BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12233

Length=911
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009793156.1|  PREDICTED: dnaJ homolog subfamily C member 14      322   3e-106   Nicotiana sylvestris
ref|XP_009599104.1|  PREDICTED: dnaJ homolog subfamily C member 14      321   5e-106   Nicotiana tomentosiformis
ref|XP_006473166.1|  PREDICTED: uncharacterized J domain-containi...    319   4e-105   Citrus sinensis [apfelsine]
ref|XP_006376249.1|  hypothetical protein POPTR_0013s11340g             319   5e-105   
ref|XP_006434578.1|  hypothetical protein CICLE_v10002209mg             318   1e-104   Citrus clementina [clementine]
ref|XP_011001096.1|  PREDICTED: dnaJ homolog subfamily B member 14      317   4e-104   Populus euphratica
emb|CDP03536.1|  unnamed protein product                                314   3e-103   Coffea canephora [robusta coffee]
ref|XP_004247453.1|  PREDICTED: uncharacterized protein LOC101257008    311   7e-102   Solanum lycopersicum
ref|XP_006359423.1|  PREDICTED: dnaJ homolog subfamily C member 1...    310   2e-101   Solanum tuberosum [potatoes]
ref|XP_007045885.1|  Chaperone DnaJ-domain superfamily protein          310   8e-101   
ref|XP_011079729.1|  PREDICTED: dnaJ homolog subfamily C member 9       301   4e-98    Sesamum indicum [beniseed]
ref|XP_010679887.1|  PREDICTED: uncharacterized protein LOC104895126    301   5e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB60803.1|  hypothetical protein B456_009G326500                    301   8e-98    Gossypium raimondii
ref|XP_008462782.1|  PREDICTED: dnaJ homolog subfamily B member 12      299   1e-97    Cucumis melo [Oriental melon]
ref|XP_010104484.1|  Chaperone protein DnaJ                             300   2e-97    Morus notabilis
ref|XP_010530162.1|  PREDICTED: dnaJ homolog subfamily B member 14      298   4e-97    Tarenaya hassleriana [spider flower]
ref|XP_009362458.1|  PREDICTED: dnaJ homolog subfamily B member 1...    298   6e-97    Pyrus x bretschneideri [bai li]
ref|XP_010246036.1|  PREDICTED: uncharacterized protein LOC104589413    296   5e-96    Nelumbo nucifera [Indian lotus]
ref|XP_008339223.1|  PREDICTED: dnaJ homolog subfamily B member 1...    295   1e-95    
ref|XP_008339222.1|  PREDICTED: dnaJ homolog subfamily C member 1...    294   6e-95    
ref|XP_003539686.1|  PREDICTED: uncharacterized protein LOC100819309    293   1e-94    Glycine max [soybeans]
emb|CDX75107.1|  BnaC09g25750D                                          292   1e-94    
ref|XP_004137622.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    291   2e-94    Cucumis sativus [cucumbers]
ref|XP_002874566.1|  DNAJ heat shock N-terminal domain-containing...    291   2e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_009113533.1|  PREDICTED: uncharacterized protein LOC103838834    291   3e-94    Brassica rapa
ref|XP_010421846.1|  PREDICTED: dnaJ homolog subfamily B member 12      291   3e-94    Camelina sativa [gold-of-pleasure]
gb|KFK32077.1|  hypothetical protein AALP_AA6G196600                    290   6e-94    Arabis alpina [alpine rockcress]
ref|XP_006397191.1|  hypothetical protein EUTSA_v10028742mg             295   6e-94    
ref|NP_192673.1|  NADH dehydrogenase-like complex T                     288   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435793.1|  PREDICTED: dnaJ homolog subfamily B member 1...    288   6e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010455337.1|  PREDICTED: dnaJ homolog subfamily B member 1...    286   5e-92    Camelina sativa [gold-of-pleasure]
gb|KHG19820.1|  Triose phosphate/phosphate translocator, chloropl...    296   6e-91    Gossypium arboreum [tree cotton]
ref|XP_006288529.1|  hypothetical protein CARUB_v10001800mg             282   8e-91    Capsella rubella
gb|KHM98836.1|  Chaperone protein DnaJ                                  280   3e-90    Glycine soja [wild soybean]
ref|XP_003531831.1|  PREDICTED: dnaJ homolog subfamily C member 1...    281   3e-90    
ref|XP_010064575.1|  PREDICTED: dnaJ homolog subfamily B member 1...    281   4e-90    Eucalyptus grandis [rose gum]
ref|XP_010045171.1|  PREDICTED: dnaJ homolog subfamily B member 1...    281   4e-90    Eucalyptus grandis [rose gum]
ref|XP_008786524.1|  PREDICTED: dnaJ homolog subfamily C member 2...    278   1e-89    
ref|XP_008786523.1|  PREDICTED: dnaJ homolog subfamily C member 2...    278   2e-89    
ref|XP_012075786.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    279   4e-89    Jatropha curcas
ref|XP_004979103.1|  PREDICTED: dnaJ homolog subfamily B member 1...    275   7e-88    Setaria italica
ref|XP_002272533.1|  PREDICTED: uncharacterized protein LOC100252905    273   7e-87    Vitis vinifera
ref|XP_009406485.1|  PREDICTED: dnaJ homolog subfamily B member 14      273   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930616.1|  PREDICTED: uncharacterized protein LOC105051729    271   2e-86    Elaeis guineensis
ref|XP_003577706.1|  PREDICTED: dnaJ homolog subfamily A member 3...    265   5e-84    Brachypodium distachyon [annual false brome]
ref|XP_007223682.1|  hypothetical protein PRUPE_ppa010245mg             264   2e-83    Prunus persica
ref|XP_004506395.1|  PREDICTED: uncharacterized protein LOC101493556    263   6e-83    
gb|EYU46716.1|  hypothetical protein MIMGU_mgv1a012583mg                261   1e-82    Erythranthe guttata [common monkey flower]
ref|XP_008219027.1|  PREDICTED: dnaJ homolog subfamily B member 14      259   1e-81    Prunus mume [ume]
ref|XP_004299890.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    257   8e-81    Fragaria vesca subsp. vesca
ref|XP_007131284.1|  hypothetical protein PHAVU_011G001000g             254   7e-80    Phaseolus vulgaris [French bean]
ref|NP_001067508.1|  Os11g0216100                                       254   1e-79    
ref|XP_006663300.1|  PREDICTED: dnaJ homolog subfamily B member 1...    252   6e-79    Oryza brachyantha
ref|XP_002449374.1|  hypothetical protein SORBIDRAFT_05g008750          250   4e-78    Sorghum bicolor [broomcorn]
gb|AFK34686.1|  unknown                                                 248   3e-77    Medicago truncatula
