjct  336   GEPMNPHSEDAVQVTQHFANYFVSQARKSLNRAPADKVLNNLIDNYSPRF  385



>ref|XP_006442405.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
 gb|ESR55645.1| hypothetical protein CICLE_v10020608mg [Citrus clementina]
Length=291

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
              S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  78    FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  137

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             +NEP E L +KL LVNG+++PGG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  138   FNEPEEILFEKLELVNGILYPGGWAKNGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  197

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +CLVMQNH
Sbjct  198   ELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNH  257

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKV  399
              +GISPE  QA+ +L+ FF +LTTS+D+ NKV
Sbjct  258   HYGISPERMQANQELAKFFKILTTSMDEYNKV  289



>ref|XP_006442396.1| hypothetical protein CICLE_v10021719mg [Citrus clementina]
 gb|ESR55636.1| hypothetical protein CICLE_v10021719mg [Citrus clementina]
Length=265

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
              S  CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYIAAS VKFVES GARVIPLI
Sbjct  52    FSAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIAASYVKFVESGGARVIPLI  111

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGF  675
             +NEP E L +KL LVNG+++ GG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF
Sbjct  112   FNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGF  171

Query  674   QLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +LL++IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +CLVMQNH
Sbjct  172   ELLSMIVSEDRNILETFDGANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNH  231

Query  494   KWGISPESFQADADLSNFFNVLTTSLDKDNKV  399
              +GISPE  QA+ +L+ FF +LTTS+D+ NKV
Sbjct  232   HYGISPERMQANQELAKFFKILTTSMDEYNKV  263



>ref|XP_011654410.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Cucumis sativus]
 gb|KGN55060.1| hypothetical protein Csa_4G627110 [Cucumis sativus]
Length=348

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 200/298 (67%), Gaps = 24/298 (8%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C   +PSL YRPVIGI+SHPGDGASGR SNAT  SYI AS VKFVESAGARVIPLIYN+P
Sbjct  74    CTKVNPSLYYRPVIGILSHPGDGASGRYSNATTASYIPASYVKFVESAGARVIPLIYNDP  133

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +K+ LVNGV+F GG    G Y    ++I++++L +N+ GD  PL  I+LGFQ+++
Sbjct  134   PEVLEEKMGLVNGVIFTGGRVRDGLYYSVAEKIFQQILSRNEAGDYVPLYGISLGFQIIS  193

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
              +VS+ N I+E F+A+   S L+  +  N+ GT                        +GI
Sbjct  194   AMVSQRNDIIETFNATRFPSALKFNDFANIRGT------------------------YGI  229

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             SPE+F+ D  LS+FF +LTTS+DK+NKVYVST   + YP+   QW PE+N++EW +S IP
Sbjct  230   SPETFEQDERLSDFFQILTTSVDKNNKVYVSTANARNYPITIFQWNPEKNSYEWGISTIP  289

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             H+E AI ++  VA++ VSEAR+S N P    V + LIYNY+  Y+GK G G+ +VY+F
Sbjct  290   HTEYAIELTHHVAHHLVSEARRSINQPPAEKVLEKLIYNYSPIYNGKAGKGYDQVYLF  347



>ref|XP_006301184.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella]
 gb|EOA34082.1| hypothetical protein CARUB_v10021583mg, partial [Capsella rubella]
Length=276

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 175/228 (77%), Gaps = 0/228 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C A DP+LNYRPVIGI+SHPGDGASGR++NAT  S + AS VK  E+ GARVIPLIYNEP
Sbjct  49    CSASDPNLNYRPVIGILSHPGDGASGRLNNATNASNVVASYVKLAEAGGARVIPLIYNEP  108

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNGV+  GG  ++G Y E +K+I+ KVLE+ND G++FPL AI LGF+LLT
Sbjct  109   EELLFQKLELVNGVLLTGGWAKEGLYFEIVKKIFNKVLERNDAGEHFPLYAICLGFELLT  168

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S++  I EK  A N AS+LQ +E +N++GT+F+RFP EL  K+  +CLVMQNH++GI
Sbjct  169   MIISQNRDIFEKVDARNCASSLQFIENVNIKGTVFERFPPELFNKLSTDCLVMQNHQYGI  228

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             SPESF+    LSNFFN++TT  D  NK YVST++ K+YPV   QW PE
Sbjct  229   SPESFERTIALSNFFNIVTTCTDNHNKAYVSTVKSKQYPVTGFQWHPE  276



>ref|XP_011620471.1| PREDICTED: gamma-glutamyl hydrolase 2 isoform X2 [Amborella trichopoda]
Length=331

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/298 (50%), Positives = 194/298 (65%), Gaps = 51/298 (17%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP+L Y+PVIGI++HPGDGASGR+ N + VSYIAAS VKF E+AGARVIPLIYNE 
Sbjct  84    CPAPDPALYYQPVIGILTHPGDGASGRLMNGSHVSYIAASYVKFCEAAGARVIPLIYNER  143

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L++KLNLVNG++  GG  ++G Y + ++ I+K VLE+ND GD+FPL+AI L F+L++
Sbjct  144   REVLLEKLNLVNGMLLTGGWCKRGLYYDTVEMIFKHVLERNDAGDHFPLVAICLNFELIS  203

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             IIVS+D  I E++SA +  STLQ  + + +  T+F+RF  ELL+KV  ECL+MQ+H+   
Sbjct  204   IIVSQDRSIFERYSALDLPSTLQFKQNIELNNTVFRRFSSELLKKVSTECLIMQSHR---  260

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
                                                             +NAFEW L  IP
Sbjct  261   ------------------------------------------------KNAFEWGLPNIP  272

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             HSEDA+ V+Q VAN+F+SEARKSSN P    V DNLIYN++ +Y GK G G+ EVY+F
Sbjct  273   HSEDAVQVTQHVANFFISEARKSSNRPPTTRVLDNLIYNHSPTYCGKAGKGYDEVYLF  330



>ref|XP_006494683.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006494685.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
Length=263

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50    CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110   EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH +GI
Sbjct  170   MIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHYGI  229

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
             SPE+ Q + DLS FF +LTTS D+DNK    TI
Sbjct  230   SPETLQKNLDLSRFFKMLTTSADEDNKCKPMTI  262



>gb|KDO42396.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=263

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50    CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110   EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
             +I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH +GI
Sbjct  170   MIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNHHYGI  229

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTI  384
             SPE+ + + DLS FF +LTTS D+DNK    TI
Sbjct  230   SPETLRKNLDLSRFFKMLTTSADEDNKCKPMTI  262



>ref|XP_006477850.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X3 [Citrus 
sinensis]
Length=302

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 173/226 (77%), Gaps = 0/226 (0%)
 Frame = -3

Query  1016  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
             A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75    ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  836   TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  657
              L +KL LVNGV+  GG  +KG Y + +++I+KK+LEKND G+ FPL AI LGF+L+++I
Sbjct  135   ILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKKILEKNDAGEYFPLYAICLGFELISMI  194

Query  656   VSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISP  477
             +S+D  ILE+F+ ++QASTL+ ++   +EGT+FQRF  ELL+K+  +CLVMQ H +GISP
Sbjct  195   ISKDRNILERFNGADQASTLKFIKNSKIEGTVFQRFVPELLKKLSTDCLVMQKHIYGISP  254

Query  476   ESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             E  Q + DLS FF +LTTS D  NKVYVST+Q   YP    QW PE
Sbjct  255   ERMQENLDLSKFFRILTTSEDIYNKVYVSTVQAYNYPFTGFQWHPE  300



>ref|XP_006477849.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Citrus 
sinensis]
Length=339

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 173/226 (77%), Gaps = 0/226 (0%)
 Frame = -3

Query  1016  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
             A D  LN RPVIGI+SHPGDGASGR++N+   SYIAAS VKFVESAGARVIPLIYNEP E
Sbjct  75    ATDRRLNNRPVIGILSHPGDGASGRLNNSKNASYIAASYVKFVESAGARVIPLIYNEPEE  134

Query  836   TLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  657
              L +KL LVNGV+  GG  +KG Y + +++I+KK+LEKND G+ FPL AI LGF+L+++I
Sbjct  135   ILFEKLKLVNGVLLTGGWAKKGLYFQIVEKIFKKILEKNDAGEYFPLYAICLGFELISMI  194

Query  656   VSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISP  477
             +S+D  ILE+F+ ++QASTL+ ++   +EGT+FQRF  ELL+K+  +CLVMQ H +GISP
Sbjct  195   ISKDRNILERFNGADQASTLKFIKNSKIEGTVFQRFVPELLKKLSTDCLVMQKHIYGISP  254

Query  476   ESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             E  Q + DLS FF +LTTS D  NKVYVST+Q   YP    QW PE
Sbjct  255   ERMQENLDLSKFFRILTTSEDIYNKVYVSTVQAYNYPFTGFQWHPE  300



>ref|XP_007021919.1| Gamma-glutamyl hydrolase 1 isoform 4 [Theobroma cacao]
 gb|EOY13444.1| Gamma-glutamyl hydrolase 1 isoform 4 [Theobroma cacao]
Length=291

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 168/211 (80%), Gaps = 0/211 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81    ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KL LVNGV+F GG  + G Y E  ++I+KKVLEKND  D+FPL AI LGF+
Sbjct  141   NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFKKVLEKNDARDHFPLYAICLGFE  200

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+SED  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +CLVMQNH 
Sbjct  201   LLTMIISEDRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADCLVMQNHH  260

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKV  399
             +GISPE  + + +LS+FF +LTTS D +N+ 
Sbjct  261   YGISPERLRNNPNLSSFFKILTTSTDDNNEC  291



>ref|XP_007021918.1| Gamma-glutamyl hydrolase 1 isoform 3 [Theobroma cacao]
 gb|EOY13443.1| Gamma-glutamyl hydrolase 1 isoform 3 [Theobroma cacao]
Length=292

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             +  C   DP L YRPVIGI+SHPGDGASGR++N T  SYIAAS VKFVE+AGARVIPLIY
Sbjct  81    ASSCTTLDPKLYYRPVIGILSHPGDGASGRLNNDTNASYIAASYVKFVEAAGARVIPLIY  140

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L +KL LVNGV+F GG  + G Y E  ++I+KKVLEKND  D+FPL AI LGF+
Sbjct  141   NEPEEILFEKLELVNGVLFTGGWAKAGLYYEIAQKIFKKVLEKNDARDHFPLYAICLGFE  200

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+I+SED  ILE FSA++QAS+LQ V+ +N+EGT+FQRFP +LL+K+G +CLVMQNH 
Sbjct  201   LLTMIISEDRNILESFSAADQASSLQFVKNINIEGTVFQRFPPDLLKKLGADCLVMQNHH  260

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNK  402
             +GISPE  + + +LS+FF +LTTS D +N+
Sbjct  261   YGISPERLRNNPNLSSFFKILTTSTDDNNE  290



>ref|XP_010248393.1| PREDICTED: gamma-glutamyl hydrolase 2-like isoform X2 [Nelumbo 
nucifera]
Length=292

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 177/235 (75%), Gaps = 2/235 (1%)
 Frame = -3

Query  1043  NWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVI  864
             +W+ S  C APDP+L +RPVIGI++HP  GAS    NA+  S I AS VKFVESAGARVI
Sbjct  43    SWR-SSSCQAPDPALYFRPVIGILTHPAHGASNG-PNASNASLITASYVKFVESAGARVI  100

Query  863   PLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
             PLIYNEP E L +KL+LVNGV+ PGG  + G + E +++++K  LEKND GD+FP+ AI 
Sbjct  101   PLIYNEPPEILAEKLSLVNGVLLPGGWAKTGLFYEIVEKVFKHALEKNDSGDHFPVFAIC  160

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             L F+LLT+I+S+D  ILE+F+A NQASTLQ  E   +EGT+FQRF  ELL+K+  +C+VM
Sbjct  161   LSFELLTMIISKDVNILERFNALNQASTLQFTENSIIEGTVFQRFSPELLKKLTTDCIVM  220

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPE  339
             +NH++GIS E FQ +  LS+FF +LTTS D+D KVYVST++   YPV A QW PE
Sbjct  221   ENHQYGISLERFQKNPSLSSFFRILTTSKDRDGKVYVSTVKSHNYPVSAFQWHPE  275



>ref|XP_002984712.1| hypothetical protein SELMODRAFT_423816 [Selaginella moellendorffii]
 gb|EFJ14357.1| hypothetical protein SELMODRAFT_423816 [Selaginella moellendorffii]
Length=330

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 143/306 (47%), Positives = 200/306 (65%), Gaps = 11/306 (4%)
 Frame = -3

Query  1013  PDPSLNYRPVIGIVSHPGDGASGRISNA--------TGVSYIAASNVKFVESAGARVIPL  858
             P+ S   RP+IGI++ PGDG      N         + +SYIAAS VKFVE+ GAR +PL
Sbjct  24    PEESREKRPLIGILTQPGDGDDRSYINRLEPGDPRRSNISYIAASYVKFVEAGGARAVPL  83

Query  857   IYNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
             +YNEP ETL KK +L+NG++F GGS   + G Y  A + ++K+ LE ND GD FP+    
Sbjct  84    LYNEPWETLAKKFSLINGILFAGGSASLQDGPYYRASEFLFKRALEANDKGDYFPVFGTC  143

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             LG +LL +IVS ++ IL+ ++A   A  L  V       ++F  FP ++L KV  E L M
Sbjct  144   LGLELLAVIVSGNHSILDDYNAHKAAGELNFVGDWAKGRSMFTWFPKDILDKVEHEKLAM  203

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             QNH  G+SP++++    L +FF+VLTT+ D + K+Y+STI+G+KYPV +VQW PE+NAFE
Sbjct  204   QNHVKGLSPQTWRDTQSLRDFFDVLTTTPDLNGKIYISTIEGRKYPVTSVQWHPEKNAFE  263

Query  323   WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSG-F  147
             W    IPHS DA+ ++QS A++FVSEA KSS+  +  +    LIYNY+  YSG+DG G F
Sbjct  264   WGYEGIPHSPDAVRITQSAASFFVSEALKSSHTASWEEEEQLLIYNYSPIYSGRDGKGHF  323

Query  146   VEVYIF  129
              + Y+F
Sbjct  324   DQSYVF  329



>ref|XP_001772336.1| predicted protein [Physcomitrella patens]
 gb|EDQ62807.1| predicted protein [Physcomitrella patens]
Length=304

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/298 (46%), Positives = 202/298 (68%), Gaps = 9/298 (3%)
 Frame = -3

Query  992  RPVIGIVSHPGDGASGRISNAT-----GVSYIAASNVKFVESAGARVIPLIYNEPTETLI  828
            RP+IG++S PGDG   ++++         SYIAAS VKFVE  GAR +PLI+NEP ETL 
Sbjct  7    RPLIGVLSQPGDGEEYQLTSRPLPPDYNTSYIAASYVKFVEMGGARAVPLIWNEPEETLR  66

Query  827  KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  654
            KK   +NGV+FPGG  S +   +    ++++   +E ND GD+FP+  + LGF+LL+IIV
Sbjct  67   KKFASINGVLFPGGGASLKDTPFYRVAEKLFNWAIEANDRGDHFPVYGVCLGFELLSIIV  126

Query  653  SEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPE  474
            S+++ ILE+F A N    L  V       ++FQ  P  ++ ++ ++ L MQNHKWG+SPE
Sbjct  127  SKNHYILERFEAENNPGPLLFVGDSAKHQSMFQWIPLRIIDELNDQKLAMQNHKWGLSPE  186

Query  473  SFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSE  294
             + +  +L+NFF +LT + D + K+YVST++ +KYP++ VQW PE+NA+EW +  IPHS 
Sbjct  187  KWISTPELNNFFQILTVTPDLNEKLYVSTVEARKYPILGVQWHPEKNAYEWGVDNIPHSA  246

Query  293  DAILVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTSYSGKDGSG-FVEVYIFS  126
            DAI V+QSVANY ++EARKSS+ P +  + +  LIYNY+  Y+ KDG G F + Y+F+
Sbjct  247  DAIGVTQSVANYLIAEARKSSHKPASYEEEQAFLIYNYDPVYTSKDGKGVFDQAYVFN  304



>ref|XP_002978801.1| hypothetical protein SELMODRAFT_177157 [Selaginella moellendorffii]
 gb|EFJ20248.1| hypothetical protein SELMODRAFT_177157 [Selaginella moellendorffii]
Length=330

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/306 (47%), Positives = 200/306 (65%), Gaps = 11/306 (4%)
 Frame = -3

Query  1013  PDPSLNYRPVIGIVSHPGDGASGRISNA--------TGVSYIAASNVKFVESAGARVIPL  858
             P+ S   RP+IGI++ PGDG      N         + +SYIAAS VKFVE+ GAR +PL
Sbjct  24    PEESREKRPLIGILTQPGDGDGRSYINRLEPGDPRRSNISYIAASYVKFVEAGGARAVPL  83

Query  857   IYNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
             +YNEP ETL KK +L+NG++F GGS   + G Y  A + ++K+ LE ND GD FP+    
Sbjct  84    LYNEPWETLAKKFSLINGILFAGGSASLQDGPYYRAGEFLFKRALEANDKGDYFPVFGTC  143

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             LG +LL +IVS ++ IL+ ++A   A  L  V       ++F  FP ++L KV  E L M
Sbjct  144   LGLELLAVIVSGNHSILDDYNAHKAAGELNFVGDWAKGRSMFTWFPKDILDKVEHEKLAM  203

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             QNH  G+SP++++    L +FF+VLTT+ D + K+Y+STI+G+KYPV +VQW PE+NAFE
Sbjct  204   QNHIKGLSPQAWRDTQRLRDFFDVLTTTPDLNGKIYISTIEGRKYPVTSVQWHPEKNAFE  263

Query  323   WALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSG-F  147
             W    IPHS DA+ ++QS A++FVSEA KSS+  +  +    LIYNY+  YSG+DG G F
Sbjct  264   WGYEGIPHSPDAVRITQSAASFFVSEALKSSHTASWEEEEQLLIYNYSPIYSGRDGKGHF  323

Query  146   VEVYIF  129
              + Y+F
Sbjct  324   DQSYVF  329



>ref|XP_001782403.1| predicted protein [Physcomitrella patens]
 gb|EDQ52797.1| predicted protein, partial [Physcomitrella patens]
Length=294

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/294 (45%), Positives = 193/294 (66%), Gaps = 15/294 (5%)
 Frame = -3

Query  992  RPVIGIVSHPGDGASGRISNATGV----------SYIAASNVKFVESAGARVIPLIYNEP  843
            RP+IGI+S PGDG    +++  G+          SYIAAS VKFVE  GAR +PLI+NEP
Sbjct  1    RPLIGILSQPGDGMGYSLTSTGGLEKPVPPGYSTSYIAASYVKFVEMGGARAVPLIWNEP  60

Query  842  TETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIY-KKVLEKNDGGDNFPLLAINLGFQ  672
             ETL KK + +NG++FPGG  S +   +      +  +  +E ND GD+FP+  + LGF+
Sbjct  61   EETLRKKFSAINGILFPGGGTSLKDSPFFRLCHGVVVQWAIEANDRGDHFPIYGVCLGFE  120