ref|NP_001148857.1|  LOC100282476                                       248   4e-77    Zea mays [maize]
gb|KEH29266.1|  DnaJ heat shock amino-terminal domain protein           248   5e-77    Medicago truncatula
ref|XP_006858482.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    238   2e-73    Amborella trichopoda
gb|ACU17982.1|  unknown                                                 228   2e-70    Glycine max [soybeans]
ref|XP_011650709.1|  PREDICTED: NAD(P)H-quinone oxidoreductase su...    228   5e-70    Cucumis sativus [cucumbers]
gb|EAY80365.1|  hypothetical protein OsI_35539                          226   6e-69    Oryza sativa Indica Group [Indian rice]
dbj|BAJ86486.1|  predicted protein                                      204   1e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT05725.1|  Chaperone protein dnaJ                                  185   1e-53    
emb|CCI55385.1|  NDH subunit NdhT                                       150   1e-40    Marchantia polymorpha
dbj|BAD43651.1|  putative protein                                       144   5e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001768838.1|  predicted protein                                  150   1e-38    
ref|XP_002993582.1|  hypothetical protein SELMODRAFT_163076             147   2e-38    Selaginella moellendorffii
ref|XP_002992725.1|  hypothetical protein SELMODRAFT_448880             145   6e-38    Selaginella moellendorffii
ref|XP_002534485.1|  conserved hypothetical protein                     100   3e-23    
ref|WP_015151194.1|  DnaJ-class molecular chaperone with C-termin...  86.3    6e-17    Oscillatoria acuminata
ref|WP_006909844.1|  molecular chaperone DnaJ                         79.7    1e-14    Cyanobium sp. PCC 7001
ref|XP_002533580.1|  conserved hypothetical protein                   78.2    2e-14    Ricinus communis
ref|WP_008275921.1|  molecular chaperone DnaJ                         79.3    2e-14    Cyanothece sp. CCY0110
dbj|BAD79437.1|  DnaJ protein                                         78.2    7e-14    Synechococcus elongatus PCC 6301
ref|WP_011377514.1|  MULTISPECIES: molecular chaperone DnaJ           77.8    9e-14    Synechococcus
gb|ACB49806.1|  hypothetical protein cce_0455                         77.8    1e-13    Cyanothece sp. ATCC 51142
ref|WP_009546541.1|  MULTISPECIES: molecular chaperone DnaJ           77.0    1e-13    Cyanothece
ref|WP_011055973.1|  heat shock protein                               76.3    2e-13    Thermosynechococcus elongatus
ref|WP_012597008.1|  MULTISPECIES: molecular chaperone DnaJ           76.6    2e-13    Cyanothece
emb|CCQ67455.1|  DnaJ protein                                         77.0    2e-13    Crocosphaera watsonii WH 0402
ref|WP_041234854.1|  heat shock protein                               75.5    3e-13    
ref|WP_007310790.1|  molecular chaperone DnaJ                         76.3    3e-13    Crocosphaera watsonii
gb|AFZ47901.1|  heat shock protein DnaJ domain protein                75.5    3e-13    Cyanobacterium stanieri PCC 7202
ref|WP_044170976.1|  molecular chaperone DnaJ                         75.9    4e-13    
ref|WP_024125592.1|  membrane protein with DnaJ domain                75.1    4e-13    Thermosynechococcus sp. NK55a
ref|WP_044450896.1|  molecular chaperone DnaJ                         74.7    5e-13    Mastigocladus laminosus
ref|WP_044106348.1|  hypothetical protein                             74.7    6e-13    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_041919148.1|  molecular chaperone DnaJ                         75.1    6e-13    
ref|WP_035122175.1|  molecular chaperone DnaJ                         74.7    7e-13    Fischerella sp. PCC 9431
ref|WP_033378504.1|  molecular chaperone DnaJ                         74.7    7e-13    Fischerella muscicola
gb|AFZ31212.1|  heat shock protein DnaJ domain protein                75.1    7e-13    Gloeocapsa sp. PCC 7428
gb|KHF31246.1|  Chaperone protein DnaJ                                73.9    7e-13    Anoxybacillus sp. BCO1
ref|WP_017311353.1|  molecular chaperone DnaJ                         74.7    7e-13    Fischerella sp. PCC 9339
ref|WP_038027909.1|  heat shock protein                               74.3    8e-13    
ref|WP_010311009.1|  molecular chaperone DnaJ                         74.7    8e-13    Synechococcus sp. CB0101
ref|WP_039729747.1|  MULTISPECIES: hypothetical protein               73.9    1e-12    
ref|WP_016875608.1|  hypothetical protein                             74.7    1e-12    Chlorogloeopsis fritschii
ref|WP_017285969.1|  hypothetical protein                             75.1    1e-12    Leptolyngbya boryana
gb|KIJ80791.1|  molecular chaperone DnaJ                              74.3    1e-12    Scytonema tolypothrichoides VB-61278
ref|WP_038546157.1|  hypothetical protein                             74.3    1e-12    Synechococcus sp. KORDI-100
ref|WP_008179949.1|  molecular chaperone DnaJ                         74.7    1e-12    Moorea producens
gb|AFY90826.1|  heat shock protein DnaJ domain protein                73.9    2e-12    Chroococcidiopsis thermalis PCC 7203
ref|WP_041463569.1|  molecular chaperone DnaJ                         73.6    2e-12    
ref|WP_035138981.1|  molecular chaperone DnaJ                         73.2    3e-12    Fischerella muscicola
ref|WP_015170578.1|  heat shock protein DnaJ domain-containing pr...  73.6    3e-12    Geitlerinema sp. PCC 7407
ref|WP_006455876.1|  molecular chaperone DnaJ                         72.8    3e-12    Synechococcus sp. PCC 7335
ref|WP_013324900.1|  molecular chaperone DnaJ                         73.2    4e-12    
ref|WP_038315502.1|  molecular chaperone DnaJ                         72.8    4e-12    
gb|EHA60431.1|  heat shock protein DnaJ domain protein                73.2    4e-12    Synechococcus sp. WH 8016
ref|WP_015117010.1|  DnaJ-class molecular chaperone with C-termin...  72.8    4e-12    Rivularia sp. PCC 7116
ref|WP_038014590.1|  molecular chaperone DnaJ                         72.8    4e-12    Synechococcus sp. WH 8016
gb|EMS64006.1|  hypothetical protein TRIUR3_03738                     72.4    5e-12    Triticum urartu
gb|EKE97499.1|  heat shock protein DnaJ                               72.8    5e-12    Tolypothrix sp. PCC 7601
ref|WP_011127494.1|  molecular chaperone DnaJ                         72.8    5e-12    Synechococcus sp. WH 8102
gb|EHC12180.1|  heat shock protein DnaJ domain protein                72.4    5e-12    Fischerella thermalis
ref|WP_011430869.1|  molecular chaperone DnaJ                         74.7    5e-12    Synechococcus
ref|WP_045874023.1|  molecular chaperone DnaJ                         72.4    6e-12    Nostocales
ref|WP_011933941.1|  molecular chaperone DnaJ                         72.4    6e-12    Synechococcus sp. WH 7803
ref|WP_033334744.1|  molecular chaperone DnaJ                         71.6    6e-12    Scytonema hofmannii
ref|WP_016870909.1|  MULTISPECIES: molecular chaperone DnaJ           72.0    6e-12    Fischerella thermalis
ref|WP_041391617.1|  hypothetical protein                             71.6    6e-12    
dbj|BAQ63658.1|  DnaJ-class molecular chaperone CbpA                  72.0    7e-12    Geminocystis sp. NIES-3709
ref|WP_037218347.1|  molecular chaperone DnaJ                         72.0    7e-12    
ref|WP_037990838.1|  hypothetical protein                             72.4    7e-12    Synechococcus sp. CC9616
emb|CDN11993.1|  DnaJ protein                                         72.0    7e-12    Richelia intracellularis
ref|WP_039713552.1|  molecular chaperone DnaJ                         72.0    7e-12    
ref|WP_035050582.1|  molecular chaperone DnaJ                         74.7    8e-12    Anoxybacillus
gb|KGG15804.1|  DnaJ-class molecular chaperone                        71.2    8e-12    Prochlorococcus sp. MIT 0603
ref|WP_043121112.1|  molecular chaperone DnaJ                         73.2    8e-12    
ref|WP_036919193.1|  MULTISPECIES: hypothetical protein               71.2    9e-12    Prochlorococcus
ref|WP_006509069.1|  DnaJ-class molecular chaperone with C-termin...  71.6    9e-12    Xenococcus sp. PCC 7305
emb|CDI80665.1|  DnaJ domain-containing protein, putative             71.2    1e-11    Eimeria acervulina
ref|WP_015145499.1|  DnaJ-class molecular chaperone with C-termin...  71.6    1e-11    
emb|CDJ62703.1|  DnaJ domain-containing protein, putative             72.0    1e-11    Eimeria necatrix
gb|ABX09525.1|  DnaJ-like protein                                     72.0    1e-11    Prochlorococcus marinus str. MIT 9211
ref|WP_032100499.1|  molecular chaperone DnaJ                         74.3    1e-11    
ref|WP_003393893.1|  chaperone protein DnaJ                           74.3    1e-11    Anoxybacillus flavithermus
ref|WP_035019456.1|  MULTISPECIES: molecular chaperone DnaJ           74.3    1e-11    Anoxybacillus
ref|WP_004889456.1|  molecular chaperone DnaJ                         74.3    1e-11    Anoxybacillus flavithermus
dbj|GAC89597.1|  molecular chaperone DnaJ                             74.3    1e-11    Anoxybacillus flavithermus NBRC 109594
ref|WP_041638102.1|  molecular chaperone DnaJ                         74.3    1e-11    Anoxybacillus flavithermus
gb|ACJ33214.1|  DnaJ-class molecular chaperone with C-terminal Zn...  74.3    1e-11    Anoxybacillus flavithermus WK1
emb|CDJ40420.1|  DnaJ domain-containing protein, putative             72.4    1e-11    Eimeria tenella
ref|WP_009374033.1|  MULTISPECIES: chaperone protein DnaJ             74.3    1e-11    Anoxybacillus
ref|WP_009633604.1|  DnaJ-class molecular chaperone with C-termin...  71.6    1e-11    Synechocystis sp. PCC 7509
ref|WP_021095117.1|  MULTISPECIES: chaperone protein DnaJ             73.9    1e-11    Anoxybacillus
ref|WP_035139973.1|  molecular chaperone DnaJ                         70.9    2e-11    Fischerella sp. PCC 9605
ref|WP_010315267.1|  molecular chaperone DnaJ                         70.9    2e-11    Synechococcus sp. CB0205
ref|WP_008230610.1|  Heat shock protein DnaJ-like                     70.9    2e-11    Richelia intracellularis
ref|WP_004438009.1|  molecular chaperone DnaJ                         73.9    2e-11    Bacillus methanolicus
ref|WP_012964519.1|  chaperone protein DnaJ                           73.6    2e-11    Hydrogenobacter thermophilus
ref|WP_015136504.1|  DnaJ-class molecular chaperone with C-termin...  70.9    2e-11    Nostoc sp. PCC 7524
ref|WP_044077446.1|  hypothetical protein                             70.9    2e-11    Prochlorothrix hollandica
ref|XP_001024093.1|  DnaJ domain containing protein                   74.3    2e-11    
ref|WP_036800102.1|  heat shock protein                               70.1    2e-11    
gb|EAS03848.2|  DnaJ domain protein                                   74.3    2e-11    Tetrahymena thermophila SB210
ref|WP_031408168.1|  molecular chaperone DnaJ                         73.6    2e-11    Geobacillus vulcani
ref|WP_044730790.1|  molecular chaperone DnaJ                         73.6    2e-11    Geobacillus kaustophilus
ref|WP_011231982.1|  MULTISPECIES: chaperone protein DnaJ             73.6    2e-11    Geobacillus
ref|WP_041650752.1|  hypothetical protein                             68.9    2e-11    
ref|WP_013524167.1|  MULTISPECIES: chaperone protein DnaJ             73.6    2e-11    Geobacillus
ref|WP_020753793.1|  Chaperone protein dnaJ                           73.6    2e-11    Geobacillus
ref|WP_013144702.1|  molecular chaperone DnaJ                         73.6    2e-11    Geobacillus sp. C56-T3
ref|WP_011133102.1|  molecular chaperone DnaJ                         70.1    3e-11    Prochlorococcus marinus
ref|WP_025948898.1|  molecular chaperone DnaJ                         73.6    3e-11    Geobacillus thermocatenulatus
ref|WP_039896035.1|  hypothetical protein                             70.5    3e-11    
ref|WP_039740338.1|  molecular chaperone DnaJ                         70.5    3e-11    
sp|Q45552.1|DNAJ_GEOSE  RecName: Full=Chaperone protein DnaJ          73.2    3e-11    Geobacillus stearothermophilus
gb|EAW37085.1|  DnaJ protein                                          70.9    3e-11    Lyngbya sp. PCC 8106
gb|EGK88795.1|  heat shock protein DnaJ domain protein                70.1    3e-11    Microcoleus vaginatus FGP-2