Query  671  LLTIIVSEDNI-ILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
            LL++IVS+ N  ILE F A N    L  V        +F+  P  ++ ++ E+ L MQNH
Sbjct  121  LLSVIVSKQNHDILEPFHAENNPGPLLFVGDSAKHEGMFKWIPLNIIDELYEQKLTMQNH  180

Query  494  KWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL  315
            KWG+SPE + +  +L++FF +LT + D + K+YVST++ ++YP++ VQW PE+NAFEW +
Sbjct  181  KWGLSPEKWISTPELNDFFQILTVTPDLNEKLYVSTVEAREYPILGVQWHPEKNAFEWGI  240

Query  314  SEIPHSEDAILVSQSVANYFVSEARKSSNVPNE-PDVRDNLIYNYNTSYSGKDG  156
              IPHS DAI ++QSVAN+ ++EARKS++ P+   + +D LIYN+   Y+GK+G
Sbjct  241  DNIPHSADAIRITQSVANFLIAEARKSTHTPSSFKEEQDFLIYNHAPVYTGKEG  294



>gb|KDO42394.1| hypothetical protein CISIN_1g039121mg, partial [Citrus sinensis]
Length=232

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDPSLNYRPVIGI+SHPGDGASGR+SNAT  SYI+AS VKF ES GARVIPLI+NEP
Sbjct  47    CPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEP  106

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L +KL LVNG+++ GG  + G Y + +++I+KK+LEKND GD+FP+ AI LGF+LL+
Sbjct  107   EEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLS  166

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             +IVSED  ILE F  +NQASTLQ V+ +N+EGTLFQRFP ELL+K+  +CLVMQNH 
Sbjct  167   MIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHH  223



>ref|XP_002862658.1| hypothetical protein ARALYDRAFT_359459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38916.1| hypothetical protein ARALYDRAFT_359459, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=210

 Score =   254 bits (649),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  737  KVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLF  558
            K LE+ND G++FP+  I LGF+L++II+S++  ILE+F A + ASTLQ V+ +N++GTLF
Sbjct  1    KALERNDAGEHFPVYGICLGFELMSIIISQNRDILERFDAEDNASTLQFVDNVNIDGTLF  60

Query  557  QRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQG  378
            QRFP ELL+K+  +CLVMQ HK+GI+P +FQ +  LS+FF +LTT +D+++K YVST++ 
Sbjct  61   QRFPPELLKKLSTDCLVMQKHKYGITPANFQGNPALSSFFEILTTCIDENSKTYVSTVKA  120

Query  377  KKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDN  198
            K+YP+   QW PE+NAFEW  S IPHSEDAI V+Q  A+Y VSEARKS N P    V  N
Sbjct  121  KRYPITGFQWHPEKNAFEWGSSAIPHSEDAIQVTQHAASYLVSEARKSLNRPPSKKVLSN  180

Query  197  LIYNYNTSYSGKDGSGFVEVYIFS  126
            LIYNY  +Y G  G G+ EVYIF+
Sbjct  181  LIYNYKPTYCGYAGRGYDEVYIFT  204



>ref|XP_010064498.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Eucalyptus grandis]
Length=220

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             +  CPAPDP LN+RPVIGI+SHPGDGASGR+SNA+  S+I AS VKFVESAGARVIPLIY
Sbjct  37    AADCPAPDPKLNFRPVIGILSHPGDGASGRLSNASDASFIPASYVKFVESAGARVIPLIY  96

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NEP E L++KLN+VNGV+F GG    G Y E ++ I+KKVL KND GD+FPL A  LGFQ
Sbjct  97    NEPQEVLLEKLNMVNGVLFTGGWASTGLYYETVEAIFKKVLAKNDAGDHFPLYATCLGFQ  156

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT+IVS+D  ILE+F+A++QASTLQ +   ++EGT+FQRFP +LL+K+  +CLVMQNH 
Sbjct  157   LLTMIVSKDKGILEEFNAAHQASTLQFMRNTDIEGTVFQRFPPDLLKKLSTDCLVMQNHH  216

Query  491   WGI  483
               I
Sbjct  217   TNI  219



>gb|ACU20290.1| unknown [Glycine max]
Length=246

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S  C A DPSLNY+PVIGI++HPGDGASGR SNATGVSYIAAS VKFVES GARVIPLIY
Sbjct  40    SVSCIATDPSLNYKPVIGILTHPGDGASGRPSNATGVSYIAASYVKFVESGGARVIPLIY  99

Query  851   NEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
             NE  E L KKL+LVNGV+F GG    G YL+ L  I+KK LEKND GD+FP++A NLG  
Sbjct  100   NESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALEKNDAGDHFPVIAFNLGGN  159

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             L+  IVSE   ILE F+AS+  S+L + +  N +G+LFQRFP +LL ++  +CLV+ NH+
Sbjct  160   LVIRIVSEQTDILEPFTASSLPSSLVLWKEANAKGSLFQRFPSDLLTQLKTDCLVLHNHR  219

Query  491   WGISPESFQADADLSNFFNVLTTSLDK  411
             + ISP   Q +  LS+FF +L TS D+
Sbjct  220   YAISPRKLQYNTKLSDFFEILATSEDR  246



>gb|AES66561.2| class I glutamine amidotransferase [Medicago truncatula]
Length=261

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 138/290 (48%), Positives = 177/290 (61%), Gaps = 51/290 (18%)
 Frame = -3

Query  1025  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  846
              CP P+P+L Y+PVIGI+SHPGDG SGR SNATG S+I AS VKFVE+AGARV+PLIYNE
Sbjct  23    SCPPPNPNLYYQPVIGILSHPGDGTSGRHSNATGASFIHASYVKFVEAAGARVVPLIYNE  82

Query  845   PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  666
             P E ++K                       + E  K  L KND GD+FPL AI LGF+L+
Sbjct  83    PEEKILK-----------------------VSE--KATLPKNDAGDHFPLYAICLGFELI  117

Query  665   TIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWG  486
             ++I+SED  ILE+F A NQASTLQ VE  ++EGT+F+RFP ELL+K+  +CLVMQNH   
Sbjct  118   SVIISEDKNILEEFKAKNQASTLQFVENASIEGTVFERFPPELLKKLSTDCLVMQNHVV-  176

Query  485   ISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEI  306
                 +      +S+FF +LTT  D+++KVYVST++ + YPV   QW PE           
Sbjct  177   ----TRHIPNKVSSFFEILTTCNDEEDKVYVSTVRSRNYPVTGFQWHPE-----------  221

Query  305   PHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
                     V + V   +  EARKS N P   ++ DNLIYN    +  K G
Sbjct  222   --------VIKKVL--YTIEARKSLNRPVAQELYDNLIYNIVQLFMQKKG  261



>gb|EMT14979.1| Gamma-glutamyl hydrolase [Aegilops tauschii]
Length=279

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 171/253 (68%), Gaps = 20/253 (8%)
 Frame = -3

Query  824  KLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            KL+LVNGV+F GGS ++G Y E +K++++ VL+KND G  FPL A  LGF+L+++IVS+D
Sbjct  27   KLSLVNGVLFTGGSVKRGPYFETIKKVFQYVLDKNDAGVPFPLFAQCLGFELVSMIVSKD  86

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK---------  492
            N ILE F AS+QASTLQ     +++G++F+RF  +L++K+   CLVMQNHK         
Sbjct  87   NNILESFHASDQASTLQFPNYSSLQGSVFERFHPDLIKKLSTSCLVMQNHKNNYLYLLVF  146

Query  491  -----------WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWA  345
                       +GISP+  + +  LS+FF +LT S D++ +VYVST++ +KYP+   QW 
Sbjct  147  PNMVYFLNWSKYGISPKRLRENDALSSFFKILTISPDENGEVYVSTVEAQKYPITCTQWH  206

Query  344  PERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSG  165
            PE+  FEW    IPHSEDA+ V+Q+ ANYF+S+ARKS N P    V DNLIYNY  ++SG
Sbjct  207  PEKAIFEWRKPMIPHSEDAVQVTQNFANYFISQARKSPNRPPADKVLDNLIYNYIPTFSG  266

Query  164  KDGSGFVEVYIFS  126
            K    F  VY+FS
Sbjct  267  KTSKSFELVYLFS  279



>gb|KDO42397.1| hypothetical protein CISIN_1g023716mg [Citrus sinensis]
Length=250

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CP PD  LNYRPVIGIV+HPGDGASGR++NAT  SYIAAS VKFVESAGARVIPLIYNEP
Sbjct  50    CPVPDSKLNYRPVIGIVTHPGDGASGRLNNATNASYIAASYVKFVESAGARVIPLIYNEP  109

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              + L +KL LVNGV++ GG  + G Y   +++++KK+LEKND GD+FPL A  LGF+LLT
Sbjct  110   EDVLFEKLELVNGVLYTGGWAKDGLYYAIVEKVFKKILEKNDAGDHFPLYAHCLGFELLT  169

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNH  495
             +I+S+D  ILE F+A++QASTLQ +E  ++EGT+FQRFP +L++K+  +CLVMQNH
Sbjct  170   MIISKDKNILESFNAADQASTLQFMENTSIEGTVFQRFPPKLIKKLSTDCLVMQNH  225



>gb|KCW67543.1| hypothetical protein EUGRSUZ_F01296 [Eucalyptus grandis]
Length=188

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -3

Query  668  LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
            L  I   D  ILE+F+A++QASTLQ +   N+EGT+FQRFP +LL+K+  +CLVMQNH +
Sbjct  8    LESISRHDKGILEEFNAAHQASTLQFMRNTNIEGTVFQRFPPDLLKKLSTDCLVMQNHHY  67

Query  488  GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
            GISPE      DL+NFF VLTTS+D DNKVYVST Q   YPV A QW PE+NAFEW LS 
Sbjct  68   GISPERLMQSTDLTNFFKVLTTSMDGDNKVYVSTAQAHSYPVTAFQWHPEKNAFEWGLSM  127

Query  308  IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            IPHS+DAI V+Q VAN+FVSEARKS+N  +   V DNLIYNY+ +Y GK G G+ EVYIF
Sbjct  128  IPHSDDAIQVTQHVANFFVSEARKSTNRASARKVLDNLIYNYSPTYCGKAGKGYDEVYIF  187

Query  128  S  126
            +
Sbjct  188  T  188



>ref|XP_003596310.1| Gamma-glutamyl hydrolase [Medicago truncatula]
Length=247

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 171/290 (59%), Gaps = 65/290 (22%)
 Frame = -3

Query  1025  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  846
              CP P+P+L Y+PVIGI+SHPGDG SGR SNATG S+I AS VKFVE+AGARV+PLIYNE
Sbjct  23    SCPPPNPNLYYQPVIGILSHPGDGTSGRHSNATGASFIHASYVKFVEAAGARVVPLIYNE  82

Query  845   PTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  666
             P E ++K                       + E  K  L KND GD+FPL AI LGF+L+
Sbjct  83    PEEKILK-----------------------VSE--KATLPKNDAGDHFPLYAICLGFELI  117

Query  665   TIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWG  486
             ++I+SED  ILE+F A NQASTLQ VE  ++EGT+F+RFP ELL+K+  +CLVMQNH   
Sbjct  118   SVIISEDKNILEEFKAKNQASTLQFVENASIEGTVFERFPPELLKKLSTDCLVMQNHV--  175

Query  485   ISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEI  306
                              +LTT  D+++KVYVST++ + YPV   QW PE           
Sbjct  176   -----------------ILTTCNDEEDKVYVSTVRSRNYPVTGFQWHPE-----------  207

Query  305   PHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDG  156
                     V + V   +  EARKS N P   ++ DNLIYN    +  K G
Sbjct  208   --------VIKKVL--YTIEARKSLNRPVAQELYDNLIYNIVQLFMQKKG  247



>ref|XP_003596307.1| Gamma-glutamylhydrolase [Medicago truncatula]
Length=199

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             CPAPDP+L Y+PVIGIVSHPGDGASGR+SNAT  SYIAAS VKFVE+AGARV+PLIY EP
Sbjct  43    CPAPDPNLYYQPVIGIVSHPGDGASGRLSNATDASYIAASYVKFVEAAGARVVPLIYTEP  102

Query  842   TETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
              E L+KKL LVNGV+F GG  + G Y E ++ I+KKVLEKND GD FPL A  LGF+L++
Sbjct  103   EEILLKKLELVNGVLFTGGWAKDGLYFETVRRIFKKVLEKNDAGDYFPLYATCLGFELIS  162

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQR  552
             +I+SEDN ILE+FSA NQAS+LQ V+   +EG++FQR
Sbjct  163   MIISEDNNILEEFSARNQASSLQFVKNAYIEGSVFQR  199



>gb|KHN36904.1| Gamma-glutamyl hydrolase [Glycine soja]
Length=181

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -3

Query  662  IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
            +I+S+DN ILE+FSASNQASTLQ VE  N+  ++FQRFP ELL K+  +CLVMQNH++GI
Sbjct  1    MIISQDNNILEEFSASNQASTLQFVENANIGESVFQRFPPELLGKMSTDCLVMQNHRYGI  60

Query  482  SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
            SP     +  LS+FF +LTT  D+D+KVYVST++ + YPV   QW PE+NAFEW    IP
Sbjct  61   SPGKLLNNPKLSSFFEILTTCTDEDDKVYVSTVRSRNYPVTGFQWHPEKNAFEWGSPRIP  120

Query  302  HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            H+EDAI ++Q VAN+ VSEARKS N P   ++ DNLIYNY+ +Y GK G G+ EVYIF+
Sbjct  121  HTEDAIQITQYVANFLVSEARKSLNRPVAQELLDNLIYNYSPTYCGKAGKGYDEVYIFA  179



>ref|XP_008359366.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase 1-like 
[Malus domestica]
Length=183

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 125/171 (73%), Gaps = 0/171 (0%)
 Frame = -3

Query  638  ILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQAD  459
            ILE FSA + ASTLQ      +EGT+FQRFP +LLRK+  +CLVMQNHK+GISPE    +
Sbjct  6    ILESFSAVDVASTLQFTVNTIIEGTVFQRFPPDLLRKLSTDCLVMQNHKYGISPERLMDN  65

Query  458  ADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILV  279
             +LS+FF +LTT  D+D+KVYVST     YPV A QW PE+NAFEW L  IPHSEDAI V
Sbjct  66   ENLSSFFKILTTCTDEDDKVYVSTAHAYNYPVTAFQWHPEKNAFEWGLPMIPHSEDAIQV  125

Query  278  SQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            +Q VAN+ VSEARKS N P    V DNLIYNY+ ++ GK G G+ EVYIF+
Sbjct  126  TQHVANFLVSEARKSLNRPPVGQVLDNLIYNYSPTFCGKAGKGYDEVYIFT  176



>ref|XP_005645555.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21011.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=345

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 173/300 (58%), Gaps = 18/300 (6%)
 Frame = -3

Query  992  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  813
            RP+IGI++ PG+ A G        SYIAAS +KFVESAGAR +P+ Y+ P   + +    
Sbjct  40   RPLIGILTQPGNPAPGN------QSYIAASYIKFVESAGARAVPIPYDAPRAEVQRLFRA  93

Query  812  VNGVVFPGGS---FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDN  642
            VNG + PGG         + +    +    +  ND GD FPL    LGF+ L +IVS D 
Sbjct  94   VNGALIPGGGQNLSPHHPFFDTSALLLNLSIAANDAGDFFPLHGTCLGFEALAVIVSGDG  153

Query  641  IILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQA  462
              L KF + + AS L + E    + T F  FP E+LR + E+ L M+NH  G++  +++ 
Sbjct  154  RALTKFDSYDNASPLVLTEDGKNDSTFFGAFPPEVLRGLQEQPLAMENHGKGLAMSTYEG  213

Query  461  DADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIPHSEDAI  285
               L +FF V + S D+ + VY+ST++ +KYP+ A QW PE+N+FEWA   +IPHS  A+
Sbjct  214  SERLKDFFVVTSLSSDRRHAVYISTMEARKYPITATQWHPEKNSFEWARKLQIPHSSSAV  273

Query  284  LVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTSYSGKDGSG-------FVEVYIF  129
             V+ + A Y V +ARK+++ P ++ +  D LIYNY T+Y+GK   G       F E Y F
Sbjct  274  EVTHAAAKYLVDQARKNTHSPASQQEEEDILIYNYPTTYTGKGDPGHPGKESDFDECYFF  333



>gb|KDD74766.1| hypothetical protein H632_c1088p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=323

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/303 (39%), Positives = 179/303 (59%), Gaps = 13/303 (4%)
 Frame = -3

Query  1055  LLNTN-WKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESA  879
             L +TN WK        +  LN RP+IG+V+  G  A        G +YIAAS +KFVESA
Sbjct  28    LSDTNAWKNDDDDDKREEKLNVRPIIGVVAQSGRPAP------EGHTYIAASYIKFVESA  81

Query  878   GARVIPLIYNEPTETLIKKLNLVNGVVFPGGS--FEKG-EYLEALKEIYKKVLEKNDGGD  708
             GARVIP++ + P   + ++   +NGV+ PGGS     G ++ + +  ++   L  ND GD
Sbjct  82    GARVIPILPDMPPAEVKRRFQAINGVLIPGGSQNLRPGNDFFDTVDLLFNLTLAANDAGD  141

Query  707   NFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRK  528
              FP+    LGF+ L +  S ++ IL  F A +  S L   + L  +   F   P ++ + 
Sbjct  142   FFPMHGTCLGFEALAVAASRNHSILTHFDAEDLPSALFPTD-LAQKSDFFSVLPKKVYKN  200

Query  527   VGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQW  348
             +  +   M+NH+ G++  +   +  L + F+VLT S+D+  ++YVST++ KKYP+ A QW
Sbjct  201   LITKPYAMENHENGVAWTAVDENPGLKDMFDVLTLSVDRGGRIYVSTMEAKKYPISATQW  260

Query  347   APERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTS  174
              PE+NAFEW   + IPH  DAI+V+Q +ANYFV+EARK+ + P NE D    +IYN+ +S
Sbjct  261   HPEKNAFEWNREKHIPHDPDAIVVTQEIANYFVNEARKNFHAPDNEEDENKMVIYNFRSS  320

Query  173   YSG  165
             ++G
Sbjct  321   FTG  323



>ref|XP_637673.1| peptidase C26 family protein [Dictyostelium discoideum AX4]
 sp|Q54LN4.1|GGHA_DICDI RecName: Full=Gamma-glutamyl hydrolase A; AltName: Full=Conjugase 
A; AltName: Full=GH A; AltName: Full=Gamma-Glu-X carboxypeptidase 
A; Flags: Precursor [Dictyostelium discoideum]
 gb|EAL64169.1| peptidase C26 family protein [Dictyostelium discoideum AX4]
Length=317

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 177/296 (60%), Gaps = 10/296 (3%)
 Frame = -3

Query  1001  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
             +N RP+IGI++ P DG         G  YIAAS VK++ESAGARV+P++Y+   ++L + 
Sbjct  26    INNRPIIGILTQPTDGDMTTF----GSQYIAASYVKYIESAGARVVPILYDIDIKSLTEL  81

Query  821   LNLVNGVVFPGGSFE---KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
             +  +NGV FPGG  +   +  Y + ++ I+ +V+E N+ GD FPL    +GFQ L ++ +
Sbjct  82    MGSINGVFFPGGGVDFNNQTVYTDTIQSIWSQVVEFNNNGDYFPLWGTCMGFQELALLSA  141