dbj|BAN02560.1|  hypothetical protein YM304_22460                     71.2    3e-11    Ilumatobacter coccineus YM16-304
ref|WP_033018918.1|  MULTISPECIES: molecular chaperone DnaJ           73.2    3e-11    Geobacillus
ref|WP_006043269.1|  molecular chaperone DnaJ                         70.5    3e-11    Synechococcus sp. WH 7805
ref|WP_044822224.1|  molecular chaperone DnaJ                         69.3    3e-11    
ref|WP_015176362.1|  heat shock protein DnaJ domain protein           70.1    3e-11    Oscillatoria nigro-viridis
ref|WP_033014701.1|  molecular chaperone DnaJ                         73.2    3e-11    Geobacillus stearothermophilus
ref|WP_043905524.1|  molecular chaperone DnaJ                         73.2    3e-11    Parageobacillus genomosp. 1
gb|EKQ70905.1|  DnaJ-class molecular chaperone with C-terminal Zn...  71.6    3e-11    Oscillatoriales cyanobacterium JSC-12
ref|WP_018716616.1|  hypothetical protein                             72.4    3e-11    Arhodomonas aquaeolei
ref|WP_033375419.1|  molecular chaperone DnaJ                         70.1    3e-11    
ref|XP_012073151.1|  PREDICTED: chaperone protein dnaJ 1, mitocho...  73.6    3e-11    Jatropha curcas
ref|XP_012073153.1|  PREDICTED: dnaJ homolog subfamily A member 2...  73.2    3e-11    Jatropha curcas
gb|EKD11307.1|  Heat shock protein DnaJ domain protein                70.1    3e-11    Arthrospira platensis C1
ref|WP_004163460.1|  molecular chaperone DnaJ                         70.1    4e-11    Microcystis
ref|WP_008879918.1|  MULTISPECIES: chaperone protein DnaJ             73.2    4e-11    Geobacillus
ref|WP_044743135.1|  molecular chaperone DnaJ                         73.2    4e-11    Anoxybacillus geothermalis
ref|WP_033009633.1|  molecular chaperone DnaJ                         73.2    4e-11    
ref|WP_017318707.1|  molecular chaperone DnaJ                         70.1    4e-11    Mastigocladopsis repens
ref|WP_017435624.1|  molecular chaperone DnaJ                         72.8    4e-11    Bacillaceae
ref|WP_039886992.1|  heat shock protein                               69.7    4e-11    
ref|WP_029638490.1|  molecular chaperone DnaJ [                       70.1    4e-11    [Scytonema hofmanni] UTEX B 1581
gb|ADP73874.1|  chaperone protein DnaJ                                72.8    4e-11    Geobacillus sp. Y4.1MC1
ref|XP_004235949.1|  PREDICTED: dnaJ homolog 1, mitochondrial         73.2    4e-11    Solanum lycopersicum
emb|CEA08179.1|  Chaperone protein DnaJ                               72.8    4e-11    Arthrobacter saudimassiliensis
ref|WP_024566441.1|  conjugal transfer protein TraG                   73.6    4e-11    Elizabethkingia
ref|WP_025726661.1|  molecular chaperone DnaJ                         72.8    4e-11    Bacillus ginsengihumi
ref|WP_020153962.1|  molecular chaperone DnaJ                         72.8    4e-11    Caldibacillus debilis
ref|WP_003249049.1|  MULTISPECIES: chaperone protein DnaJ             72.8    4e-11    Bacillaceae
ref|WP_015864546.1|  chaperone protein DnaJ                           72.8    4e-11    Bacillaceae
gb|AEH47168.1|  Chaperone protein dnaJ                                72.8    4e-11    Parageobacillus thermoglucosidasius C56-YS93
ref|WP_041270196.1|  molecular chaperone DnaJ                         72.8    4e-11    Parageobacillus thermoglucosidasius
ref|WP_004268885.1|  molecular chaperone DnaJ                         69.7    5e-11    Microcystis aeruginosa
ref|WP_036616040.1|  molecular chaperone DnaJ                         69.3    5e-11    
ref|WP_041237627.1|  molecular chaperone DnaJ                         70.1    5e-11    Cyanothece sp. PCC 7424
ref|WP_045054745.1|  molecular chaperone DnaJ                         69.7    5e-11    Aliterella atlantica
ref|WP_040697180.1|  hypothetical protein                             69.3    5e-11    
ref|WP_026552223.1|  molecular chaperone DnaJ                         72.4    5e-11    Arthrobacter sp. H20
ref|WP_021793819.1|  hypothetical protein                             72.4    6e-11    
ref|WP_012412226.1|  molecular chaperone DnaJ                         69.7    6e-11    Nostoc punctiforme
ref|WP_036535801.1|  molecular chaperone DnaJ                         69.7    6e-11    
ref|WP_041922593.1|  heat shock protein                               68.9    6e-11    
gb|ERN40893.1|  DnaJ-class molecular chaperone with C-terminal Zn...  70.1    6e-11    Rubidibacter lacunae KORDI 51-2
ref|XP_001767471.1|  predicted protein                                72.8    6e-11    
ref|WP_006103090.1|  molecular chaperone DnaJ                         70.1    6e-11    Coleofasciculus chthonoplastes
emb|CCD75667.1|  putative chaperone protein DNAj                      70.1    6e-11    Schistosoma mansoni
ref|WP_012306171.1|  molecular chaperone DnaJ                         69.3    6e-11    Synechococcus
ref|WP_030005815.1|  heat shock protein                               69.3    6e-11    Synechococcus sp. NKBG042902
ref|WP_029911975.1|  hypothetical protein                             67.4    6e-11    
ref|WP_028085059.1|  molecular chaperone DnaJ                         68.9    7e-11    Dolichospermum circinale
ref|WP_044805076.1|  molecular chaperone DnaJ                         69.3    7e-11    
ref|WP_006529593.1|  DnaJ-class molecular chaperone with C-termin...  68.9    7e-11    Gloeocapsa sp. PCC 73106
ref|WP_029141907.1|  molecular chaperone DnaJ                         72.4    7e-11    Bacillus coagulans
ref|WP_015216284.1|  heat shock protein DnaJ domain protein           69.7    7e-11    Anabaena cylindrica
gb|ACK68999.1|  heat shock protein DnaJ domain protein                69.7    7e-11    Cyanothece sp. PCC 7424
ref|WP_013859697.1|  molecular chaperone DnaJ                         72.0    7e-11    Bacillus coagulans
ref|WP_015202675.1|  heat shock protein DnaJ domain-containing pr...  69.7    7e-11    Crinalium epipsammum
ref|WP_044894750.1|  molecular chaperone DnaJ                         72.0    7e-11    Bacillus alveayuensis
gb|KHJ31437.1|  putative chaperone j-domain-containing protein        72.4    7e-11    Erysiphe necator