Query  650   EDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPES  471
             ++  +L  +++ N    L     L     LF      +++ +  E + M NH++G+SP++
Sbjct  142   DNFNLLSSYNSENYTVPLNFTS-LAAGSRLFSLASSSIMQSLASEPITMNNHQFGLSPQT  200

Query  470   FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP-HSE  294
             +Q  + ++ FF+VL+T++D+D   ++STI+ K YP+   QW PE+  FEW   E+  HS 
Sbjct  201   YQQTSSINTFFDVLSTNVDRDGNTFISTIEAKNYPIYGTQWHPEKPIFEWWDQEVMNHSF  260

Query  293   DAILVSQSVANYFVSEARKSSNVPNEPDVR-DNLIYNYNTSYSGKDGSGFVEVYIF  129
             D+I+ +Q  +N+FV+E RKS +  ++P V    LIYNY   YS      F ++Y F
Sbjct  261   DSIMANQYTSNFFVNECRKSLHSFSDPSVEASTLIYNYTPQYSESTVPDFEQIYYF  316



>ref|XP_003287039.1| hypothetical protein DICPUDRAFT_31892 [Dictyostelium purpureum]
 gb|EGC36406.1| hypothetical protein DICPUDRAFT_31892 [Dictyostelium purpureum]
Length=314

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/302 (36%), Positives = 179/302 (59%), Gaps = 10/302 (3%)
 Frame = -3

Query  1016  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
             A   ++N RP+IGI++ P +G         G  Y+AAS VK++ESAGARV+P++Y+   +
Sbjct  18    AAPTAVNNRPIIGILTQPTNGGMATY----GDQYLAASYVKYIESAGARVVPILYDTDIK  73

Query  836   TLIKKLNLVNGVVFPGG--SFEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLL  666
             +L    N +NG++FPGG   F+    Y   ++ I++ V+E N+ GD FPL    +GFQ L
Sbjct  74    SLTSLFNSINGILFPGGGVDFDNATVYTNTIQSIWQLVIESNNNGDYFPLWGTCMGFQEL  133

Query  665   TIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWG  486
              ++ + +  +L  +++ N    L        E  +    P E+   +  + + M NH++G
Sbjct  134   ALLAAGNFDLLSSYNSENYTVPLNFTAAAK-ESNMLGNAPSEIFEALATQPITMNNHQFG  192

Query  485   ISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEI  306
             +SP++F   + ++ FFNVL+T++D+D   ++STI+ K YP+  VQW PE+  FEW   E+
Sbjct  193   LSPQTFSDTSAINTFFNVLSTNVDRDGNTFISTIEAKNYPIYGVQWHPEKPIFEWWDQEV  252

Query  305   P-HSEDAILVSQSVANYFVSEARKSSNVPNEPDVR-DNLIYNYNTSYSGKDGSGFVEVYI  132
               HS  ++L +Q  +N+FV+E RKSS+  ++P V   +LIYNY   YS +    F ++Y 
Sbjct  253   MNHSFMSVLSNQYTSNFFVNECRKSSHSFSDPTVEAQSLIYNYQPQYSYQSVPDFEQIYY  312

Query  131   FS  126
             F+
Sbjct  313   FN  314



>ref|XP_011395864.1| Gamma-glutamyl hydrolase A [Auxenochlorella protothecoides]
 gb|KFM22997.1| Gamma-glutamyl hydrolase A [Auxenochlorella protothecoides]
Length=360

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 116/300 (39%), Positives = 179/300 (60%), Gaps = 17/300 (6%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IG+VS  GD A        G +YIAAS +KF+E+AGARVIP++ + P E + ++ 
Sbjct  49   NMRPIIGVVSQEGDPAP------KGHTYIAASYIKFLEAAGARVIPILADMPPEEVERRF  102

Query  818  NLVNGVVFPGGS--FEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
             LVNG++ PGGS     G  + +   +I++  L+ ND GD FPL    LGF+ L +I S+
Sbjct  103  KLVNGILVPGGSQVLRPGHGFYDVTSKIFELTLKANDHGDFFPLHGTCLGFETLAVIASK  162

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESF  468
            ++ IL +F A N  S L   +    +   F   P+++   +  +   M+NH  G++  + 
Sbjct  163  NHSILSEFDAENLPSPLFPTDKAE-KSEFFSVLPHKVYENLLTKPYAMENHVNGLAWTAI  221

Query  467  QADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL-SEIPHSED  291
              +  L +FF+VLT S+D+  + YVST++   YP+ A QW PE+NA+EW L  +IPH+ +
Sbjct  222  AENPTLVDFFDVLTLSIDRGGRTYVSTMEAIDYPITATQWHPEKNAYEWTLDKDIPHNPE  281

Query  290  AILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGK-----DGSGFVEVYIF  129
            AI+++Q V N+FV+ AR++  N+ N  D  D LIYN++  Y+GK     +   F E Y F
Sbjct  282  AIVITQEVGNFFVNRARRNQHNIANHDDEVDLLIYNFDLVYTGKAKFEGEEVDFDESYFF  341



>gb|EMS68709.1| Gamma-glutamyl hydrolase [Triticum urartu]
Length=340

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 160/258 (62%), Gaps = 36/258 (14%)
 Frame = -3

Query  830  IKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
            IKKL+LVNGV+F GGS ++G Y E +K++++ VL+KND G  FPL A  LGF+L+++IVS
Sbjct  5    IKKLSLVNGVLFTGGSVKRGPYFETIKKVFQYVLDKNDAGVPFPLFAQCLGFELVSMIVS  64

Query  650  EDNIILEKFSASNQASTLQVVEGLNV-EGT---------LFQR--FPYELLRKVGEECLV  507
            ++ I+L      N  S L  +  L V  GT         L+++  F  +L++K+   CLV
Sbjct  65   KEKIVL----VPNLCSFLIFLYQLKVCMGTCKDHVSCPGLYKKIIFHPDLIKKLSTSCLV  120

Query  506  MQNHK--------------------WGISPESFQADADLSNFFNVLTTSLDKDNKVYVST  387
            MQNHK                    +GISP+  + +  LS+FF +LT S D++ +VYVST
Sbjct  121  MQNHKNNYLYLLVFPNMVYFLNWSKYGISPKRLRENDALSSFFKILTISPDENGEVYVST  180

Query  386  IQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDV  207
            ++ +KYP+   QW PE+  FEW    IPHSEDA+ V+Q+ ANYF+S+ARKS N P    V
Sbjct  181  VEAQKYPITCTQWHPEKAIFEWRKPMIPHSEDAVQVTQNFANYFISQARKSPNRPPADKV  240

Query  206  RDNLIYNYNTSYSGKDGS  153
             DNLIYNY  ++SGK  +
Sbjct  241  LDNLIYNYIPTFSGKTST  258



>gb|EFA81874.1| peptidase C26 family protein [Polysphondylium pallidum PN500]
Length=321

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 173/297 (58%), Gaps = 10/297 (3%)
 Frame = -3

Query  1004  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  825
             SLN RP+IGI+S P +G         G  YIAAS VK++ESAGARV+P+ ++    T+  
Sbjct  23    SLNLRPIIGILSQPTNGEMASF----GDQYIAASYVKWIESAGARVVPIFFDSDAATVKS  78

Query  824   KLNLVNGVVFPGGSFE---KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  654
              L+ +NGVVFPGG  +   +  Y + LK I++ VL  N  G  FPL    +GFQ L ++ 
Sbjct  79    LLSQINGVVFPGGGVDLAAQPAYTDTLKLIWQTVLASNQNGGFFPLWGTCMGFQQLCMLA  138

Query  653   SEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPE  474
              +D  IL  F++ N    + +    +   TLF     E++  +  + + M NH +G+SP 
Sbjct  139   GDDFNILTGFNSENYTVPINMTAAAS-SSTLFSLASPEIMSALANQPITMNNHMYGVSPA  197

Query  473   SFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP-HS  297
             ++Q ++DL++FF VL+T++D+D   ++STI+ K YP+   QW PE+  FEW   E+  HS
Sbjct  198   AYQQNSDLNSFFEVLSTNVDRDGLTFLSTIEAKNYPIYGTQWHPEKPLFEWWDEEVMNHS  257

Query  296   EDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSGFVEVYIF  129
              D+IL +Q  A +FV++AR ++N    P     +LIYN+   YS      F +VY F
Sbjct  258   YDSILANQYTALFFVNQARNNNNKFTYPAQESTSLIYNFTPVYSFDIAPDFEQVYYF  314



>ref|XP_001696183.1| gamma-glutamyl hydrolase [Chlamydomonas reinhardtii]
 gb|EDP08160.1| gamma-glutamyl hydrolase [Chlamydomonas reinhardtii]
Length=379

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/303 (38%), Positives = 175/303 (58%), Gaps = 23/303 (8%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S PGD A        G SYIAAS VK++ESAGARV+P++Y+   + +  + 
Sbjct  74   NMRPIIGILSQPGDPAP------DGQSYIAASYVKWLESAGARVVPILYDMSPQQVEDRF  127

Query  818  NLVNGVVFPGG--SFEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
            +++NG++ PGG  +   G  + +  +++    +  ND GD FP+    LG + L++I+S 
Sbjct  128  DVINGLLLPGGGATLAPGHRFYDTARQLVDLAVAANDNGDYFPVHGTCLGMETLSVILSA  187

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESF  468
            +  IL  F A +  + L        +  L +  P +++  +  + + M+NH  G+S  + 
Sbjct  188  NYTILSPFDAEDAPAPLLYTADAK-DSHLLRSLPADVVENLQNKPIAMENHGMGLSMTAL  246

Query  467  QADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIPHSED  291
              + DL  FF VL+ SLDK    Y+ST++G+KYP  A QW PE+NA+EW     IPH+ D
Sbjct  247  VENPDLGKFFKVLSLSLDKSGAAYISTLEGRKYPFTATQWHPEKNAYEWTPHLHIPHTTD  306

Query  290  AILVSQSVANYFVSEAR----KSSNVPNEPDVRDNLIYNYNTSYSGKDG-----SGFVEV  138
            AI +SQ VAN+FVSEAR    K+ N+  E DV   LIYN+   ++G+         F + 
Sbjct  307  AIRMSQEVANFFVSEARRNLHKAKNILEEDDV---LIYNWKPEFTGRHAYVGQEKDFEQA  363

Query  137  YIF  129
            Y+F
Sbjct  364  YMF  366



>ref|XP_001626371.1| predicted protein [Nematostella vectensis]
 gb|EDO34271.1| predicted protein [Nematostella vectensis]
Length=314

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 176/293 (60%), Gaps = 13/293 (4%)
 Frame = -3

Query  995  YRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLN  816
            +RP+IGI++    G+S +       SYIAAS VK++ESAG RV+P+  +   + L K   
Sbjct  29   HRPIIGILAEKVYGSSSK-------SYIAASYVKYIESAGGRVVPIFPDMSEDKLEKLFY  81

Query  815  LVNGVVFPGGSFE--KGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDN  642
             +NGV+FPGG  +  K  Y +  K +Y   L+  D GD FP+    LGF+LLT+I S+D 
Sbjct  82   SINGVLFPGGGVDLSKSGYAKNGKFLYNMALKAYDKGDIFPVWGSCLGFELLTVITSDDK  141

Query  641  IILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQA  462
            + L +  A N    L   EG      LF   P  L++ V    + + NH + ++P  F  
Sbjct  142  VALSRVDAENLPLPLNFSEGFR-GSRLFADAPDGLIKAVQTSNITLNNHHYALAPGDFGK  200

Query  461  DADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAI  285
            +  LS+F+ VL+T++D+  K ++ST++G KYPV  VQW PE+N FEW+  E IPHS++AI
Sbjct  201  NDALSSFYKVLSTNVDRKGKEFISTVEGIKYPVYGVQWHPEKNQFEWSRREDIPHSKEAI  260

Query  284  LVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             + Q +AN+ V++AR +  + P+  +    LIYNYN++++GK  S F++ Y F
Sbjct  261  QIGQYMANFLVNQARMNDHHFPSTSEEDAALIYNYNSTFTGKH-SNFMQCYYF  312



>ref|XP_003391262.1| PREDICTED: gamma-glutamyl hydrolase A-like, partial [Amphimedon 
queenslandica]
Length=268

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 161/268 (60%), Gaps = 5/268 (2%)
 Frame = -3

Query  920  SYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKE  747
            SYIAAS VK++ESAGARV+P+I N   + L      +NGV+FPGG  S  +  YLE  K 
Sbjct  2    SYIAASYVKYIESAGARVVPIINNITQDELKDLFGSINGVLFPGGGSSLVESAYLEVAKT  61

Query  746  IYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEG  567
            I++   + ND GD FPL    LGFQLL ++ S  N IL  F + + +  L   +  N   
Sbjct  62   IFELAKQANDEGDYFPLWGTCLGFQLLCVLQSGTNHILSSFDSEDYSIPLNFTDAANA-S  120

Query  566  TLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVST  387
             LF  +  E +  +  E + M NH++G+SP+SF++ + L+ F+ VL+T+ D+    ++S+
Sbjct  121  RLFSMYTPEGMDWLSSEPITMNNHQYGVSPDSFKSMSSLTEFYTVLSTNFDRKGSEFISS  180

Query  386  IQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEP  213
            I+   YP   VQW PE+N FEW  +E I HS  A+ ++Q+ AN+ VSEARK+  +  +E 
Sbjct  181  IEAIHYPFYGVQWHPEKNIFEWTTAESINHSYHAVSIAQTAANFLVSEARKNEHHFTSEE  240

Query  212  DVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
               D+LIYNY  +Y+GK    F + Y F
Sbjct  241  KEMDSLIYNYEPTYTGKVSHSFEQEYEF  268



>ref|XP_005830901.1| hypothetical protein GUITHDRAFT_72685 [Guillardia theta CCMP2712]
 gb|EKX43921.1| hypothetical protein GUITHDRAFT_72685 [Guillardia theta CCMP2712]
Length=334

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 177/296 (60%), Gaps = 10/296 (3%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP++GI+S P  G  G   N +G SYIA+S VKFVE AGARVIP+I+N P + ++ ++
Sbjct  28   NERPIVGILSQPCTGFRG--CNESG-SYIASSYVKFVEMAGARVIPIIFNAPHDEIMFRM  84

Query  818  NLVNGVVFPGGS--FEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
              V+ ++FPGG+   + G  + E  K +++ V++ N  G  FPL    LGF+LL I+V+ 
Sbjct  85   RYVHMLLFPGGAVPLQPGTLFFETSKSLFEHVIDLNKRGFWFPLHGTCLGFELLHILVAR  144

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESF  468
               +L+ F+++N  S L   E       LFQ F  +L     ++ + +++H +G+SPE++
Sbjct  145  SGGVLQTFNSTNCRSKLNFTESAR-HSRLFQNFSNDLFEAARKKKIAVEHHMYGVSPEAY  203

Query  467  QADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL-SEIPHSED  291
            +    L +FF +L+TS D   K+YVS+++   +P+   Q+ PE+  FEW    EI H   
Sbjct  204  KNFPSLQSFFRILSTSADLQGKIYVSSMEAIDFPISGTQFHPEKPVFEWKTGQEISHDPQ  263

Query  290  AILVSQSVANYFVSEARKSSNVP--NEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            AIL++Q ++N  ++EA+K+S  P    P +   LIYNY+  Y   D   F +VY+F
Sbjct  264  AILMAQMLSNALITEAKKNSRPPLSKGPQLNSLLIYNYSPIYISDDSIPFEQVYVF  319



>ref|XP_011406499.1| PREDICTED: gamma-glutamyl hydrolase A-like [Amphimedon queenslandica]
Length=288

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 167/296 (56%), Gaps = 31/296 (10%)
 Frame = -3

Query  1004  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  825
             SLN RP+IGIVS          +     SYIAAS VK++ESAGARV+P++          
Sbjct  20    SLNLRPIIGIVSE---------TTTEDHSYIAASYVKYIESAGARVVPIM----------  60

Query  824   KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
                    V+FPGG  S  +  YLE  K I++   + ND GD FPL    LGFQLL ++ S
Sbjct  61    -------VLFPGGGSSLVESAYLEVAKTIFELAKQANDEGDYFPLWGTCLGFQLLCVLQS  113

Query  650   EDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPES  471
               N IL  F + + +  L   +  N    LF  +  E +  +  E + M NH++G+SP+S
Sbjct  114   GTNHILSSFDSEDYSIPLNFTDAANA-SRLFSMYTPEGMGWLSSEPITMNNHQYGVSPDS  172

Query  470   FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSE  294
             F++ + L+ F+ +L+T+ D+    ++S+I+   YP   VQW PE+N FEW  +E I HS 
Sbjct  173   FKSMSSLTEFYTILSTNFDRKGSEFISSIEAIHYPFYGVQWHPEKNTFEWTTAESINHSY  232

Query  293   DAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
              A+ ++Q+ AN+ VSEARKS  +  +E    D+LIYNY  +Y+GK    F + Y F
Sbjct  233   HAVSIAQTAANFLVSEARKSDHHFTSEEKEMDSLIYNYEPTYTGKVSHSFEQEYEF  288



>gb|EYU26306.1| hypothetical protein MIMGU_mgv1a019546mg [Erythranthe guttata]
Length=231

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 156/271 (58%), Gaps = 54/271 (20%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             +S  C       N+ PVIGI           + NAT  SYIAA         GARVIPLI
Sbjct  2     ISLRCRPAVLKFNFGPVIGI-----------LGNATDASYIAA---------GARVIPLI  41

Query  854   YNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYK-KVLEKNDGGDNFPLLAINLG  678
             YNEP E   +KLNLVNGV+F   S   G Y + +K I++  V  KND G +FPLLAI LG
Sbjct  42    YNEPLELRNEKLNLVNGVIFTAKS---GVYFDVVKSIFEINVRRKNDAGHHFPLLAICLG  98

Query  677   FQLLTIIVSEDNIILEKFSASNQASTLQVVE--GLNVEGTLFQRFPYELLRKVGEECLVM  504
             F+LLT+IVSED  I++KF+A N AS  +V++   +N  G+LFQRFP  L  K+  + LVM
Sbjct  99    FELLTMIVSEDENIMDKFNAKNHASNFKVMKKPDVNGNGSLFQRFPEVLRNKLSTKSLVM  158

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
             QNH       SF+ DA L +FF +L TS DK+ K                     +NAFE
Sbjct  159   QNH-------SFRRDARLDSFFKILATSTDKNGK---------------------KNAFE  190

Query  323   WALSEIPHSEDAILVSQSVANYFVSEARKSS  231
             W LS IPHSEDA+ V+Q VA++FV  +  SS
Sbjct  191   WGLSGIPHSEDAVHVTQHVADFFVRVSTSSS  221



>dbj|GAM18533.1| hypothetical protein SAMD00019534_017080, partial [Acytostelium 
subglobosum LB1]
Length=327

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/303 (38%), Positives = 170/303 (56%), Gaps = 10/303 (3%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C  P  + N RP+IGI+S P DG       A G  YIAAS VKF+ESAGARV+P++Y+  
Sbjct  20    CVTPINAQNLRPIIGILSQPTDGDMA----ALGDQYIAASYVKFIESAGARVVPILYDMS  75

Query  842   TETLIKKLNLVNGVVFPGGSFEKGE---YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
              + L   L+ +NGV+FPGG  +      Y + LK I+  V+E ND G+ FPL    +GFQ
Sbjct  76    QDDLKTLLSQLNGVLFPGGGVDLANSPTYYDNLKLIWSFVIESNDNGNPFPLWGTCMGFQ  135

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
              L ++ +++  IL  F + N    L +         LF      ++  +    + M  H+
Sbjct  136   ELCMLAADNLNILSPFDSENYTIPLNLTAAAQTS-RLFSLASPAVMTALTTLPITMNAHQ  194

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             +G+SP ++ A A L+ FF+VL+T+ D++ KV++STI+ K YP+   QW PE+  FEW   
Sbjct  195   YGVSPATYTATASLNTFFDVLSTNGDREGKVFLSTIEAKNYPIYGSQWHPEKPIFEWWAE  254

Query  311   EIP-HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDN-LIYNYNTSYSGKDGSGFVEV  138
             E+  HS D+I+ +Q  A +FV++AR ++N           LIYNYN  YS      F + 
Sbjct  255   EVMNHSYDSIVGNQYTAMFFVNQARNNNNKFTTVTAESQALIYNYNPIYSFDIDQDFEQA  314

Query  137   YIF  129
             Y F
Sbjct  315   YYF  317



>ref|XP_005852047.1| hypothetical protein CHLNCDRAFT_133025 [Chlorella variabilis]
 gb|EFN59945.1| hypothetical protein CHLNCDRAFT_133025 [Chlorella variabilis]
Length=386

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 171/286 (60%), Gaps = 12/286 (4%)
 Frame = -3

Query  1001  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
             LN RP+IG+VS  G  A        G SYIA+S VK VESAGARV+P+  +   E + ++
Sbjct  51    LNLRPLIGVVSQVGAPAP------KGHSYIASSYVKMVESAGARVVPIFCDMSPEEVERR  104

Query  821   LNLVNGVVFPGGS--FEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
                VNG++ PGGS     G+ + + + ++ +  +E ND G+ FP+    LGF+ L II S
Sbjct  105   FKAVNGILIPGGSQDLRPGQPFFDTVSQLVQLAVEANDKGNYFPVHGTCLGFETLAIIAS  164

Query  650   EDNIILEKFSASNQASTLQVVE-GLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPE  474
              ++ IL +F + N  S L + +   + +   F   P ++++ +      M+NH  G++  
Sbjct  165   GNHSILSEFDSENLPSPLFLTDTATSGKSRFFSALPEQVVQHLQTRPYAMENHAHGLAWT  224

Query  473   SFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWAL-SEIPHS  297
             + + +  L +FF+VL+ S+D+   VYVST++  +YP+   QW PE+NAFEW    +IPH 
Sbjct  225   AVEENPRLKDFFDVLSLSVDRAGAVYVSTVEAHRYPITGTQWHPEKNAFEWTPDKDIPHH  284

Query  296   EDAILVSQSVANYFVSEARKSSNVP-NEPDVRDNLIYNYNTSYSGK  162
              DAI ++Q VAN+ V EAR++ + P ++ +  D LIYN+  SY+GK
Sbjct  285   PDAIEITQEVANFIVGEARRNFHAPSSQEEEEDLLIYNWAPSYTGK  330



>pdb|4L8F|C Chain C, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8F|D Chain D, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8F|B Chain B, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8F|A Chain A, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
Complex With Mtx
 pdb|4L8Y|C Chain C, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
 pdb|4L8Y|D Chain D, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
 pdb|4L8Y|A Chain A, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
 pdb|4L8Y|B Chain B, Crystal Structure Of Gamma-glutamyl Hydrolase (c108a) 
From Zebrafish
Length=312

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 173/295 (59%), Gaps = 16/295 (5%)
 Frame = -3

Query  998  NYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
            N RP+IG+++    D    R       SYIAAS VKF+ESAGARV+P++ N+  +   + 
Sbjct  28   NERPIIGVLAQDVFDPKPDR------NSYIAASYVKFLESAGARVVPVMINKSEDEYSRL  81

Query  821  LNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
               +NGV+FPGG  S E   Y +A    Y+  LE N  GD FP+    LGF+LLT++ S 
Sbjct  82   FKSINGVLFPGGGVSLESSGYSKAAGIFYRLALEANSNGDYFPVWGTALGFELLTLLTSG  141

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLVMQNHKWGISPES  471
            + ++L   + S  A  L   E  +V+G+ LF+ FP EL++ +  E L   +H+W I+ E+
Sbjct  142  E-LLLSHTNTSGIALPLDFTE--DVKGSRLFKEFPEELMKSLATEPLTENSHQWSITTEN  198

Query  470  FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSED  291
            F A+  L  F+ VL+T+ D  NK +VST++   +P+ A QW PE+NAFEW    IPH+  
Sbjct  199  FTANKKLKKFYRVLSTNTDGYNK-FVSTMEAYDFPIYATQWHPEKNAFEWTRPYIPHTPS  257

Query  290  AILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            AI  +  +AN+FV+EARK+  +  +  +    LIYNY   Y+G   S F + Y F
Sbjct  258  AIKTTFYMANFFVNEARKNLHSFASTEEEEKALIYNYKPEYTGIQ-SAFEQTYFF  311



>ref|NP_998487.1| gamma-glutamyl hydrolase precursor [Danio rerio]
 pdb|4L7Q|C Chain C, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|D Chain D, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|A Chain A, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|B Chain B, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|E Chain E, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 pdb|4L7Q|F Chain F, Crystal Structure Of Gamma Glutamyl Hydrolase (wild-type) 
From Zebrafish
 gb|AAH66746.1| Gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) 
[Danio rerio]
 gb|ACK43089.1| gamma-glutamyl hydrolase [Danio rerio]
Length=312

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 173/295 (59%), Gaps = 16/295 (5%)
 Frame = -3

Query  998  NYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
            N RP+IG+++    D    R       SYIAAS VKF+ESAGARV+P++ N+  +   + 
Sbjct  28   NERPIIGVLAQDVFDPKPDR------NSYIAASYVKFLESAGARVVPVMINKSEDEYSRL  81

Query  821  LNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
               +NGV+FPGG  S E   Y +A    Y+  LE N  GD FP+    LGF+LLT++ S 
Sbjct  82   FKSINGVLFPGGGVSLESSGYSKAAGIFYRLALEANSNGDYFPVWGTCLGFELLTLLTSG  141

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLVMQNHKWGISPES  471
            + ++L   + S  A  L   E  +V+G+ LF+ FP EL++ +  E L   +H+W I+ E+
Sbjct  142  E-LLLSHTNTSGIALPLDFTE--DVKGSRLFKEFPEELMKSLATEPLTENSHQWSITTEN  198

Query  470  FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSED  291
            F A+  L  F+ VL+T+ D  NK +VST++   +P+ A QW PE+NAFEW    IPH+  
Sbjct  199  FTANKKLKKFYRVLSTNTDGYNK-FVSTMEAYDFPIYATQWHPEKNAFEWTRPYIPHTPS  257

Query  290  AILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            AI  +  +AN+FV+EARK+  +  +  +    LIYNY   Y+G   S F + Y F
Sbjct  258  AIKTTFYMANFFVNEARKNLHSFASTEEEEKALIYNYKPEYTGIQ-SAFEQTYFF  311



>ref|XP_004998304.1| gamma-glutamyl hydrolase [Salpingoeca rosetta]
 gb|EGD76129.1| gamma-glutamyl hydrolase [Salpingoeca rosetta]
Length=332

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/304 (36%), Positives = 174/304 (57%), Gaps = 14/304 (5%)
 Frame = -3

Query  1007  PSLNYRPVIGIVSHP------GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  846
             P+    PVIG+++        G    G I      +YIAAS VK++ESAGARV+P+    
Sbjct  30    PANQTGPVIGVLTQTYGPEVLGGKLGGEIDETR--TYIAASYVKYLESAGARVVPIDCMA  87

Query  845   PTETLIKKLNLVNGVVFPGG----SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  678
               + L +K  ++NG + PGG    +  K  Y    + +     E N+ GD FP+    LG
Sbjct  88    SEDELREKAKMINGFLLPGGGQAITDPKNSYSRTARFMMNMAKEFNNKGDYFPVWGTCLG  147

Query  677   FQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQN  498
             FQ++++ +  ++++   F + +    L     ++    +F+    EL+  +  + L M N
Sbjct  148   FQMVSVFIGGNSVLGHHFDSEDLPLPLNFTSHISTS-KIFKSARPELITALRNQPLTMNN  206

Query  497   HKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWA  318
             H+ G++P +F  +A+L++FFNV++T++D+    +VSTI+GK  P  A QW PE+N+FEW 
Sbjct  207   HEGGVTPITFANNANLTSFFNVISTNVDRKGNPFVSTIEGKHMPFYATQWHPEKNSFEWT  266

Query  317   LSE-IPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDNLIYNYNTSYSGKDGSGFVE  141
              SE IPHS  AI   Q  + +FV+EARKS++      +R ++IYNYN  ++GKDGSGF +
Sbjct  267   ASEAIPHSALAIETCQLTSTFFVNEARKSNHAYPPEQLRKDIIYNYNPVFTGKDGSGFEQ  326

Query  140   VYIF  129
              Y +
Sbjct  327   CYFW  330



>pdb|4L8W|D Chain D, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|I Chain I, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|B Chain B, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|E Chain E, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|G Chain G, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L8W|K Chain K, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish Complex With Mtx Polyglutamate
 pdb|4L95|E Chain E, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|F Chain F, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|C Chain C, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|G Chain G, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|K Chain K, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
 pdb|4L95|M Chain M, Crystal Structure Of Gamma Glutamyl Hydrolase (h218n) 
From Zebrafish
Length=312

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 173/295 (59%), Gaps = 16/295 (5%)
 Frame = -3

Query  998  NYRPVIGIVSHP-GDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
            N RP+IG+++    D    R       SYIAAS VKF+ESAGARV+P++ N+  +   + 
Sbjct  28   NERPIIGVLAQDVFDPKPDR------NSYIAASYVKFLESAGARVVPVMINKSEDEYSRL  81

Query  821  LNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
               +NGV+FPGG  S E   Y +A    Y+  LE N  GD FP+    LGF+LLT++ S 
Sbjct  82   FKSINGVLFPGGGVSLESSGYSKAAGIFYRLALEANSNGDYFPVWGTCLGFELLTLLTSG  141

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGT-LFQRFPYELLRKVGEECLVMQNHKWGISPES  471
            + ++L   + S  A  L   E  +V+G+ LF+ FP EL++ +  E L   +H+W I+ E+
Sbjct  142  E-LLLSHTNTSGIALPLDFTE--DVKGSRLFKEFPEELMKSLATEPLTENSHQWSITTEN  198

Query  470  FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSED  291
            F A+  L  F+ VL+T+ D  NK +VST++   +P+ A QW PE+NAFEW    IPH+  
Sbjct  199  FTANKKLKKFYRVLSTNTDGYNK-FVSTMEAYDFPIYATQWNPEKNAFEWTRPYIPHTPS  257

Query  290  AILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            AI  +  +AN+FV+EARK+  +  +  +    LIYNY   Y+G   S F + Y F
Sbjct  258  AIKTTFYMANFFVNEARKNLHSFASTEEEEKALIYNYKPEYTGIQ-SAFEQTYFF  311



>ref|XP_005009586.1| PREDICTED: gamma-glutamyl hydrolase [Anas platyrhynchos]
Length=393

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 167/305 (55%), Gaps = 11/305 (4%)
 Frame = -3

Query  1031  SGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIY  852
             S   P      N RP++G+++              G SYIAAS VKF+ESAGARV+PL  
Sbjct  95    SAALPGRQSEPNERPIVGVLA---QECHFNKFQQFGNSYIAASYVKFLESAGARVVPLRL  151

Query  851   NEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLG  678
             N   E   K  + +NGV+FPGG    +  EY    K  Y+K LE ND GD FP+    LG
Sbjct  152   NLSDEVYDKIFHSINGVLFPGGGVDLKTSEYSRVAKIFYRKALEANDKGDYFPIWGTCLG  211

Query  677   FQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQN  498
              + LT + S + ++L     +  A  L        +  LF+  P +LLR +  E L    
Sbjct  212   HEELTYLTS-NKVLLVNTKTTGLALPLNFTSAAK-DSRLFKNLPKDLLRALANEPLTSNF  269

Query  497   HKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWA  318
             H+W +S E+F  +  L  F+NVLTT+ D + + Y+ST++  KYP+ +VQW PE++ FEW 
Sbjct  270   HRWSLSMENFTKNEKLHKFYNVLTTNTDGEVE-YISTMEAYKYPIYSVQWHPEKSPFEWK  328

Query  317   LSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFV  144
              S  IPHS  A+  +  +A++FV+EARKS    P+E + R  LIYNY   Y+G   S F 
Sbjct  329   KSTGIPHSSSAVRAAYYIADFFVNEARKSLHRFPSEDEERKELIYNYTPIYTG-TFSSFQ  387

Query  143   EVYIF  129
             + Y F
Sbjct  388   QAYFF  392



>ref|XP_419226.4| PREDICTED: gamma-glutamyl hydrolase [Gallus gallus]
Length=439

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 171/303 (56%), Gaps = 14/303 (5%)
 Frame = -3

Query  1025  GCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNE  846
             GC   +P  N RP++GI+S           +  G SYIAAS VKF+ESAGAR++P+  N 
Sbjct  146   GC---EPGPNERPIVGILSQECHFDE---FHKFGSSYIAASYVKFLESAGARIVPIRLNL  199

Query  845   PTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQ  672
               E   +  + +NGV+FPGG    +  EY    K  Y+K LE ND GD FP+    LG +
Sbjct  200   SDEEYDRIFHSINGVLFPGGGVDLKTSEYSRVAKIFYRKALEANDKGDYFPVWGTCLGHE  259

Query  671   LLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK  492
             LLT + S + +++   + +N  S             LF+  P +LL     E L    H 
Sbjct  260   LLTYLTSGEILLVN--TKTNGFSLPLNFTSAAKRSRLFKNLPNDLLHAFANEPLTSNFHV  317

Query  491   WGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS  312
             W IS E+F  +  L NF+N+LTT++D + + ++ST++  KYP+  VQW PE+N+FEW  S
Sbjct  318   WSISMENFTKNEKLYNFYNILTTNIDNEVE-FISTMEAYKYPIYGVQWHPEKNSFEWKNS  376

Query  311   E-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEV  138
               IPHS  AI  +  +A++F++EARKS    P+E +    LIYNY  +Y+G   S F +V
Sbjct  377   SGIPHSSSAIRAAHYIADFFINEARKSLHRFPSEGEETKELIYNYTPTYTGTF-SSFQQV  435

Query  137   YIF  129
             Y F
Sbjct  436   YFF  438



>ref|XP_009075416.1| PREDICTED: gamma-glutamyl hydrolase, partial [Acanthisitta chloris]
Length=292

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 164/296 (55%), Gaps = 13/296 (4%)
 Frame = -3

Query  1001  LNYRPVIGIVSHPGD-GASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  825
             LN RP+IGI+S     G   R     G SYIAAS VKFVESAGAR +P+  N   E   K
Sbjct  4     LNDRPIIGILSQECHYGEFQRF----GRSYIAASYVKFVESAGARAVPIRLNLTDEEYDK  59

Query  824   KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
                 +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S
Sbjct  60    IFYSINGVLFPGGGVDLKTSEYSRVAKIFYDKALEANDKGDYFPIWGTCLGHEELTYLTS  119

Query  650   EDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPES  471
              D +++   + +N  S          +  LF+ FP ++L  +  E L    H W +S E+
Sbjct  120   GDILLVR--TKTNGFSLPLNFTSAAKDSKLFRNFPDDVLHALATEPLTSNFHMWSLSMEN  177

Query  470   FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSE  294
             F  +  L +F+NVLTT+ D D   ++ST++  KYP+  +QW PE+N FEW  S  IPHS 
Sbjct  178   FTTNEKLRDFYNVLTTNTD-DELEFISTMEAYKYPIYGIQWHPEKNPFEWKDSPGIPHSP  236

Query  293   DAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
              A+  +  +A++FV+EARKS  + P+E +    LIYNY   Y+G   S F + Y F
Sbjct  237   AAVRAAYYMADFFVNEARKSLHHFPSEDEETKELIYNYTPVYTGP-FSAFQQTYFF  291



>ref|XP_007894923.1| PREDICTED: gamma-glutamyl hydrolase [Callorhinchus milii]
Length=318

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 173/301 (57%), Gaps = 11/301 (4%)
 Frame = -3

Query  1022  CPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEP  843
             C AP   LN RP+IG+++    G   +     G SYIAAS VK +ESAGARV+P+  N  
Sbjct  23    CAAPVTQLNQRPIIGVLTQKTYGELNKF----GKSYIAASYVKHLESAGARVVPISINLS  78

Query  842   TETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQL  669
              +   K    +NG+++PGG  +     Y +     Y   +E ND G +FP+    LGF+ 
Sbjct  79    EDECKKLFYSINGLLYPGGGVNIMTSSYAKLAAIFYNLTIEANDHGTHFPVWGTCLGFEE  138

Query  668   LTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKW  489
             LT   S +N+ L   + SN    L   +  + +  +F++FP +LL+ + EE L    HKW
Sbjct  139   LTFTTSGENL-LTLTNTSNLTLPLTFTKE-SRDSRMFKKFPKDLLQALAEEPLTANFHKW  196

Query  488   GISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE  309
              +S ++F ++A LSN + +LTT+ D     ++ST++ + YP+ AVQW PE+N +EW+  E
Sbjct  197   SLSVKNFTSNAKLSNSYRILTTNTDSQGLQFISTMEARNYPIYAVQWHPEKNPYEWSKKE  256

Query  308   -IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVY  135
              IPHS  A+  +  +A +FV+EARK+  +  NE +    LI+NY + Y+G D S F ++Y
Sbjct  257   NIPHSLTAVKAAWYMAEFFVNEARKNLHHFSNETEEAKALIHNYLSIYTG-DISNFQQMY  315

Query  134   I  132
              
Sbjct  316   F  316



>ref|XP_010707289.1| PREDICTED: gamma-glutamyl hydrolase [Meleagris gallopavo]
Length=408

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 166/298 (56%), Gaps = 11/298 (4%)
 Frame = -3

Query  1010  DPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETL  831
             +P  N RP++GI+S           +  G SYIAAS VKF+ESAGAR++P+  N   E  
Sbjct  117   EPEPNERPIVGILSQECHFDE---FHKFGSSYIAASYVKFLESAGARIVPIRLNLSDEEY  173

Query  830   IKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  657
              K  + +NGV+FPGG    +  EY    K  Y+K LE ND GD FP+    LG +LLT +
Sbjct  174   DKIFHSINGVLFPGGGVDLKTSEYSRVAKIFYRKALEANDKGDYFPIWGTCLGHELLTYL  233