ref|WP_028090610.1|  molecular chaperone DnaJ                         68.9    7e-11    Dolichospermum circinale
ref|WP_017552610.1|  molecular chaperone DnaJ                         72.0    7e-11    Bacillus coagulans
ref|WP_040553421.1|  molecular chaperone DnaJ                         68.9    7e-11    
dbj|BAE24035.1|  unnamed protein product                              69.3    7e-11    Mus musculus [mouse]
gb|EFA73682.1|  Heat shock protein DnaJ-like protein                  68.9    8e-11    Raphidiopsis brookii D9
ref|WP_014097971.1|  molecular chaperone DnaJ                         72.0    8e-11    Bacillus coagulans
ref|WP_027881238.1|  molecular chaperone DnaJ                         71.2    8e-11    Meiothermus rufus
gb|AFZ52425.1|  heat shock protein DnaJ domain protein                68.9    8e-11    Cyanobacterium aponinum PCC 10605
dbj|BAL56358.1|  molecular chaperone DnaJ                             72.0    8e-11    uncultured Aquificae bacterium
ref|WP_004435827.1|  molecular chaperone DnaJ                         72.0    8e-11    Bacillus methanolicus
ref|XP_009382672.1|  PREDICTED: dnaJ homolog 1, mitochondrial         72.4    8e-11    Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_011130863.1|  molecular chaperone DnaJ                         69.7    8e-11    Prochlorococcus marinus
ref|WP_026926813.1|  molecular chaperone DnaJ                         72.0    8e-11    Granulicoccus phenolivorans
dbj|BAL54562.1|  molecular chaperone DnaJ                             71.6    8e-11    uncultured Aquificae bacterium
ref|WP_002736811.1|  MULTISPECIES: molecular chaperone DnaJ           68.9    9e-11    Microcystis
ref|WP_044879573.1|  molecular chaperone DnaJ                         68.6    9e-11    Paenibacillus sp. IHBB 10380
gb|ADI65926.1|  heat shock protein DnaJ domain protein                68.6    9e-11    'Nostoc azollae' 0708
ref|WP_008231827.1|  DnaJ protein                                     68.9    9e-11    Richelia intracellularis
gb|KEF43024.1|  molecular chaperone DnaJ                              69.3    9e-11    Cyanobium sp. CACIAM 14
ref|WP_002751861.1|  molecular chaperone DnaJ                         68.9    9e-11    Microcystis aeruginosa
ref|WP_016952185.1|  hypothetical protein                             68.9    9e-11    Anabaena sp. PCC 7108
ref|WP_020960633.1|  molecular chaperone DnaJ                         71.6    1e-10    Geobacillus genomosp. 3
ref|WP_011142393.1|  molecular chaperone DnaJ                         69.7    1e-10    Gloeobacter violaceus
ref|WP_035083456.1|  molecular chaperone DnaJ                         68.6    1e-10    
ref|WP_026544028.1|  molecular chaperone DnaJ                         71.6    1e-10    Arthrobacter sp. 35/47
ref|WP_017662780.1|  hypothetical protein                             68.6    1e-10    Geitlerinema sp. PCC 7105
emb|CDO98167.1|  unnamed protein product                              72.0    1e-10    Coffea canephora [robusta coffee]
ref|WP_036030912.1|  molecular chaperone DnaJ                         68.6    1e-10    
ref|WP_019482775.1|  MULTISPECIES: molecular chaperone DnaJ           71.6    1e-10    Arthrobacter
ref|WP_045361349.1|  heat shock protein                               68.6    1e-10    Microcystis aeruginosa
ref|WP_005267290.1|  chaperone protein DnaJ                           71.6    1e-10    Arthrobacter crystallopoietes
ref|XP_567939.1|  chaperone regulator                                 71.6    1e-10    Cryptococcus neoformans var. neoformans JEC21
ref|WP_003355414.1|  molecular chaperone DnaJ                         71.6    1e-10    Bacillus smithii
ref|WP_029315196.1|  molecular chaperone DnaJ                         68.6    1e-10    Acaryochloris sp. CCMEE 5410
ref|WP_013296459.1|  molecular chaperone DnaJ                         71.6    1e-10    Methanothermobacter marburgensis
ref|WP_035405151.1|  molecular chaperone DnaJ                         71.6    1e-10    Bacillus sp. SJS
ref|WP_036911367.1|  MULTISPECIES: molecular chaperone DnaJ           69.3    1e-10    Prochlorococcus
ref|XP_006364226.1|  PREDICTED: dnaJ homolog 1, mitochondrial-like    72.0    1e-10    Solanum tuberosum [potatoes]
ref|WP_002779886.1|  molecular chaperone DnaJ                         68.6    1e-10    Microcystis aeruginosa
gb|KGG28351.1|  DnaJ-like protein                                     69.3    1e-10    Prochlorococcus sp. MIT 0702
ref|WP_002763788.1|  molecular chaperone DnaJ                         68.6    1e-10    Microcystis aeruginosa
ref|WP_025915087.1|  molecular chaperone DnaJ                         68.2    1e-10    
ref|WP_011125778.1|  DnaJ-class molecular chaperone                   68.9    1e-10    Prochlorococcus
ref|WP_041596668.1|  molecular chaperone DnaJ                         68.6    1e-10    
ref|WP_012161081.1|  molecular chaperone DnaJ                         68.2    1e-10    Acaryochloris marina
ref|WP_011825127.1|  molecular chaperone DnaJ                         69.3    1e-10    
ref|WP_015111471.1|  heat shock protein DnaJ domain-containing pr...  68.6    1e-10    Nostoc sp. PCC 7107
ref|WP_039204865.1|  molecular chaperone DnaJ                         68.2    1e-10    
emb|CDI05491.1|  Type I membrane protein (fragment)                   68.9    1e-10    Thaumarchaeota archaeon N4
gb|KHN22434.1|  Chaperone protein DnaJ                                71.6    1e-10    Glycine soja [wild soybean]
gb|AFZ44872.1|  heat shock protein DnaJ domain protein                68.6    1e-10    Halothece sp. PCC 7418
ref|WP_036892619.1|  MULTISPECIES: hypothetical protein               68.2    1e-10    
ref|XP_009392102.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  67.8    1e-10    
ref|WP_007355300.1|  MULTISPECIES: molecular chaperone DnaJ           67.8    2e-10    
ref|WP_040656079.1|  hypothetical protein                             67.8    2e-10    
ref|WP_015200803.1|  heat shock protein DnaJ domain-containing pr...  68.6    2e-10    
ref|XP_003545801.1|  PREDICTED: dnaJ homolog 1, mitochondrial-lik...  71.6    2e-10    