Query  656   VSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISP  477
              S + +++   + +N  S          +  LF+  P +LL     E L    H W IS 
Sbjct  234   TSGEILLVN--TKTNGFSLPLNFTSAAKQSRLFKNLPSDLLHAFATEPLTSNFHMWSISM  291

Query  476   ESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPH  300
             E+F  +  L NF+NVLTT+ D D   ++ST++  +YP+  VQW PE+N FEW  S  IPH
Sbjct  292   ENFTKNEKLYNFYNVLTTNTD-DEVEFISTMEAYRYPIYGVQWHPEKNPFEWKNSSGIPH  350

Query  299   SEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             S  A+  +  +A++FV+EARK+    P+E +    LIYNY   Y+G   S F +VY F
Sbjct  351   SSSAVRAAYYIADFFVNEARKNLHRFPSEGEETKELIYNYTPIYTG-TFSSFQQVYFF  407



>gb|AAI08439.1| LOC496099 protein [Xenopus laevis]
Length=311

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 173/306 (57%), Gaps = 13/306 (4%)
 Frame = -3

Query  1025  GCPAPDPS---LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             GC  P P+    N RP+IGIV+      + +     G +YIA S VKF+ESAG RV+P+ 
Sbjct  12    GCVLPAPAGTEPNNRPIIGIVAQE---VTDKEFFPFGTTYIADSYVKFLESAGCRVVPIQ  68

Query  854   YNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
              N P     K    +NGV+FPGGS   +   +    +  YK  +E +  G  FP+    +
Sbjct  69    LNLPEVEYRKLFRSINGVLFPGGSVDLQISSFARTARIFYKLAIEASSSGHYFPIWGTCM  128

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             GFQ+LT   +  ++ L   SA N +  L + + +     +F R P +LLR + +E +   
Sbjct  129   GFQILTAFTAGADL-LSATSAENISLPLNLTDEV-ASSRMFLRAPPDLLRVLSQERVTAN  186

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
              H +G++PE+F+A+  LS+FF VL+T+ D +   ++STI+ + YP+  VQW PE N F+W
Sbjct  187   FHHFGLTPETFRANKKLSDFFRVLSTNRDINGVEFISTIEARNYPIYGVQWHPEVNRFQW  246

Query  320   ALS-EIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSGF  147
                   PHS +AI VSQ +A++FV+EARKS N  P E +    LIYN+   Y+  + SG+
Sbjct  247   RSDFSFPHSANAIWVSQYLADFFVNEARKSQNHFPTEKEENAALIYNWTPIYTA-NISGY  305

Query  146   VEVYIF  129
              + Y F
Sbjct  306   EQAYFF  311



>gb|KFP82604.1| Gamma-glutamyl hydrolase, partial [Acanthisitta chloris]
Length=288

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 119/295 (40%), Positives = 163/295 (55%), Gaps = 13/295 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGD-GASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
            N RP+IGI+S     G   R     G SYIAAS VKFVESAGAR +P+  N   E   K 
Sbjct  1    NDRPIIGILSQECHYGEFQRF----GRSYIAASYVKFVESAGARAVPIRLNLTDEEYDKI  56

Query  821  LNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
               +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S 
Sbjct  57   FYSINGVLFPGGGVDLKTSEYSRVAKIFYDKALEANDKGDYFPIWGTCLGHEELTYLTSG  116

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESF  468
            D +++   + +N  S          +  LF+ FP ++L  +  E L    H W +S E+F
Sbjct  117  DILLVR--TKTNGFSLPLNFTSAAKDSKLFRNFPDDVLHALATEPLTSNFHMWSLSMENF  174

Query  467  QADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSED  291
              +  L +F+NVLTT+ D D   ++ST++  KYP+  +QW PE+N FEW  S  IPHS  
Sbjct  175  TTNEKLRDFYNVLTTNTD-DELEFISTMEAYKYPIYGIQWHPEKNPFEWKDSPGIPHSPA  233

Query  290  AILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            A+  +  +A++FV+EARKS  + P+E +    LIYNY   Y+G   S F + Y F
Sbjct  234  AVRAAYYMADFFVNEARKSLHHFPSEDEETKELIYNYTPVYTGP-FSAFQQTYFF  287



>ref|XP_005288157.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Chrysemys 
picta bellii]
Length=389

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 169/294 (57%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N +P+IGI++   D  S    +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  102  NEKPIIGILAQECDFTS---FHRFGSSYIAASYVKFLESAGARVVPIRLNRSEEEYDKIF  158

Query  818  NLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
              +NGV+FPGG    +  EY    +  Y K L+ ND GD FP+    LG++ LT + S +
Sbjct  159  QSINGVLFPGGGVDLKTSEYSRTARIFYNKALKANDKGDYFPVWGTCLGYEELTYLTSGE  218

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             I+L   +  + A  L        +  +F+ FP +LL+K+  E L    H W +S ++F 
Sbjct  219  -ILLTWTNTEDFAFPLNFTTAAK-DSRMFKNFPDDLLQKLATESLTAHFHHWSLSVQNFT  276

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +A L NF+ VLTT+   D + ++ST++  KYP+  VQW PE+N FEW  S  IPHS  A
Sbjct  277  QNAKLRNFYKVLTTNTHADVE-FISTMEAYKYPIYGVQWHPEKNPFEWKNSSGIPHSASA  335

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            + V+  VA++ V+EARKS  + PN+ +    LIYNY   ++G   S F +VY F
Sbjct  336  MKVAYYVADFLVNEARKSLHHFPNKSEETKALIYNYTPVFTGIF-SPFEQVYFF  388



>gb|AAH87532.1| LOC496099 protein, partial [Xenopus laevis]
Length=319

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 173/306 (57%), Gaps = 13/306 (4%)
 Frame = -3

Query  1025  GCPAPDPS---LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             GC  P P+    N RP+IGIV+      + +     G +YIA S VKF+ESAG RV+P+ 
Sbjct  20    GCVLPAPAGTEPNNRPIIGIVAQE---VTDKEFFPFGTTYIADSYVKFLESAGCRVVPIQ  76

Query  854   YNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
              N P     K    +NGV+FPGGS   +   +    +  YK  +E +  G  FP+    +
Sbjct  77    LNLPEVEYRKLFRSINGVLFPGGSVDLQISSFARTARIFYKLAIEASSSGHYFPIWGTCM  136

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             GFQ+LT   +  ++ L   SA N +  L + + +     +F R P +LLR + +E +   
Sbjct  137   GFQILTAFTAGADL-LSATSAENISLPLNLTDEV-ASSRMFLRAPPDLLRVLSQERVTAN  194

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
              H +G++PE+F+A+  LS+FF VL+T+ D +   ++STI+ + YP+  VQW PE N F+W
Sbjct  195   FHHFGLTPETFRANKKLSDFFRVLSTNRDINGVEFISTIEARNYPIYGVQWHPEVNRFQW  254

Query  320   ALS-EIPHSEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSGF  147
                   PHS +AI VSQ +A++FV+EARKS N  P E +    LIYN+   Y+  + SG+
Sbjct  255   RSDFSFPHSANAIWVSQYLADFFVNEARKSQNHFPTEKEENAALIYNWTPIYTA-NISGY  313

Query  146   VEVYIF  129
              + Y F
Sbjct  314   EQAYFF  319



>ref|XP_009707401.1| PREDICTED: gamma-glutamyl hydrolase, partial [Cariama cristata]
Length=289

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 162/294 (55%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S        R     G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  2    NERPIIGILSQECHFEKFR---RFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  58

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  59   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE  118

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             ++L        A  L        +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  119  -VLLVNTKTDGFALPLNFTSAAK-DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFT  176

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+NVLTT+ + D   ++ST++  KYP+  VQW PE+N FEW  S  IPHS  A
Sbjct  177  KNEKLRNFYNVLTTNTN-DEVEFISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSA  235

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++F++EARKS  + P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  236  VKAAYYIADFFINEARKSLHHFPSEDEETKELIYNYTPIYTGT-FSSFQQIYFF  288



>ref|XP_007421928.1| PREDICTED: gamma-glutamyl hydrolase [Python bivittatus]
Length=316

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/296 (39%), Positives = 170/296 (57%), Gaps = 12/296 (4%)
 Frame = -3

Query  1004  SLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIK  825
             S N RP+IGI++   D  S +     G SYIAAS VKF+ESAGARV+P+  N   E   K
Sbjct  28    SENERPIIGILAQETDFKSFQ---KFGSSYIAASYVKFIESAGARVVPIRLNRSYEEYDK  84

Query  824   KLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
               + +NG++FPGG    +  E+ +  K  YKK LE ND GD FP+    LG QLL  + S
Sbjct  85    IFHGINGILFPGGGVDLKTSEFSKVAKIFYKKALEANDRGDYFPIWGTCLGHQLLAYLTS  144

Query  650   EDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPES  471
              ++++    +       L   +G      +FQ FP ++ + +  E +    H W +S ++
Sbjct  145   GEDLLTWT-NTDGFTMPLNFTQGAK-HSKMFQDFPEDIYKLIASEPVTSHFHFWSLSVQN  202

Query  470   FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSE  294
             +  +  L NF+ +LTT+    N  ++ST++  +YP+  VQW PE+N FEW  S  IPHS 
Sbjct  203   YTENEKLRNFYKILTTNF--HNVEFISTMEAYRYPIYGVQWHPEKNPFEWKNSTGIPHSS  260

Query  293   DAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             ++I V+  +A +FV+EARKSS +  ++ D  D LIYN+N  ++G   S F +VY F
Sbjct  261   ESIKVTFFIAEFFVNEARKSSHHFSSKKDETDALIYNFNPVFTGI-FSSFDQVYFF  315



>ref|XP_002946185.1| hypothetical protein VOLCADRAFT_102798 [Volvox carteri f. nagariensis]
 gb|EFJ53180.1| hypothetical protein VOLCADRAFT_102798 [Volvox carteri f. nagariensis]
Length=331

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 169/286 (59%), Gaps = 14/286 (5%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S PGD A        G SYIAAS VK++ESAGARV+P+ Y+   + + ++ 
Sbjct  30   NLRPIIGILSQPGDPAP------EGESYIAASYVKWLESAGARVVPIFYDMDAQDIERRF  83

Query  818  NLVNGVVFPGG--SFEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
             ++NG++ PGG  + E G  + +  + + +  L+ ND GD FP+    LG + L++I+S 
Sbjct  84   AVINGLLLPGGGATLEPGHRFYDTARYLVELALKANDNGDYFPVHGTCLGMETLSVIISS  143

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHK--WGISPE  474
            +  +L +F A +  + L +         L +  P +++  +  + + M+NH    G+S  
Sbjct  144  NYTLLGEFDAEDAPAPL-LYTNEAAASHLLRSLPPDVVTDLQNKPIAMENHMNGGGLSMT  202

Query  473  SFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIPHS  297
            +F  +  L  FF V++ SLDK    Y+ST++G+ YP  A QW PE+NA+EW     IPH+
Sbjct  203  AFLENPALGRFFRVVSLSLDKSGAAYISTLEGRNYPFTATQWHPEKNAYEWTPHLHIPHT  262

Query  296  EDAILVSQSVANYFVSEARKSSNVPNEPDVRDN-LIYNYNTSYSGK  162
             DAI +SQ VAN+FV+EAR++ ++       D  LIYN+   ++GK
Sbjct  263  TDAIRMSQEVANFFVAEARRNLHMAKNIIEEDELLIYNFKPVFTGK  308



>ref|XP_010288197.1| PREDICTED: gamma-glutamyl hydrolase, partial [Phaethon lepturus]
Length=292

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/297 (40%), Positives = 164/297 (55%), Gaps = 11/297 (4%)
 Frame = -3

Query  1007  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  828
             P  N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   
Sbjct  2     PVGNERPIIGILSQE---CHFEKFHRFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYD  58

Query  827   KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  654
             K  + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + 
Sbjct  59    KIFHSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLT  118

Query  653   SEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPE  474
             S + ++L     +  A  L        +  LF+ FP ++L     E L    H W +S E
Sbjct  119   SGE-VLLVNTKTNGFALPLNFTSAAK-DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSME  176

Query  473   SFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHS  297
             +F  +  L NF+NVLTT+++ D   ++ST++  KYP+  VQW PE+N FEW  S  IPHS
Sbjct  177   NFTKNEKLRNFYNVLTTNIN-DEVEFISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHS  235

Query  296   EDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
               A+  +  +A++F++EARKS    P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  236   PSAVRAAYYIADFFINEARKSLHQFPSEDEETKELIYNYTPVYTGT-FSSFQQIYFF  291



>ref|XP_009950167.1| PREDICTED: gamma-glutamyl hydrolase [Leptosomus discolor]
Length=322

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 165/306 (54%), Gaps = 17/306 (6%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             + GG P      N RP++GI+S        +  +  G SYIAAS VKF+ESAGARV+P+ 
Sbjct  29    VEGGGP------NERPIVGILSQE---CHFKKFHRFGSSYIAASYVKFLESAGARVVPIR  79

Query  854   YNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
              N   E   K  + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    L
Sbjct  80    LNRSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCL  139

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             G + LT + S   ++L     +  A  L        +  LF+ FP ++L     E L   
Sbjct  140   GHEELTYLTS-GQVLLVNTKTNGFALPLNFTSAAK-DSRLFKNFPDDVLHAFATEPLTSN  197

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
              H W +S E+F  +  L NF+NVLTT+ D D   +VST++  KYP+  VQW PE+N FEW
Sbjct  198   FHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFVSTMEAYKYPIYGVQWHPEKNPFEW  256

Query  320   ALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
                  IPHS  A+  +  +A++FV+EAR+S    P+E +    LIYNY   Y+G   S F
Sbjct  257   KNKPGIPHSPSAVRAAYYIADFFVNEARRSLHRFPSEDEESKELIYNYTPVYTGA-FSSF  315

Query  146   VEVYIF  129
              ++Y F
Sbjct  316   QQIYFF  321



>gb|KFP61510.1| Gamma-glutamyl hydrolase, partial [Cariama cristata]
Length=309

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 162/294 (55%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S        R     G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  22   NERPIIGILSQECHFEKFR---RFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  78

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  79   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE  138

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             ++L        A  L        +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  139  -VLLVNTKTDGFALPLNFTSAAK-DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFT  196

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+NVLTT+ + D   ++ST++  KYP+  VQW PE+N FEW  S  IPHS  A
Sbjct  197  KNEKLRNFYNVLTTNTN-DEVEFISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSA  255

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++F++EARKS  + P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  256  VKAAYYIADFFINEARKSLHHFPSEDEETKELIYNYTPIYTGT-FSSFQQIYFF  308



>gb|KFQ12123.1| Gamma-glutamyl hydrolase, partial [Leptosomus discolor]
Length=318

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 165/306 (54%), Gaps = 17/306 (6%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
             + GG P      N RP++GI+S        +  +  G SYIAAS VKF+ESAGARV+P+ 
Sbjct  25    VEGGGP------NERPIVGILSQE---CHFKKFHRFGSSYIAASYVKFLESAGARVVPIR  75

Query  854   YNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
              N   E   K  + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    L
Sbjct  76    LNRSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCL  135

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             G + LT + S   ++L     +  A  L        +  LF+ FP ++L     E L   
Sbjct  136   GHEELTYLTS-GQVLLVNTKTNGFALPLNFTSAAK-DSRLFKNFPDDVLHAFATEPLTSN  193

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
              H W +S E+F  +  L NF+NVLTT+ D D   +VST++  KYP+  VQW PE+N FEW
Sbjct  194   FHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFVSTMEAYKYPIYGVQWHPEKNPFEW  252

Query  320   ALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
                  IPHS  A+  +  +A++FV+EAR+S    P+E +    LIYNY   Y+G   S F
Sbjct  253   KNKPGIPHSPSAVRAAYYIADFFVNEARRSLHRFPSEDEESKELIYNYTPVYTGA-FSSF  311

Query  146   VEVYIF  129
              ++Y F
Sbjct  312   QQIYFF  317



>gb|KFQ77761.1| Gamma-glutamyl hydrolase, partial [Phaethon lepturus]
Length=306

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/297 (40%), Positives = 164/297 (55%), Gaps = 11/297 (4%)
 Frame = -3

Query  1007  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  828
             P  N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   
Sbjct  16    PVGNERPIIGILSQE---CHFEKFHRFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYD  72

Query  827   KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  654
             K  + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + 
Sbjct  73    KIFHSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLT  132

Query  653   SEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPE  474
             S + ++L     +  A  L        +  LF+ FP ++L     E L    H W +S E
Sbjct  133   SGE-VLLVNTKTNGFALPLNFTSAAK-DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSME  190

Query  473   SFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHS  297
             +F  +  L NF+NVLTT+++ D   ++ST++  KYP+  VQW PE+N FEW  S  IPHS
Sbjct  191   NFTKNEKLRNFYNVLTTNIN-DEVEFISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHS  249

Query  296   EDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
               A+  +  +A++F++EARKS    P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  250   PSAVRAAYYIADFFINEARKSLHQFPSEDEETKELIYNYTPVYTGT-FSSFQQIYFF  305



>ref|XP_007231125.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Astyanax 
mexicanus]
Length=310

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 169/299 (57%), Gaps = 24/299 (8%)
 Frame = -3

Query  998  NYRPVIGIVSH------PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
            N  PVIG+++       PG  A           YIAAS VK++ESAGA+V+P++ N   E
Sbjct  26   NDSPVIGVLAQEVYAPTPGKNA-----------YIAASYVKYLESAGAKVVPVMINRSEE  74

Query  836  TLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
               +    +NG++FPGG  S     Y +A    Y+  LE N  GD FP+    LGF+ LT
Sbjct  75   EYTRLFKSLNGILFPGGGASITSSGYAKAAGIFYRLALEANSKGDYFPVWGTCLGFEQLT  134

Query  662  IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
            ++ SE  ++L   + S  A  L     LN +  +F+ FP  L+  +  E L   +HKW I
Sbjct  135  LLTSEK-LLLSHTNTSGVALPLNFTSELN-KSRMFKDFPAHLMTSLANEPLTENSHKWSI  192

Query  482  SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
            + +SF+ +  L  F+ +L+T+ D   K +VST++   YPV   QW PE+NAFEW    IP
Sbjct  193  TTKSFKGNEKLKKFYRILSTNTD-GQKEFVSTVEAYDYPVYGTQWHPEKNAFEWTRPYIP  251

Query  302  HSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            H+  AI  +  +A++FV+EA+KS  +  ++ + ++ LIYNY+ SY+GK  S F ++Y F
Sbjct  252  HTPSAIKTTFYMADFFVNEAKKSLHSFSSQEEEQNALIYNYSPSYTGKT-SIFEQIYYF  309



>ref|XP_004350727.1| peptidase C26 family protein [Dictyostelium fasciculatum]
 gb|EGG14019.1| peptidase C26 family protein [Dictyostelium fasciculatum]
Length=335

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 165/296 (56%), Gaps = 10/296 (3%)
 Frame = -3

Query  1001  LNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKK  822
             +N RP+IGI++ P +G         G  Y+AAS VK+VES GARV+P++Y+ P + +   
Sbjct  36    INNRPIIGILTQPTNGDMANY----GDQYLAASYVKYVESGGARVVPILYDSPADEIKSL  91

Query  821   LNLVNGVVFPGGSF---EKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVS  651
                +NGV  PGG     +  +Y + L+ +Y+ V++ ND  D FPL    +GFQ + ++ +
Sbjct  92    FQSINGVFLPGGGVDLDQSPQYTDTLRLLYQLVIQANDNQDYFPLWGTCMGFQEINMMQA  151

Query  650   EDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPES  471
              +  IL  + + N    L      +    LF      +++ +    + M NH WG++P +
Sbjct  152   NNLDILSPYDSENYTVPLNFTSAAS-SSRLFSLATPSIMQNLASLPITMNNHMWGVAPST  210

Query  470   FQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSE  294
             F + A LS+FFNVL+ + D+  +V++STI+ K+YP+ A QW PE+  FEW   E I HS 
Sbjct  211   FASTALLSSFFNVLSVNNDRQGRVFISTIEAKEYPIYATQWHPEKPLFEWWDQEVIDHSL  270

Query  293   DAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
              +I  +Q  + +FV+E RKS  + P++      LIYNY   ++      F +VY F
Sbjct  271   QSIQANQYTSTWFVNECRKSLHSFPDQTAESAALIYNYAPMFTFDIEPDFEQVYYF  326



>gb|KFQ39814.1| Gamma-glutamyl hydrolase, partial [Mesitornis unicolor]
Length=314

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 162/294 (55%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  27   NERPIIGILSQECHFDK---FHKFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  83

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG       EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  84   HSINGVLFPGGGVDLRTSEYARVAKIFYHKALEANDKGDYFPIWGTCLGHEELTYLTSGE  143

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             +++   + ++  S          +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  144  VLLVN--TKTDGFSLPLNFTSAAKDSRLFKNFPDDVLHAFATEPLTSNFHMWSLSVENFT  201

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+NVLTT+ D D   ++ST++  KYP+  VQW PE+N FEW  S  IPHS  A
Sbjct  202  KNEKLRNFYNVLTTNTD-DELEFISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSA  260

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++F++EARKS    P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  261  VKAAYYIADFFINEARKSLHRFPSEDEEAKELIYNYTPIYTGT-FSSFQQIYFF  313



>ref|XP_007937663.1| PREDICTED: gamma-glutamyl hydrolase [Orycteropus afer afer]
Length=316

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 171/299 (57%), Gaps = 11/299 (4%)
 Frame = -3

Query  1016  APDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
             AP      +P+IGI+         ++ N  G  YIAAS VK++ESAGARVIP+  N   E
Sbjct  25    APSSGTTEKPIIGILMQR---CRSKMKN-LGKYYIAASYVKYLESAGARVIPVRLNLTGE  80

Query  836   TLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
                K    +NG++FPGGS      +Y +  K  Y   L+  D GD FP+    LGF+ L+
Sbjct  81    EYEKLFKSINGILFPGGSVNLRTSDYAKVAKIFYNFALKSFDDGDYFPVWGTCLGFEELS  140

Query  662   IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
              +VS  N+ L K    N++  L    G  ++G +FQ FP +LL  +  E L    HKW +
Sbjct  141   FLVSGKNL-LTKTETENKSLPLNFT-GATLQGRMFQNFPADLLLSLSTEPLTANFHKWSL  198

Query  482   SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
             S ++F A+  L  FFNV+TT+   D   +VS+++G KYP+  VQW PE++ +EW    I 
Sbjct  199   SIKNFTANERLKTFFNVITTN-TVDKIEFVSSMEGYKYPIYGVQWHPEKSPYEWENDYIS  257

Query  302   HSEDAILVSQSVANYFVSEARKSS-NVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             HS +A+  +  +A++FVSEARK+S +  +E + R+ LIY ++  ++G   S F + YIF
Sbjct  258   HSSNAVKTAFYLADFFVSEARKNSHHFESEDEEREALIYQFHPVFTG-SLSSFQQCYIF  315



>gb|KFV98034.1| Gamma-glutamyl hydrolase, partial [Fulmarus glacialis]
Length=282

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 154/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y+K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  76   KIFYRKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    HKW +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  134  DSRLFKNFPDDVLYAFATEPLTSNFHKWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  253  EDEETKELIYNYTPIYTGA-FSSFQQIYFF  281



>ref|XP_009584845.1| PREDICTED: gamma-glutamyl hydrolase, partial [Fulmarus glacialis]
Length=286

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 154/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  20   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  79

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y+K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  80   KIFYRKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  137

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    HKW +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  138  DSRLFKNFPDDVLYAFATEPLTSNFHKWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFI  196

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  197  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  256

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  257  EDEETKELIYNYTPIYTGA-FSSFQQIYFF  285



>ref|XP_010189075.1| PREDICTED: gamma-glutamyl hydrolase [Mesitornis unicolor]
Length=325

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 162/294 (55%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   K  
Sbjct  38   NERPIIGILSQECHFDK---FHKFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIF  94

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG       EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  95   HSINGVLFPGGGVDLRTSEYARVAKIFYHKALEANDKGDYFPIWGTCLGHEELTYLTSGE  154

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             +++   + ++  S          +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  155  VLLVN--TKTDGFSLPLNFTSAAKDSRLFKNFPDDVLHAFATEPLTSNFHMWSLSVENFT  212

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+NVLTT+ D D   ++ST++  KYP+  VQW PE+N FEW  S  IPHS  A
Sbjct  213  KNEKLRNFYNVLTTNTD-DELEFISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSA  271

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++F++EARKS    P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  272  VKAAYYIADFFINEARKSLHRFPSEDEEAKELIYNYTPIYTGT-FSSFQQIYFF  324



>ref|XP_007231124.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X1 [Astyanax 
mexicanus]
Length=310

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/300 (37%), Positives = 171/300 (57%), Gaps = 24/300 (8%)
 Frame = -3

Query  998  NYRPVIGIVSH------PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
            N  PVIG+++       PG  A           YIAAS VK++ESAGA+V+P++ N   E
Sbjct  26   NDSPVIGVLAQEVYAPTPGKNA-----------YIAASYVKYLESAGAKVVPVMINRSEE  74

Query  836  TLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
               +    +NG++FPGG  S     Y +A    Y+  LE N  GD FP+    LGF+ LT
Sbjct  75   EYTRLFKSLNGILFPGGGASITSSGYAKAAGIFYRLALEANSKGDYFPVWGTCLGFEQLT  134

Query  662  IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
            ++ SE  ++L   + S  A  L     ++ +  +F+ FP +L+  +  E L   +H+W I
Sbjct  135  LLTSE-KLLLSHTNTSGVALPLNFTSEVS-DSRMFKDFPKDLMTSLANEPLTENSHQWSI  192

Query  482  SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
            + ESF+ +  L+ F+ +L+T+ D   K +VST++   YPV   QW PE+N FEW    IP
Sbjct  193  TTESFKGNEKLNKFYRILSTNTD-GQKEFVSTVEAYDYPVYGTQWHPEKNTFEWTRPYIP  251

Query  302  HSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIFS  126
            H+  AI  +  +A++FV+EA+KS  +  ++ + +D LIYNY+ SY+GK  S F ++Y F+
Sbjct  252  HTPSAIKTTFYMADFFVNEAKKSLHSFSSQEEEQDALIYNYSPSYTGK-MSAFEQIYYFA  310



>ref|XP_006634071.1| PREDICTED: gamma-glutamyl hydrolase-like [Lepisosteus oculatus]
Length=312

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 173/308 (56%), Gaps = 18/308 (6%)
 Frame = -3

Query  1025  GCPA----PDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPL  858
             GC +        +N RP+IG+++        + S    +SYIAAS VKF+ESAGARV+P+
Sbjct  15    GCASSAVFKTAKINDRPIIGVLAQ-----EIKSSENPEISYIAASYVKFLESAGARVVPV  69

Query  857   IYNEPTETLIKKLNLVNGVVFPGGSFE--KGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
               N+  E   K  N +NG + PGG        Y +A    Y+  ++ N  GD FP+    
Sbjct  70    RINQSQEDYEKLFNSINGFLLPGGGVNLISSGYAKAASVFYQLAIKANSEGDYFPIWGTC  129

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             LGF+ LT + S   I+L + + ++ A  L   +G   E  LF+ FP ELL  +  E +  
Sbjct  130   LGFEELTYLTS-GKILLVRTNTTSVALPLIFTKGAR-ESRLFKNFPTELLEALATESITE  187

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKV-YVSTIQGKKYPVVAVQWAPERNAF  327
              +H W +S E + +D  L  F+N+LTT  +KD K+ +VST++    P+   QW PE+NAF
Sbjct  188   NSHIWSLSVEKYNSDEKLRKFYNILTT--NKDEKLEFVSTMEAYDVPIYGTQWHPEKNAF  245

Query  326   EWALSEIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
             EW    IPHS +A+  +  +A++FV+EARK+  + P+E +    LIYNY   Y G + S 
Sbjct  246   EWTRPYIPHSPNAVKATFYMADFFVNEARKNFHHFPSEEEESKALIYNYIPVYKG-NHSA  304

Query  149   FVEVYIFS  126
             F ++YIFS
Sbjct  305   FEQIYIFS  312



>gb|KFW77964.1| Gamma-glutamyl hydrolase, partial [Manacus vitellinus]
Length=317

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 164/294 (56%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N +P+IGI++   D    +     G SYIAAS VKFVESAGAR +P+  N   E   +  
Sbjct  30   NDKPIIGILAQECDFGEFQ---GFGRSYIAASYVKFVESAGARAVPIRLNLTDEEYSRIF  86

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  87   HSINGVLFPGGGVDLKTSEYARVAKIFYHKALEANDNGDYFPVWGTCLGHEELTYLTSGE  146

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             +++   + +N  S          +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  147  VLLVN--TKTNGFSLPLNFTSAAKDSRLFRNFPDDVLHAFATEPLTSNFHMWSLSMENFT  204

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+NVLTT+ D D   ++ST++  +YP+ ++QW PE+N FEW  S  IPHS  A
Sbjct  205  NNEKLRNFYNVLTTNTD-DEVEFISTMEAYRYPIYSLQWHPEKNPFEWKNSPGIPHSPSA  263

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++FV+EARKS  + P+E +    LIYNY   Y+G   S F + Y F
Sbjct  264  VRAAYYMADFFVNEARKSLHHFPSEDEETKELIYNYAPVYTGT-FSAFQQTYFF  316



>ref|XP_006860125.1| PREDICTED: gamma-glutamyl hydrolase [Chrysochloris asiatica]
Length=316

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 171/291 (59%), Gaps = 11/291 (4%)
 Frame = -3

Query  992  RPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNL  813
            +P+IGI+       +   +N +G  YIAAS VK++ESAGARV+P+  +  T+   K    
Sbjct  33   KPIIGILMQ----NASMWTNVSGKYYIAASYVKYLESAGARVVPVRLDLTTQEYEKLFKS  88

Query  812  VNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNI  639
            +NG++FPGGS   +  +Y +  +  Y   L+  D GD FP+    LGF+ LT++VS  N+
Sbjct  89   INGILFPGGSVSLKNSDYAKVARIFYNSALKSFDDGDYFPVWGTCLGFEELTLLVSGKNL  148

Query  638  ILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQAD  459
            +    + +   S      G    G +F+ FP +LL  +  E L    HKW +S ++F ++
Sbjct  149  L--TLTETKSKSLPLNFTGGKYSGRMFRNFPADLLLSLSTEPLTANFHKWSLSMKNFTSN  206

Query  458  ADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIPHSEDAILV  279
              L +FFNV+TT+   DN  +VS+++G KYPV  VQW PE+  +EW +S I HS +A+  
Sbjct  207  KKLKSFFNVITTN-TADNLEFVSSVEGYKYPVYGVQWHPEKPPYEWGVSSISHSPNAVKT  265

Query  278  SQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +A +FVSEARK+++   ++ + R  LIY ++  YS K  S F ++Y+F
Sbjct  266  AFYLAEFFVSEARKNNHRFKSKDEERKALIYQFHPMYSEK-FSSFQQIYLF  315



>ref|XP_006113705.1| PREDICTED: gamma-glutamyl hydrolase [Pelodiscus sinensis]
Length=333

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 166/297 (56%), Gaps = 11/297 (4%)
 Frame = -3

Query  1007  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  828
             P  N RP+IGI++   D       +  G SYIAAS VKF+ESAGARV+P+  N   E   
Sbjct  43    PGSNERPIIGILAQECDFTG---FHRFGSSYIAASYVKFLESAGARVVPIRLNRTEEEYD  99

Query  827   KKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  654
             +    +NGV+FPGG    +  EY    K  Y K L+ ND GD FP+    LG++ LT + 
Sbjct  100   QIFQSINGVLFPGGGVDLKTSEYSRVAKMFYNKALQANDKGDYFPVWGTCLGYEELTYLT  159

Query  653   SEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPE  474
             SE+ ++L      + A  L     +     +F+ FP +LL+K+  E L    H W +S +
Sbjct  160   SEE-VLLTWTDTEDFAFPLNFTTAVK-SSRMFKNFPDDLLQKLATEPLTAHFHHWSLSMK  217

Query  473   SFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHS  297
             +F  +  L NF+ VLTT+   D + ++ST++  KYP+  VQW PE+N FEW +S  I  S
Sbjct  218   NFTNNEKLRNFYKVLTTNTHADVE-FISTMEAHKYPIYGVQWHPEKNPFEWKISAGISRS  276

Query  296   EDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
               A+ V+   A++ V+EARKS +  PN+ +    LIYNY   ++  + S F +VY F
Sbjct  277   PSAMKVAHYTADFLVNEARKSLHYFPNKDEETKALIYNYIPVFTA-EFSSFEQVYFF  332



>ref|XP_008171736.1| PREDICTED: LOW QUALITY PROTEIN: gamma-glutamyl hydrolase [Chrysemys 
picta bellii]
Length=326

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 170/298 (57%), Gaps = 16/298 (5%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI++      + R     G SYIAAS VKF+ESAGARV+P+      +   K  
Sbjct  37   NERPIIGILAQESLSKTFR---KYGKSYIAASYVKFIESAGARVVPIRLYRSEKEYDKIF  93

Query  818  NLVNG---VVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIV  654
               NG   V+FPGG  S +  EY    +  YKK L+ ND GD FP+    LG Q LT + 
Sbjct  94   KATNGXVLVLFPGGGVSLKTSEYARVARIFYKKALKANDKGDYFPVWGTCLGHQELTYLT  153

Query  653  SEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPE  474
            SE N+++ K    N +  L        +  +FQ FP +LL+K+  E L    HKW +S +
Sbjct  154  SEKNLLV-KTKTENISLPLTFTTAAK-DSRMFQNFPDDLLQKLATEPLTAHFHKWSLSMK  211

Query  473  SFQADADLSNFFNVLTTSLDKDNKV-YVSTIQGKKYPVVAVQWAPERNAFEWA-LSEIPH  300
            +F+ +  L NF+ VLTT  + D K+ + S+++  KYP+  VQW PE++ FEW  +S IPH
Sbjct  212  NFRKNEKLHNFYKVLTT--NTDGKIEFASSMEAYKYPIYGVQWHPEKSPFEWKNVSGIPH  269

Query  299  SEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            S  A+ V+  +A++ V+EARKS  + P++ +  + LIYNY   +S    S F ++Y F
Sbjct  270  SPSAVKVTYYIADFLVNEARKSLHHFPSKDEETEALIYNYVPVFSSA-FSIFQQIYFF  326



>gb|KFW02734.1| Gamma-glutamyl hydrolase, partial [Eurypyga helias]
Length=283

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  17   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  76

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND  D FPL    LG + LT + S   ++L        A  L        
Sbjct  77   KIFYHKALEANDKRDYFPLWGTCLGHEELTYLTS-GKVLLVNTKTEGFALPLNFTSAAK-  134

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FPY++L     E L    H W +S E+F  +  L NF+NVLTT+ D + + ++
Sbjct  135  DSRLFKNFPYDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTDGEVE-FI  193

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+ +VQW PE+N FEW  S  IPHS  A+  +  VA++F++EARKS    P+
Sbjct  194  STMEAYKYPIYSVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYVADFFINEARKSLHRFPS  253

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  254  EEEETKELIYNYTPIYTGT-FSSFQQIYFF  282



>gb|KFV06368.1| Gamma-glutamyl hydrolase, partial [Pterocles gutturalis]
Length=267

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  1    GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  60

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L      + 
Sbjct  61   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSA-SK  118

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF   P ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   +V
Sbjct  119  DSRLFSNLPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFV  177

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  178  STMEAYKYPIYGVQWHPEKNPFEWKHSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  237

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E D    LIYNY   Y+G   S F ++Y F
Sbjct  238  EDDETKELIYNYTPVYTGT-FSSFQQIYFF  266



>ref|XP_010147217.1| PREDICTED: gamma-glutamyl hydrolase, partial [Eurypyga helias]
Length=287

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  21   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  80

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND  D FPL    LG + LT + S   ++L        A  L        
Sbjct  81   KIFYHKALEANDKRDYFPLWGTCLGHEELTYLTS-GKVLLVNTKTEGFALPLNFTSAAK-  138

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FPY++L     E L    H W +S E+F  +  L NF+NVLTT+ D + + ++
Sbjct  139  DSRLFKNFPYDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTDGEVE-FI  197

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+ +VQW PE+N FEW  S  IPHS  A+  +  VA++F++EARKS    P+
Sbjct  198  STMEAYKYPIYSVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYVADFFINEARKSLHRFPS  257

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  258  EEEETKELIYNYTPIYTGT-FSSFQQIYFF  286



>gb|KFP45914.1| Gamma-glutamyl hydrolase, partial [Chlamydotis macqueenii]
Length=281

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/270 (42%), Positives = 150/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  76   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFAFPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  134  NSRLFKNFPDDVLHAFATEPLTSNFHVWSLSMENFTKNERLRNFYNVLTTNTD-DEVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSSSAVRAAYYIADFFVNEARKSLHRFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E D    LIYNY   Y+G   S F ++Y F
Sbjct  253  EDDETKELIYNYTPVYTGT-FSSFQQIYFF  281



>ref|XP_010127038.1| PREDICTED: gamma-glutamyl hydrolase, partial [Chlamydotis macqueenii]
Length=286

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 113/270 (42%), Positives = 150/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  21   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  80

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  81   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFAFPLNFTSAAK-  138

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  139  NSRLFKNFPDDVLHAFATEPLTSNFHVWSLSMENFTKNERLRNFYNVLTTNTD-DEVEFI  197

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    P+
Sbjct  198  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSSSAVRAAYYIADFFVNEARKSLHRFPS  257

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E D    LIYNY   Y+G   S F ++Y F
Sbjct  258  EDDETKELIYNYTPVYTGT-FSSFQQIYFF  286



>gb|KFR13230.1| Gamma-glutamyl hydrolase, partial [Opisthocomus hoazin]
Length=272

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFE--KGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG  +    EY    
Sbjct  6    GRSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLTTSEYSRIA  65

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  66   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  123

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP +LL     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  124  NSRLFKNFPDDLLHAFATEPLTSNFHMWSLSMENFTKNEKLHNFYNVLTTNTD-DQVEFI  182

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  183  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  242

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  243  EDEETKELIYNYTPVYTGT-FSSFQQIYFF  271