ref|XP_004512137.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  68.2    2e-10    
ref|XP_006880816.1|  PREDICTED: dnaJ homolog subfamily B member 1...  71.2    2e-10    
gb|KFO96423.1|  DnaJ subfamily B member 14                            69.3    2e-10    
ref|WP_036901039.1|  hypothetical protein                             68.2    2e-10    
ref|XP_004509362.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  68.6    2e-10    
ref|WP_044744573.1|  molecular chaperone DnaJ                         71.2    2e-10    
ref|WP_043327347.1|  molecular chaperone DnaJ                         67.8    2e-10    
ref|WP_035354792.1|  molecular chaperone DnaJ                         70.9    2e-10    
ref|WP_035993859.1|  hypothetical protein                             67.8    2e-10    
gb|KJU73848.1|  molecular chaperone DnaJ                              70.9    2e-10    
emb|CDY58774.1|  BnaCnng33760D                                        71.2    2e-10    
ref|WP_035829514.1|  molecular chaperone DnaJ                         67.8    2e-10    
ref|XP_009106773.1|  PREDICTED: dnaJ homolog 1, mitochondrial         71.2    2e-10    
gb|AFY30126.1|  DnaJ-class molecular chaperone with C-terminal Zn...  68.6    2e-10    
ref|WP_006517703.1|  DnaJ-class molecular chaperone with C-termin...  67.8    2e-10    
ref|WP_041846240.1|  molecular chaperone DnaJ                         70.9    2e-10    
ref|WP_041035832.1|  molecular chaperone DnaJ                         68.2    2e-10    
ref|XP_010906719.1|  PREDICTED: dnaJ homolog subfamily A member 2     71.2    2e-10    
ref|WP_038536268.1|  molecular chaperone DnaJ                         70.9    2e-10    
ref|WP_041233450.1|  molecular chaperone DnaJ                         68.2    2e-10    
ref|WP_034771164.1|  molecular chaperone DnaJ                         70.9    2e-10    
ref|WP_028501649.1|  molecular chaperone DnaJ                         70.9    2e-10    
ref|WP_029261713.1|  MULTISPECIES: molecular chaperone DnaJ           70.9    2e-10    
gb|AFZ23429.1|  DnaJ-class molecular chaperone with C-terminal Zn...  68.2    2e-10    
ref|WP_010997144.1|  molecular chaperone DnaJ                         67.8    2e-10    
ref|WP_011317770.1|  molecular chaperone DnaJ                         67.8    2e-10    
ref|WP_040945974.1|  hypothetical protein                             66.6    2e-10    
ref|WP_011432386.1|  molecular chaperone DnaJ                         70.1    2e-10    
ref|WP_022072173.1|  chaperone protein DnaJ                           70.9    2e-10    
ref|WP_003183667.1|  MULTISPECIES: chaperone protein DnaJ             70.9    2e-10    
ref|WP_024038387.1|  hypothetical protein                             70.9    2e-10    
ref|WP_025306661.1|  molecular chaperone DnaJ                         70.5    2e-10    
gb|KFV91263.1|  DnaJ subfamily B member 14                            68.9    2e-10    
ref|WP_045264900.1|  molecular chaperone DnaJ                         70.5    2e-10    
ref|WP_017293092.1|  hypothetical protein                             67.4    2e-10    
ref|WP_031775988.1|  molecular chaperone DnaJ                         70.5    2e-10    
ref|XP_002286270.1|  DnaJ chaperone                                   70.1    2e-10    
ref|WP_023174161.1|  chaperone protein DnaJ                           68.9    2e-10    
ref|WP_024962518.1|  cobalamin ABC transporter permease               69.7    3e-10    
gb|AIZ56900.1|  chaperone protein DnaJ                                70.5    3e-10    
ref|WP_002785790.1|  molecular chaperone DnaJ                         67.8    3e-10    
gb|KHN79621.1|  Mitochondrial protein                                 68.9    3e-10    
gb|KFW75739.1|  DnaJ subfamily B member 14                            68.9    3e-10    
ref|WP_041235891.1|  molecular chaperone DnaJ                         67.4    3e-10    
ref|WP_040164224.1|  molecular chaperone DnaJ                         70.5    3e-10    
ref|WP_015051179.1|  molecular chaperone DnaJ                         70.5    3e-10    
ref|WP_016646846.1|  hypothetical protein                             69.7    3e-10    
gb|KGG28656.1|  DnaJ-like protein                                     67.8    3e-10    
emb|CBN80464.1|  EsV-1-173                                            70.5    3e-10    
ref|WP_018705878.1|  molecular chaperone DnaJ                         70.5    3e-10    
ref|WP_045175028.1|  molecular chaperone DnaJ                         70.5    3e-10    
ref|WP_011430003.1|  molecular chaperone DnaJ                         67.0    3e-10    
ref|WP_026554940.1|  molecular chaperone DnaJ                         70.5    3e-10    
ref|WP_018712611.1|  hypothetical protein                             69.3    3e-10    
gb|KFV94107.1|  DnaJ subfamily B member 14                            68.6    3e-10    
emb|CCD75668.1|  putative chaperone protein DNAj                      67.8    3e-10    
ref|XP_008807042.1|  PREDICTED: dnaJ homolog subfamily A member 2     70.5    3e-10    
ref|XP_009573708.1|  PREDICTED: dnaJ homolog subfamily B member 14    69.7    3e-10    
ref|WP_023066934.1|  dnaJ domain protein                              67.8    3e-10    
ref|WP_013131406.1|  molecular chaperone DnaJ                         70.1    3e-10    
gb|ACL47003.1|  heat shock protein DnaJ domain protein                68.2    3e-10    
ref|WP_012220518.1|  curved DNA-binding protein                       69.7    3e-10    
ref|WP_019125470.1|  chaperone DnaJ                                   69.7    3e-10    
ref|WP_015128793.1|  heat shock protein DnaJ domain-containing pr...  67.8    3e-10    
ref|WP_027407853.1|  molecular chaperone DnaJ                         70.1    3e-10    
ref|WP_005768408.1|  cytochrome C biogenesis protein                  69.7    3e-10    
ref|WP_002748145.1|  dnaJ domain protein                              67.4    3e-10    
ref|XP_003531344.1|  PREDICTED: dnaJ homolog 1, mitochondrial-lik...  70.5    3e-10    
ref|XP_004486655.1|  PREDICTED: chaperone protein DnaJ-like isofo...  70.5    3e-10    
gb|EAU74776.1|  Heat shock protein DnaJ-like                          67.4    3e-10    