>ref|XP_009632417.1| PREDICTED: gamma-glutamyl hydrolase, partial [Egretta garzetta]
Length=283

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 153/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  17   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  76

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  77   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  134

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP++LL  +  E L    H W +S E+F  +  L +F+NVLTT+ D D   ++
Sbjct  135  DSRLFKNFPHDLLHALATEPLTSNFHMWSLSLENFTKNEKLRDFYNVLTTNTD-DGVEFI  193

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+  FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  194  STMEAYKYPIYGVQWHPEKTPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  253

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  254  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  282



>ref|XP_010016975.1| PREDICTED: gamma-glutamyl hydrolase, partial [Nestor notabilis]
Length=281

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 153/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  15   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  74

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S   ++L     +  A  L        
Sbjct  75   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS-GKVLLANTKTNGFALPLNFTSAAK-  132

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP +LL  +  E L    H W +S E+F  + +L NF+NVLTT+ + D   ++
Sbjct  133  NSRLFKNFPDDLLHALATEPLTSNFHTWSLSLENFTKNEELHNFYNVLTTNTN-DQVEFI  191

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  192  STMEAYKYPIYGVQWHPEKNPFEWKSSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  251

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  252  EAEETKELIYNYIPLYTGT-FSSFQQIYFF  280



>gb|KFQ53384.1| Gamma-glutamyl hydrolase, partial [Nestor notabilis]
Length=282

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 153/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S   ++L     +  A  L        
Sbjct  76   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTS-GKVLLANTKTNGFALPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP +LL  +  E L    H W +S E+F  + +L NF+NVLTT+ + D   ++
Sbjct  134  NSRLFKNFPDDLLHALATEPLTSNFHTWSLSLENFTKNEELHNFYNVLTTNTN-DQVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKSSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  253  EAEETKELIYNYIPLYTGT-FSSFQQIYFF  281



>gb|KFU88050.1| Gamma-glutamyl hydrolase, partial [Chaetura pelagica]
Length=282

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 154/273 (56%), Gaps = 8/273 (3%)
 Frame = -3

Query  935  NATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYL  762
            N  G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY 
Sbjct  13   NKFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYS  72

Query  761  EALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEG  582
               K  Y K LE ND GD FP+    LG + LT + S + ++L     +  A  L     
Sbjct  73   RVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSSE-VLLVNTKTNGFALPLNFTSA  131

Query  581  LNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNK  402
               +  LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D + +
Sbjct  132  AK-DSRLFKNFPDDVLHAFATEPLTSNFHVWSLSMENFTKNEKLRNFYNVLTTNTDGEVE  190

Query  401  VYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SN  228
             ++ST++  KYPV  VQW PE++ FEW  S  IPHS  A+  S  +A++F++EARKS   
Sbjct  191  -FISTMEAYKYPVYGVQWHPEKSPFEWKSSPGIPHSPSAVRASYYMADFFINEARKSFHR  249

Query  227  VPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             PNE +    LIYNY   Y+G   S F ++Y F
Sbjct  250  FPNEDEETKELIYNYAPIYTGT-FSSFQQIYFF  281



>gb|KFP12067.1| Gamma-glutamyl hydrolase, partial [Egretta garzetta]
Length=282

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 153/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  76   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP++LL  +  E L    H W +S E+F  +  L +F+NVLTT+ D D   ++
Sbjct  134  DSRLFKNFPHDLLHALATEPLTSNFHMWSLSLENFTKNEKLRDFYNVLTTNTD-DGVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+  FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  193  STMEAYKYPIYGVQWHPEKTPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  253  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  281



>ref|XP_009993891.1| PREDICTED: gamma-glutamyl hydrolase [Chaetura pelagica]
Length=296

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 154/273 (56%), Gaps = 8/273 (3%)
 Frame = -3

Query  935  NATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYL  762
            N  G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY 
Sbjct  27   NKFGSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYS  86

Query  761  EALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEG  582
               K  Y K LE ND GD FP+    LG + LT + S + ++L     +  A  L     
Sbjct  87   RVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSSE-VLLVNTKTNGFALPLNFTSA  145

Query  581  LNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNK  402
               +  LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D + +
Sbjct  146  AK-DSRLFKNFPDDVLHAFATEPLTSNFHVWSLSMENFTKNEKLRNFYNVLTTNTDGEVE  204

Query  401  VYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SN  228
             ++ST++  KYPV  VQW PE++ FEW  S  IPHS  A+  S  +A++F++EARKS   
Sbjct  205  -FISTMEAYKYPVYGVQWHPEKSPFEWKSSPGIPHSPSAVRASYYMADFFINEARKSFHR  263

Query  227  VPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
             PNE +    LIYNY   Y+G   S F ++Y F
Sbjct  264  FPNEDEETKELIYNYAPIYTGT-FSSFQQIYFF  295



>ref|XP_005652325.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27781.1| class I glutamine amidotransferase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=324

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 164/287 (57%), Gaps = 12/287 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N R +IG++S P D A GR       SYIAAS VKF+E+AGARV+P +++     + ++ 
Sbjct  13   NNRVLIGLLSQPSDPA-GRHE-----SYIAASYVKFLEAAGARVVPFVHDMDKAEIKRRF  66

Query  818  NLVNGVVFPGGS--FEKGE-YLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSE  648
            +++NG + PGGS     G  + +   E+ +   E ND GD FP+LAI LGF+ L +I S 
Sbjct  67   DMINGFLIPGGSARLSPGHTFFDTATEVVRLANEANDNGDYFPILAICLGFETLAVIASG  126

Query  647  DNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESF  468
            +  IL  + + + A+ L   E   +    F     E++  +  +    ++H  G+S  SF
Sbjct  127  NTSILGSYDSEDTAAPLYFTEKA-LGSRFFGSLRPEIVADLAAKPYARESHSHGLSLASF  185

Query  467  QADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIPHSED  291
             AD  L   + VL+ S D + +VY+ST++ KKYP  A QW PE+NAFEW     IPHS+ 
Sbjct  186  DADKVLKEEYEVLSLSTDPEGEVYISTMESKKYPYTATQWHPEKNAFEWGDKLHIPHSKG  245

Query  290  AILVSQSVANYFVSEARKSSNVPNEPDVRDN-LIYNYNTSYSGKDGS  153
            AI V+ +VA++FV EAR S + P +    DN LIY     ++G+  S
Sbjct  246  AIDVTYAVASFFVDEARGSFHAPRDVIEEDNALIYGARLEFTGRHTS  292



>gb|KFP55993.1| Gamma-glutamyl hydrolase, partial [Cathartes aura]
Length=282

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  76   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTEGFALPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  134  DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNDKLRNFYNVLTTNTD-DEVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  253  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  281



>ref|XP_002595632.1| hypothetical protein BRAFLDRAFT_275357 [Branchiostoma floridae]
 gb|EEN51644.1| hypothetical protein BRAFLDRAFT_275357 [Branchiostoma floridae]
Length=318

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 166/286 (58%), Gaps = 11/286 (4%)
 Frame = -3

Query  1007  PSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLI  828
             P +N RP+IG+++   +GA  +     G +YI AS VK++ESAGARV+P+  N  T    
Sbjct  27    PEVNDRPIIGVIAQASEGARAKF----GKTYIPASYVKYLESAGARVVPIRVNLTTAEYT  82

Query  827   KKLNLVNGVVFPGGS---FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTII  657
             K  N +NGV++PGG    F  G Y ++ K  Y   L+  D GD FP+    +GF+ LT +
Sbjct  83    KLFNSLNGVLYPGGGVDMFTSG-YAKSAKIFYDLALKAFDEGDYFPVWGTCMGFEQLTAL  141

Query  656   VSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISP  477
              S  N++       N++  L   +       +F + P ++L  +    L    H++ ++P
Sbjct  142   TSNRNVLTTCKGTGNKSYKLNFSKDYK-SSRMFGKVPVDILTDMATLPLTPNFHEYCLTP  200

Query  476   ESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW-ALSEIPH  300
             ++F  DA L +F+ +L+T+ D D+  +VS+++  KYPV  VQW PE+N FE+ +L +I H
Sbjct  201   QNFTDDAKLKSFYKILSTNTDDDDMEFVSSMEAIKYPVYGVQWHPEKNNFEFGSLLKITH  260

Query  299   SEDAILVSQSVANYFVSEARKSSN-VPNEPDVRDNLIYNYNTSYSG  165
             S+ A  VSQ++AN+ VSEARKS++  P   +    LIYNY   Y+G
Sbjct  261   SDAATRVSQAMANFLVSEARKSAHKFPTPAEEGAALIYNYAPVYTG  306



>ref|XP_005152793.1| PREDICTED: gamma-glutamyl hydrolase [Melopsittacus undulatus]
Length=323

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/307 (38%), Positives = 168/307 (55%), Gaps = 19/307 (6%)
 Frame = -3

Query  1037  KLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPL  858
             +L+GG        N RP++GI++           +  G SYIAAS VKF+ESAGARV+P+
Sbjct  31    RLAGG--------NERPIVGILAQE---CHFDKFHRFGSSYIAASYVKFLESAGARVMPI  79

Query  857   IYNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAIN  684
               N   E   K  + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    
Sbjct  80    RLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTC  139

Query  683   LGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVM  504
             LG + LT + S   ++L     +  A  L           LF+ FP ++L  +  E L  
Sbjct  140   LGHEELTYLTS-GKVLLVNTKTNGFALPLNFTSAAKT-SRLFKNFPDDVLHALAAEPLTS  197

Query  503   QNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFE  324
               H W +S E+F  + +L NF+NVLTT+ + D   ++ST++  KYP+  VQW PE++ FE
Sbjct  198   NFHMWSLSLENFTKNEELRNFYNVLTTNTN-DQVEFISTMEAYKYPIYGVQWHPEKSPFE  256

Query  323   WALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSG  150
             W  S  IPHS  A+  +  +A++F++EARKS  + P+E +    LIYNY   Y+G   S 
Sbjct  257   WKSSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSEAEETKELIYNYTPVYTGT-FSS  315

Query  149   FVEVYIF  129
             F ++Y F
Sbjct  316   FQQIYFF  322



>ref|XP_009936040.1| PREDICTED: gamma-glutamyl hydrolase [Opisthocomus hoazin]
Length=295

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGGSFE--KGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG  +    EY    
Sbjct  29   GRSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLTTSEYSRIA  88

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  89   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  146

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP +LL     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  147  NSRLFKNFPDDLLHAFATEPLTSNFHMWSLSMENFTKNEKLHNFYNVLTTNTD-DQVEFI  205

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+
Sbjct  206  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPS  265

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  266  EDEETKELIYNYTPVYTGT-FSSFQQIYFF  294



>ref|XP_008918537.1| PREDICTED: gamma-glutamyl hydrolase [Manacus vitellinus]
Length=381

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 164/294 (56%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N +P+IGI++   D    +     G SYIAAS VKFVESAGAR +P+  N   E   +  
Sbjct  94   NDKPIIGILAQECDFGEFQ---GFGRSYIAASYVKFVESAGARAVPIRLNLTDEEYSRIF  150

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  151  HSINGVLFPGGGVDLKTSEYARVAKIFYHKALEANDNGDYFPVWGTCLGHEELTYLTSGE  210

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             +++   + +N  S          +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  211  VLLVN--TKTNGFSLPLNFTSAAKDSRLFRNFPDDVLHAFATEPLTSNFHMWSLSMENFT  268

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+NVLTT+ D D   ++ST++  +YP+ ++QW PE+N FEW  S  IPHS  A
Sbjct  269  NNEKLRNFYNVLTTNTD-DEVEFISTMEAYRYPIYSLQWHPEKNPFEWKNSPGIPHSPSA  327

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++FV+EARKS  + P+E +    LIYNY   Y+G   S F + Y F
Sbjct  328  VRAAYYMADFFVNEARKSLHHFPSEDEETKELIYNYAPVYTGT-FSAFQQTYFF  380



>ref|XP_010071123.1| PREDICTED: gamma-glutamyl hydrolase, partial [Pterocles gutturalis]
Length=265

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 150/268 (56%), Gaps = 8/268 (3%)
 Frame = -3

Query  920  SYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEALKE  747
            SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    K 
Sbjct  1    SYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVAKI  60

Query  746  IYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEG  567
             Y K LE ND GD FP+    LG + LT + S + ++L        A  L      + + 
Sbjct  61   FYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSA-SKDS  118

Query  566  TLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVST  387
             LF   P ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   +VST
Sbjct  119  RLFSNLPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFVST  177

Query  386  IQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPNEP  213
            ++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS  + P+E 
Sbjct  178  MEAYKYPIYGVQWHPEKNPFEWKHSPGIPHSPSAVRAAYYIADFFINEARKSLHHFPSED  237

Query  212  DVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            D    LIYNY   Y+G   S F ++Y F
Sbjct  238  DETKELIYNYTPVYTGT-FSSFQQIYFF  264



>ref|XP_005988287.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X2 [Latimeria 
chalumnae]
Length=318

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 171/306 (56%), Gaps = 10/306 (3%)
 Frame = -3

Query  1034  LSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLI  855
              SG   AP  + N RP+IGI++   + A   +    G +Y+AAS VK++ESAG RV+P+ 
Sbjct  19    FSGVLAAPSGNRNERPIIGILTQETEDA---VLKPFGKTYVAASYVKYLESAGCRVMPVR  75

Query  854   YNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINL  681
              N       K  N +NG++FPGG+   E  ++ +A +  Y   ++  D GD FP+    L
Sbjct  76    LNLTFSEYEKIFNSINGILFPGGAVNLENSDFAKAARIFYSLAIKAYDSGDYFPIWGTCL  135

Query  680   GFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQ  501
             G QLLT++ +  N+ L   S  N A  L +         +F  FP EL++ + +E L   
Sbjct  136   GLQLLTVLTAGKNL-LTNTSTENIALALNLTSSAQ-SSRMFHDFPPELMKALSKEPLTGN  193

Query  500   NHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEW  321
              H + I+ ++FQ +  L +F++VL+T+ D     +VST++G KYP+  VQW PE N F W
Sbjct  194   FHHYSIATQTFQRNIKLRHFYSVLSTNTDMYGVEFVSTMEGIKYPMYGVQWHPEVNRFLW  253

Query  320   ALS-EIPHSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGF  147
                   PHS  A+ +S  +A++FV+EARKS    P+  + +  LIYNY+  Y G   S +
Sbjct  254   EKDLAFPHSAKAVQLSSQLADFFVNEARKSFHRFPSAEEEKAALIYNYSPIYVGNICS-Y  312

Query  146   VEVYIF  129
             ++VY F
Sbjct  313   MQVYFF  318



>gb|KFV00608.1| Gamma-glutamyl hydrolase, partial [Tauraco erythrolophus]
Length=285

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 150/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  19   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  78

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + L+ + S + ++L        A  L        
Sbjct  79   KIFYHKALEANDKGDYFPIWGTCLGHEELSYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  136

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L  F+NVLTT+ D D   ++
Sbjct  137  DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRTFYNVLTTNTD-DEVEFI  195

Query  392  STIQGKKYPVVAVQWAPERNAFEWALS-EIPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    PN
Sbjct  196  STMEAYKYPIYGVQWHPEKNPFEWKNSPAIPHSPSAVRAAYYIADFFVNEARKSLHRFPN  255

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  256  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  284



>gb|KGL97086.1| Gamma-glutamyl hydrolase, partial [Charadrius vociferus]
Length=282

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L     +  A  L        
Sbjct  76   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTNGFALPLNFTSAAKT  134

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  135  -SRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS    P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVKAAYYIADFFINEARKSLHRFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  253  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  281



>gb|ACI68420.1| Gamma-glutamyl hydrolase precursor [Salmo salar]
Length=317

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 179/299 (60%), Gaps = 11/299 (4%)
 Frame = -3

Query  1013  PDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTET  834
             P P +N RP+IGI++         +    G +YI AS VK++ESAG+RV+P+   + T+ 
Sbjct  26    PGP-VNNRPIIGILTQE---VEDDVMKPFGKTYIPASYVKYIESAGSRVLPIRLTQSTDE  81

Query  833   LIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
                    +NG++  GGS   E  ++ +     Y+  L+ ND GD+FP+    LG QLLT 
Sbjct  82    YENIFKSINGLLLIGGSSDLETSDFAKVAGIFYRLALKANDAGDSFPIWGTCLGMQLLTC  141

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             +V+ +N+ L K +A N A  L + +  +    +FQ FP ++++ + +E L    H++G++
Sbjct  142   LVAGENL-LTKTTAENMALPLNLTKEAH-SSQMFQGFPIDVMKALSQEALTGNFHQYGVT  199

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIP  303
              ++F+ +  L +FF++L+T+  ++  ++VST++G+ YP   VQW PE N F+W      P
Sbjct  200   VKTFKENEKLQSFFSILSTNTAENGAIFVSTMEGRTYPFYGVQWHPEVNRFQWDPKLNFP  259

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSGFVEVYIF  129
             HS DA+ V+  +A +FV+E R+S +  ++P+    +LIYNY  +Y+G + +G+ ++Y F
Sbjct  260   HSSDAVRVASLLAEFFVNEGRRSLHHFDQPEEEAVSLIYNYTPTYAG-NFTGYEQIYFF  317



>ref|XP_009979902.1| PREDICTED: gamma-glutamyl hydrolase, partial [Tauraco erythrolophus]
Length=290

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 150/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  24   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  83

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + L+ + S + ++L        A  L        
Sbjct  84   KIFYHKALEANDKGDYFPIWGTCLGHEELSYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  141

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L  F+NVLTT+ D D   ++
Sbjct  142  DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRTFYNVLTTNTD-DEVEFI  200

Query  392  STIQGKKYPVVAVQWAPERNAFEWALS-EIPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS    PN
Sbjct  201  STMEAYKYPIYGVQWHPEKNPFEWKNSPAIPHSPSAVRAAYYIADFFVNEARKSLHRFPN  260

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  261  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  289



>emb|CDQ81962.1| unnamed protein product [Oncorhynchus mykiss]
Length=317

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 178/299 (60%), Gaps = 11/299 (4%)
 Frame = -3

Query  1013  PDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTET  834
             P P +N RP+IGI++         +    G +YI AS VK++ESAG+RV+P+   + T  
Sbjct  26    PGP-VNNRPIIGILTQE---VEDDVMKPFGKTYIPASYVKYIESAGSRVVPIRLTQSTAE  81

Query  833   LIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTI  660
               K    +NG++  GGS   E   + +     Y+  L+ ND GD+FP+    LG QLLT 
Sbjct  82    YEKIFKSINGLLLIGGSSDLETSVFAKVAGIFYRLALKANDAGDSFPIWGTCLGMQLLTC  141

Query  659   IVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGIS  480
             +V+ +N+ L K +A N A  L + +  +    +FQ FP ++++ + +E L    H++G++
Sbjct  142   LVAGENL-LTKTTAENMALPLNLTKEAH-SSQMFQGFPSDVMKALSQEALTGNFHQYGVT  199

Query  479   PESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALS-EIP  303
              ++F+ +  L +FF++L+T+  ++  ++VST++G+ YP   VQW PE N F+W      P
Sbjct  200   MKTFKENEKLQSFFSILSTNTAENGAIFVSTMEGRTYPFYGVQWHPEVNRFQWDPKLNFP  259

Query  302   HSEDAILVSQSVANYFVSEARKSSNVPNEPDVRD-NLIYNYNTSYSGKDGSGFVEVYIF  129
             HS DA+ V+  +A +FV+E R+S +  ++P+    +LIYNY  +Y+G + +G+ ++Y F
Sbjct  260   HSSDAVRVASLLAEFFVNEGRRSLHHFDQPEEEAVSLIYNYTPTYAG-NFTGYEQIYFF  317



>gb|KFO77933.1| Gamma-glutamyl hydrolase, partial [Cuculus canorus]
Length=282

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   +   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDDEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L   +    A  L        
Sbjct  76   KIFYHKALEANDKGDYFPIWGTCLGHEELTYLTSGE-VLLVNTNTDGFALPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            E  LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  134  ESRLFKNFPDDVLHAFATEPLTSNFHVWSLSMENFTKNEKLRNFYNVLTTNTD-DGVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKSSNV-PN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS +  P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHCYPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F + Y F
Sbjct  253  EEEETKELIYNYTPFYTGT-FSAFQQTYFF  281



>ref|XP_007231126.1| PREDICTED: gamma-glutamyl hydrolase-like isoform X3 [Astyanax 
mexicanus]
Length=310

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 170/299 (57%), Gaps = 24/299 (8%)
 Frame = -3

Query  998  NYRPVIGIVSH------PGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTE  837
            N  PVIG+++       PG  A           YIAAS VK++ESAGA+V+P++ N   E
Sbjct  26   NDSPVIGVLAQEVYAPTPGKNA-----------YIAASYVKYLESAGAKVVPVMINRSEE  74

Query  836  TLIKKLNLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLT  663
               +    +NG++FPGG  S     Y +A    Y+  LE N  GD FP+    LGF+ LT
Sbjct  75   EYTRLFKSLNGILFPGGGASITSSGYAKAAGIFYRLALEANSKGDYFPVWGTCLGFEQLT  134

Query  662  IIVSEDNIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGI  483
            ++ SE  ++L   + S  A  L     ++ +  +F+ FP +L+  +  E L   +H+W I
Sbjct  135  LLTSE-KLLLSHTNTSGVALPLNFTSEVS-DSRMFKDFPKDLMTSLANEPLTENSHQWSI  192

Query  482  SPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSEIP  303
            + ESF+ +  L+ F+ +L+T+ D   K +VST++   YPV   QW PE+N FEW    IP
Sbjct  193  TTESFKGNEKLNKFYRILSTNTD-GQKEFVSTVEAYDYPVYGTQWHPEKNTFEWTRPYIP  251

Query  302  HSEDAILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            H+  AI  +  +A++FV+EA+KS  +  ++ + ++ LIYNY+ SY+GK  S F ++Y F
Sbjct  252  HTPSAIKTTFYMADFFVNEAKKSLHSFSSQEEEQNALIYNYSPSYTGKT-SIFEQIYYF  309



>ref|XP_008945346.1| PREDICTED: gamma-glutamyl hydrolase, partial [Merops nubicus]
Length=281

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 153/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  15   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  74

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  75   KIFYHKALEANDRGDYFPVWGTCLGHEELTYLTSGE-VLLANTKTQGVALPLNFTSAAK-  132

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L +F+NVLTT+ D + + ++
Sbjct  133  DSRLFKNFPDDILHAFATEPLTANFHMWSLSMENFTKNEKLHDFYNVLTTNRDGEME-FI  191

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKSSN-VPN  219
            ST++  KYP+  VQW PE++ FEW +S  IPHS  A+  +  +A++FV+EARKS +  P+
Sbjct  192  STMEAYKYPIYGVQWHPEKSPFEWKISPGIPHSPSAVRAAYYIADFFVNEARKSQHRFPS  251

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F + Y F
Sbjct  252  EDEETRELIYNYTPIYTGT-FSSFQQTYFF  280



>gb|KFQ20983.1| Gamma-glutamyl hydrolase, partial [Merops nubicus]
Length=284

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 153/270 (57%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  18   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  77

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  78   KIFYHKALEANDRGDYFPVWGTCLGHEELTYLTSGE-VLLANTKTQGVALPLNFTSAAK-  135

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L +F+NVLTT+ D + + ++
Sbjct  136  DSRLFKNFPDDILHAFATEPLTANFHMWSLSMENFTKNEKLHDFYNVLTTNRDGEME-FI  194

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKSSN-VPN  219
            ST++  KYP+  VQW PE++ FEW +S  IPHS  A+  +  +A++FV+EARKS +  P+
Sbjct  195  STMEAYKYPIYGVQWHPEKSPFEWKISPGIPHSPSAVRAAYYIADFFVNEARKSQHRFPS  254

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F + Y F
Sbjct  255  EDEETRELIYNYTPIYTGT-FSSFQQTYFF  283



>ref|XP_008354553.1| PREDICTED: gamma-glutamyl hydrolase 2-like [Malus domestica]
Length=236

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = -3

Query  1052  LNTNWKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGA  873
             L T+   S  C APDP  NYRPVIGI+SHPGDGASGR SNA+  SYIAAS V FVESAGA
Sbjct  70    LGTSDSSSSKCTAPDPKXNYRPVIGILSHPGDGASGRXSNASTASYIAASYVXFVESAGA  129

Query  872   RVIPLIYNEPTETLIKKLNLVNGVVFPGGSFEKGEYLEALKEIYKKVLEKNDGGDNFPLL  693
             RVIPLIYNEP + L +KL+LVNGV+F GG  + G Y +  + I+KK++EKND GD+FPL 
Sbjct  130   RVIPLIYNEPPDILFQKLDLVNGVLFTGGWAKSGLYYDVAERIFKKIIEKNDXGDHFPLY  189

Query  692   AINLGFQLLTIIVSEDNIILEK--FSASNQASTLQV  591
             AI LGF+LL +I+S+ N + +   F   N AS+ ++
Sbjct  190   AICLGFELLAMIISKVNYLSQSTLFFPKNSASSFKL  225



>gb|KFZ55994.1| Gamma-glutamyl hydrolase, partial [Podiceps cristatus]
Length=282

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K    +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFRSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K +E ND GD FP+    LG + LT + S + +++   + ++  S          
Sbjct  76   KIFYHKAIEANDKGDYFPVWGTCLGHEELTYLTSGEVLLVN--TKTDGFSLPLNFTSAAK  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   Y+
Sbjct  134  DSRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEYI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS  + P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVKAAYYIADFFVNEARKSLHHFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F + Y F
Sbjct  253  EDEETKELIYNYTPIYTGT-FSSFQQTYFF  281



>ref|XP_005517480.1| PREDICTED: gamma-glutamyl hydrolase [Pseudopodoces humilis]
Length=431

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/294 (40%), Positives = 161/294 (55%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S              G SYIAAS VKFVESAGAR +P+  N   E   K  
Sbjct  144  NDRPIIGILSQECHFDE---YQRFGRSYIAASYVKFVESAGARAVPIRLNLTDEEYDKLF  200

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+ PGG       EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  201  HSINGVLLPGGGVDLRTSEYSRVAKIFYHKALEANDKGDYFPIWGTCLGHEELTYLTSGE  260

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             +++   + +N  S          +  +F+ FP +LLR +  E L    H W +S E+F 
Sbjct  261  ILLVR--TKTNGFSLPLNFTSAAKDSKMFRNFPDDLLRSLATEPLTSNFHVWSLSMENFT  318

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+NVLTT+ D D   ++ST++  KYP+  +QW PE+N FEW  S  IPHS  A
Sbjct  319  NNEKLRNFYNVLTTNTD-DEVEFISTMEAYKYPIYGMQWHPEKNPFEWKDSPGIPHSPSA  377

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++FV+EARKS  +  +E +    LIYNYN  Y+G   S F + Y F
Sbjct  378  VRAAYYMADFFVNEARKSMHHFSSEDEETKELIYNYNPVYTGT-FSAFQQTYFF  430



>gb|KFV70089.1| Gamma-glutamyl hydrolase, partial [Picoides pubescens]
Length=315

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 161/294 (55%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   +  
Sbjct  28   NERPIIGILSQECHYDK---FHKFGSSYIAASYVKFLESAGARVVPVRLNLSDEEYDRIF  84

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  85   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE  144

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             ++L        A  L        +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  145  -VLLTNTKTEGAALPLNFTPAAK-DSRLFKSFPADVLHAFATEPLTSNFHMWSLSMENFT  202

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L +F+ VLTT+ D + + ++ST++  KYP+  VQW PE+N FEW  S  IPHS  A
Sbjct  203  KNEKLHDFYKVLTTNRDGEVE-FISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSA  261

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++F++EARKS    P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  262  VRAAYYIADFFINEARKSLHRFPSEEEETKALIYNYTPIYTGT-FSSFQQIYFF  314



>ref|XP_009888091.1| PREDICTED: gamma-glutamyl hydrolase [Charadrius vociferus]
Length=299

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  33   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  92

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L     +  A  L        
Sbjct  93   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTNGFALPLNFTSAAKT  151

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  152  -SRLFKNFPDDVLHAFATEPLTSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFI  209

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS    P+
Sbjct  210  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVKAAYYIADFFINEARKSLHRFPS  269

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  270  EDEETKELIYNYTPIYTGT-FSSFQQIYFF  298



>ref|XP_009902444.1| PREDICTED: gamma-glutamyl hydrolase [Picoides pubescens]
Length=324

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 161/294 (55%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S           +  G SYIAAS VKF+ESAGARV+P+  N   E   +  
Sbjct  37   NERPIIGILSQECHYDK---FHKFGSSYIAASYVKFLESAGARVVPVRLNLSDEEYDRIF  93

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NGV+FPGG    +  EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  94   HSINGVLFPGGGVDLKTSEYSRVAKIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE  153

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
             ++L        A  L        +  LF+ FP ++L     E L    H W +S E+F 
Sbjct  154  -VLLTNTKTEGAALPLNFTPAAK-DSRLFKSFPADVLHAFATEPLTSNFHMWSLSMENFT  211

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L +F+ VLTT+ D + + ++ST++  KYP+  VQW PE+N FEW  S  IPHS  A
Sbjct  212  KNEKLHDFYKVLTTNRDGEVE-FISTMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSA  270

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++F++EARKS    P+E +    LIYNY   Y+G   S F ++Y F
Sbjct  271  VRAAYYIADFFINEARKSLHRFPSEEEETKALIYNYTPIYTGT-FSSFQQIYFF  323



>ref|XP_009971297.1| PREDICTED: gamma-glutamyl hydrolase, partial [Tyto alba]
Length=281

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  15   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  74

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  75   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  132

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+  P ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   +V
Sbjct  133  DSRLFKNLPDDVLHAFATEPLTSNFHIWSLSMENFTKNEKLRNFYNVLTTNTD-DELEFV  191

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS  + P+
Sbjct  192  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPAAVRAAYHIADFFVNEARKSLHHFPS  251

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  252  EDEETKELIYNYTPVYTGT-FSSFQQIYFF  280



>ref|XP_005423104.1| PREDICTED: gamma-glutamyl hydrolase, partial [Geospiza fortis]
Length=310

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 160/294 (54%), Gaps = 11/294 (4%)
 Frame = -3

Query  998  NYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKL  819
            N RP+IGI+S        +     G SYIAAS VKFVESAGAR +P+  N   E   K  
Sbjct  23   NDRPIIGILSQECHFDEYQ---QFGRSYIAASYVKFVESAGARAVPIRLNLTDEEYDKLF  79

Query  818  NLVNGVVFPGG--SFEKGEYLEALKEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSED  645
            + +NG++ PGG       EY    K  Y K LE ND GD FP+    LG + LT + S +
Sbjct  80   HSINGILLPGGGVDLRTSEYSRVAKMFYHKALEANDKGDYFPIWGTCLGHEELTYLTSGE  139

Query  644  NIILEKFSASNQASTLQVVEGLNVEGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQ  465
              IL   + +N  S          +  +F+ FP ++L  +  E L    H W +S E+F 
Sbjct  140  --ILLVHTKTNGFSLPLNFTSAAKDSRMFRNFPDDVLYALATEPLTSNFHVWSLSMENFT  197

Query  464  ADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDA  288
             +  L NF+ VLTT+ D D   ++ST++  KYP+  +QW PE+N FEW  S  IPHS  A
Sbjct  198  NNEKLRNFYKVLTTNTD-DEVEFISTMEAYKYPIYGMQWHPEKNPFEWKDSPGIPHSPSA  256

Query  287  ILVSQSVANYFVSEARKS-SNVPNEPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            +  +  +A++FV+EARKS  +  +E +    LIYNYN  Y+GK  S F + Y F
Sbjct  257  VRAAYYMADFFVNEARKSMHHFSSEEEEAKELIYNYNPVYTGK-FSAFQQTYFF  309



>ref|XP_009501530.1| PREDICTED: gamma-glutamyl hydrolase, partial [Phalacrocorax carbo]
Length=281

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  15   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  74

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  75   KIFYHKALEANDKGDYFPIWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  132

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  133  DSRLFRNFPDDVLHAFATEPLSSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFI  191

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+ +VQW PE+N FEW  S  IPHS   +  +  +A++F++EARKS  + P+
Sbjct  192  STMEAYKYPIYSVQWHPEKNPFEWKNSPGIPHSPSGVRAAYYIADFFINEARKSLHHFPS  251

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  252  EEEEAKELIYNYTPIYTGT-FSSFQQIYFF  280



>ref|XP_003999883.1| PREDICTED: gamma-glutamyl hydrolase [Felis catus]
Length=318

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/318 (36%), Positives = 172/318 (54%), Gaps = 31/318 (10%)
 Frame = -3

Query  1040  WKLSGGCPAPDPSLNYRPVIGIVSHPGDGASGRISNATGVSYIAASNVKFVESAGARVIP  861
             W  S G  AP  S + +P+IG++         +   + G  YIAAS VK++ESAGARV+P
Sbjct  17    WAASPGLCAPRASTSEKPIIGVLMQ----TCSKDMKSLGKYYIAASYVKYLESAGARVVP  72

Query  860   LIYNEPTETLIKKLNLVNGVVFPGGS--FEKGEYLEALKEIYKKVLEKNDGGDNFPLLAI  687
             +  +       +    +NG++FPGGS   +K  Y  A K+ Y   ++  D GD FP+   
Sbjct  73    IRPDLTKAEYERLFRSINGILFPGGSANLKKSGYALAAKKFYDLAIQSFDDGDYFPVWGT  132

Query  686   NLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV---------EGTLFQRFPYELL  534
              LGF+ L+ ++S + ++           TL   EG+ +         +  +FQ FP +LL
Sbjct  133   CLGFEELSYLISGECLL-----------TLTKTEGVTMPLNFTKGAFQSRMFQNFPADLL  181

Query  533   RKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYVSTIQGKKYPVVAV  354
               +  E L    HKW +S  +F  +  L  FFNVLTT+ D   + ++ST++G KYPV  V
Sbjct  182   MSLSLEPLTANFHKWSLSMTNFTMNEKLKKFFNVLTTNTDGKTE-FISTMEGYKYPVYGV  240

Query  353   QWAPERNAFEWA-LSEIPHSEDAILVSQSVANYFVSEARKSSNVPNEPDVRDN--LIYNY  183
             QW PE+  +EW  L  I H+ +A++ +  +A +FV+EARK+S+   E DV +N  LIY +
Sbjct  241   QWHPEKAPYEWGKLEGISHAPNAVMAAFYLAEFFVAEARKNSH-HFESDVEENKALIYQF  299

Query  182   NTSYSGKDGSGFVEVYIF  129
                Y+G   S F + YIF
Sbjct  300   RPVYTGNISSSFQQSYIF  317



>gb|KFV58816.1| Gamma-glutamyl hydrolase, partial [Tyto alba]
Length=282

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  76   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+  P ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   +V
Sbjct  134  DSRLFKNLPDDVLHAFATEPLTSNFHIWSLSMENFTKNEKLRNFYNVLTTNTD-DELEFV  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++FV+EARKS  + P+
Sbjct  193  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPAAVRAAYHIADFFVNEARKSLHHFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  253  EDEETKELIYNYTPVYTGT-FSSFQQIYFF  281



>gb|KFW90224.1| Gamma-glutamyl hydrolase, partial [Phalacrocorax carbo]
Length=282

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 152/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  16   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKIFHSINGVLFPGGGVDLKTSEYSRVA  75

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  76   KIFYHKALEANDKGDYFPIWGTCLGHEELTYLTSGE-VLLVNTKTDGFALPLNFTSAAK-  133

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
            +  LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   ++
Sbjct  134  DSRLFRNFPDDVLHAFATEPLSSNFHMWSLSMENFTKNEKLRNFYNVLTTNTD-DEVEFI  192

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+ +VQW PE+N FEW  S  IPHS   +  +  +A++F++EARKS  + P+
Sbjct  193  STMEAYKYPIYSVQWHPEKNPFEWKNSPGIPHSPSGVRAAYYIADFFINEARKSLHHFPS  252

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY   Y+G   S F ++Y F
Sbjct  253  EEEEAKELIYNYTPIYTGT-FSSFQQIYFF  281



>gb|KFP85763.1| Gamma-glutamyl hydrolase, partial [Apaloderma vittatum]
Length=283

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 151/270 (56%), Gaps = 8/270 (3%)
 Frame = -3

Query  926  GVSYIAASNVKFVESAGARVIPLIYNEPTETLIKKLNLVNGVVFPGG--SFEKGEYLEAL  753
            G SYIAAS VKF+ESAGARV+P+  N   E   K  + +NGV+FPGG    +  EY    
Sbjct  17   GSSYIAASYVKFLESAGARVVPIRLNLSDEEYDKMFHSINGVLFPGGGVDLKTSEYSRVA  76

Query  752  KEIYKKVLEKNDGGDNFPLLAINLGFQLLTIIVSEDNIILEKFSASNQASTLQVVEGLNV  573
            K  Y K LE ND GD FP+    LG + LT + S + ++L        A  L        
Sbjct  77   KIFYHKALEANDKGDYFPVWGTCLGHEELTYLTSGE-VLLVNTKTEGFALPLNFTPAAK-  134

Query  572  EGTLFQRFPYELLRKVGEECLVMQNHKWGISPESFQADADLSNFFNVLTTSLDKDNKVYV  393
               LF+ FP ++L     E L    H W +S E+F  +  L NF+NVLTT+ D D   +V
Sbjct  135  SSRLFKNFPDDVLHAFTTEPLTSNFHMWSLSMENFTKNERLRNFYNVLTTNTD-DEVEFV  193

Query  392  STIQGKKYPVVAVQWAPERNAFEWALSE-IPHSEDAILVSQSVANYFVSEARKS-SNVPN  219
            ST++  KYP+  VQW PE+N FEW  S  IPHS  A+  +  +A++F++EARKS    P+
Sbjct  194  STMEAYKYPIYGVQWHPEKNPFEWKNSPGIPHSPSAVRAAYYIADFFINEARKSLHRFPS  253

Query  218  EPDVRDNLIYNYNTSYSGKDGSGFVEVYIF  129
            E +    LIYNY+  Y+G   S F ++Y F
Sbjct  254  EDEEAKELIYNYSPIYTGP-FSSFQQIYFF  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3232880819760