ref|XP_004486656.1|  PREDICTED: chaperone protein DnaJ-like isofo...  70.5    4e-10    
ref|XP_009783196.1|  PREDICTED: dnaJ homolog 1, mitochondrial         70.5    4e-10    
ref|WP_041090320.1|  molecular chaperone DnaJ                         70.1    4e-10    
ref|WP_043936715.1|  MULTISPECIES: hypothetical protein               67.0    4e-10    
ref|WP_026534784.1|  molecular chaperone DnaJ                         70.1    4e-10    
ref|WP_020452258.1|  MULTISPECIES: chaperone DnaJ                     70.1    4e-10    
ref|WP_038023500.1|  molecular chaperone DnaJ                         67.4    4e-10    
ref|WP_041698940.1|  molecular chaperone DnaJ                         67.0    4e-10    
ref|WP_043928578.1|  molecular chaperone DnaJ                         70.1    4e-10    
ref|WP_034870049.1|  conjugal transfer protein TraG                   70.9    4e-10    
gb|KFK42378.1|  hypothetical protein AALP_AA2G248400                  70.5    4e-10    
ref|XP_007215271.1|  hypothetical protein PRUPE_ppa004678mg           70.5    4e-10    
ref|XP_003525050.1|  PREDICTED: dnaJ homolog 1, mitochondrial-lik...  70.1    4e-10    
gb|KJB66465.1|  hypothetical protein B456_010G140900                  70.5    4e-10    
gb|ADE76268.1|  unknown                                               70.5    4e-10    
ref|WP_015505464.1|  Chaperone protein DnaJ                           70.1    4e-10    
ref|WP_022532621.1|  chaperone protein DnaJ                           70.1    4e-10    
gb|EEV18366.1|  DnaJ domain protein                                   67.4    4e-10    
ref|WP_026124264.1|  MULTISPECIES: molecular chaperone DnaJ           70.1    4e-10    
ref|WP_045671725.1|  molecular chaperone DnaJ                         70.1    4e-10    
ref|XP_008228708.1|  PREDICTED: dnaJ homolog subfamily A member 2     70.1    4e-10    
ref|WP_023627253.1|  MULTISPECIES: molecular chaperone DnaJ           70.1    4e-10    
ref|WP_033160106.1|  molecular chaperone DnaJ                         70.1    4e-10    
ref|XP_001385080.2|  dnaJ homolog in endoplasmic reticulum            70.1    4e-10    
gb|KJB66466.1|  hypothetical protein B456_010G140900                  70.1    4e-10    
gb|AFZ51306.1|  DnaJ-class molecular chaperone with C-terminal Zn...  67.4    4e-10    
ref|XP_009705659.1|  PREDICTED: dnaJ homolog subfamily B member 14    68.6    4e-10    
gb|KFV71546.1|  DnaJ subfamily B member 14                            68.2    4e-10    
ref|WP_018399844.1|  hypothetical protein                             67.4    4e-10    
ref|XP_009603110.1|  PREDICTED: dnaJ homolog subfamily A member 2     70.1    4e-10    
gb|KJB66467.1|  hypothetical protein B456_010G140900                  70.1    4e-10    
gb|KIJ68671.1|  hypothetical protein HYDPIDRAFT_106908                70.1    4e-10    
ref|XP_010097206.1|  Chaperone protein DnaJ                           70.1    4e-10    
ref|WP_019178759.1|  hypothetical protein                             69.7    4e-10    
gb|KHG03313.1|  Chaperone DnaJ                                        70.1    4e-10    
ref|WP_041152347.1|  molecular chaperone DnaJ                         69.7    5e-10    
ref|WP_034533974.1|  molecular chaperone DnaJ                         69.7    5e-10    
ref|WP_034531657.1|  molecular chaperone DnaJ                         69.7    5e-10    
gb|KFP68552.1|  DnaJ subfamily B member 14                            68.2    5e-10    
ref|XP_009687633.1|  PREDICTED: dnaJ homolog subfamily B member 14    69.3    5e-10    
ref|WP_038038729.1|  molecular chaperone DnaJ                         69.7    5e-10    
ref|XP_004195968.1|  Piso0_005401                                     69.7    5e-10    
ref|WP_003332308.1|  chaperone protein DnaJ                           69.7    5e-10    
ref|WP_015083368.1|  DnaJ domain-containing protein                   66.6    5e-10    
ref|WP_010958020.1|  curved DNA-binding protein                       69.7    5e-10    
ref|XP_010212099.1|  PREDICTED: dnaJ homolog subfamily B member 14    69.3    5e-10    
emb|CCC93119.1|  unnamed protein product                              67.4    5e-10    
gb|KIR31797.1|  chaperone DnaJ                                        69.7    5e-10    
gb|ACJ20204.1|  curved DNA-binding protein                            69.3    5e-10    
gb|KIR45091.1|  chaperone regulator                                   69.7    5e-10    
ref|XP_003517172.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  66.6    5e-10    
ref|WP_035195886.1|  molecular chaperone DnaJ                         69.7    5e-10    
ref|WP_036580932.1|  molecular chaperone DnaJ                         69.7    5e-10    
ref|WP_011620253.1|  molecular chaperone DnaJ                         67.0    5e-10    
ref|WP_041237373.1|  molecular chaperone DnaJ                         66.6    5e-10    
gb|KEI67057.1|  DnaJ                                                  66.6    5e-10    
gb|ERG80223.1|  protein tumorous imaginal                             70.1    5e-10    
gb|KIR57856.1|  chaperone regulator                                   69.7    5e-10    
ref|WP_041299638.1|  hypothetical protein                             65.1    5e-10    
ref|WP_025305303.1|  molecular chaperone DnaJ                         69.7    6e-10    
ref|WP_040940022.1|  hypothetical protein                             66.6    6e-10    
ref|WP_015191674.1|  heat shock protein DnaJ domain protein           66.6    6e-10    
ref|WP_022213943.1|  dnaJ-class molecular chaperone with C-termin...  69.3    6e-10    
ref|WP_038680693.1|  hypothetical protein                             69.3    6e-10    
ref|XP_008500582.1|  PREDICTED: dnaJ homolog subfamily B member 14    69.3    6e-10    
emb|CAA96305.1|  DnaJ homologue                                       69.7    6e-10    
ref|XP_004303291.1|  PREDICTED: dnaJ homolog 1, mitochondrial         69.7    6e-10    
ref|WP_040944078.1|  hypothetical protein                             66.6    6e-10    
ref|WP_036336564.1|  molecular chaperone DnaJ                         69.3    6e-10    
emb|CEG27918.1|  chaperone protein DnaJ                               69.3    6e-10    
ref|XP_008177360.1|  PREDICTED: dnaJ homolog subfamily B member 1...  68.9    6e-10    
gb|KGL76674.1|  DnaJ subfamily B member 14                            68.6    6e-10    
ref|WP_011431821.1|  molecular chaperone DnaJ                         66.2    6e-10    
ref|WP_032525010.1|  molecular chaperone DnaJ                         66.2    6e-10    
ref|WP_010933150.1|  chaperone protein DnaJ                           69.3    6e-10    
ref|XP_009390989.1|  PREDICTED: dnaJ homolog 1, mitochondrial-like    69.7    6e-10    
gb|KFU93781.1|  DnaJ subfamily B member 14                            67.8    6e-10    
ref|WP_006277620.1|  molecular chaperone DnaJ                         66.6    6e-10    
ref|WP_004558046.1|  DnaJ-class molecular chaperone with C-termin...  68.2    6e-10    
ref|WP_010078619.1|  molecular chaperone DnaJ                         69.3    6e-10    
ref|WP_012991101.1|  molecular chaperone DnaJ                         69.3    6e-10    
ref|WP_036844006.1|  molecular chaperone DnaJ                         66.2    6e-10    
ref|WP_034244583.1|  molecular chaperone DnaJ                         69.3    7e-10    
ref|WP_012962781.1|  molecular chaperone DnaJ                         69.3    7e-10    
ref|WP_034628923.1|  molecular chaperone DnaJ                         69.3    7e-10    
ref|XP_003601936.1|  Chaperone dnaJ                                   69.3    7e-10    
gb|AEA77198.1|  heat-shock protein                                    69.3    7e-10    
ref|WP_040936587.1|  hypothetical protein                             66.2    7e-10    
gb|KFO91493.1|  DnaJ subfamily B member 14                            67.8    7e-10    
ref|XP_003196386.1|  chaperone regulator                              69.3    7e-10    
ref|WP_045169668.1|  molecular chaperone DnaJ                         69.3    7e-10    
gb|KFR12689.1|  DnaJ subfamily B member 14                            67.8    7e-10    
gb|KFQ03283.1|  DnaJ subfamily B member 14                            67.8    7e-10    
gb|KFP72706.1|  DnaJ subfamily B member 14                            67.8    7e-10    
ref|WP_014163730.1|  molecular chaperone DnaJ                         68.6    7e-10    
gb|KIR80258.1|  chaperone regulator                                   69.3    7e-10    
ref|XP_004291355.1|  PREDICTED: chaperone protein dnaJ 11, chloro...  66.2    7e-10    
gb|KFV40976.1|  DnaJ subfamily B member 14                            67.8    7e-10    
ref|WP_036831451.1|  MULTISPECIES: molecular chaperone DnaJ           65.9    7e-10    
gb|AFY69045.1|  heat shock protein DnaJ domain protein                66.6    7e-10    
ref|WP_023074430.1|  class molecular chaperone with c-terminal zn...  66.2    7e-10    
ref|WP_040945558.1|  hypothetical protein                             66.2    7e-10    
ref|XP_010152152.1|  PREDICTED: dnaJ homolog subfamily B member 14    68.9    7e-10    
ref|XP_008931460.1|  PREDICTED: dnaJ homolog subfamily B member 14    68.9    7e-10    
gb|KIR83009.1|  chaperone regulator                                   69.3    7e-10    
gb|KGL93710.1|  DnaJ subfamily B member 14                            67.8    7e-10    
gb|KJB66468.1|  hypothetical protein B456_010G140900                  69.3    7e-10    
ref|WP_020449615.1|  Chaperone protein DnaJ                           69.3    7e-10    
gb|KGB80026.1|  chaperone regulator                                   69.3    7e-10    
ref|WP_025385021.1|  cytochrome C biogenesis protein                  68.6    7e-10    
ref|WP_026584466.1|  molecular chaperone DnaJ                         69.3    7e-10    
ref|XP_012048804.1|  chaperone regulator                              69.3    7e-10    
ref|WP_041097330.1|  molecular chaperone DnaJ                         69.3    7e-10    
ref|WP_013403087.1|  molecular chaperone DnaJ                         69.3    8e-10    
gb|KIL75365.1|  Chaperone protein DnaJ                                68.9    8e-10    
ref|WP_009790354.1|  molecular chaperone DnaJ                         66.6    8e-10    
ref|WP_027963481.1|  molecular chaperone DnaJ                         68.9    8e-10    
gb|KFQ32585.1|  DnaJ subfamily B member 14                            67.4    8e-10    
ref|XP_010250190.1|  PREDICTED: dnaJ homolog subfamily A member 2     69.3    8e-10    
ref|WP_016838576.1|  molecular chaperone DnaJ                         68.9    8e-10    
ref|XP_007150763.1|  hypothetical protein PHAVU_005G178800g           69.3    8e-10    
emb|CCG84560.1|  protein of unknown function                          68.9    8e-10    
ref|WP_042157441.1|  molecular chaperone DnaJ                         65.9    8e-10    
ref|WP_040935805.1|  hypothetical protein                             65.9    9e-10    
ref|WP_025979440.1|  molecular chaperone DnaJ                         65.9    9e-10    
ref|WP_011359431.1|  molecular chaperone DnaJ                         66.6    9e-10    
ref|WP_026123593.1|  molecular chaperone DnaJ                         68.9    9e-10    
ref|WP_015410449.1|  molecular chaperone DnaJ                         68.9    9e-10    
gb|KFW69206.1|  DnaJ subfamily B member 14                            67.4    9e-10    
ref|WP_019891926.1|  hypothetical protein                             68.9    9e-10    
ref|WP_036809495.1|  molecular chaperone DnaJ                         68.9    9e-10    
ref|WP_004817356.1|  molecular chaperone DnaJ                         68.6    9e-10    
gb|KFQ07443.1|  DnaJ subfamily B member 14                            67.4    9e-10    
ref|WP_034319463.1|  molecular chaperone DnaJ                         68.9    9e-10    
ref|WP_022338549.1|  chaperone protein DnaJ                           68.9    9e-10    
ref|WP_005957101.1|  DnaJ domain protein                              68.6    9e-10    
gb|ABE11085.1|  DnaJ-like protein                                     65.9    9e-10    
ref|WP_014215438.1|  molecular chaperone DnaJ                         68.9    9e-10    
ref|WP_010880419.1|  Chaperone protein DnaJ 2                         68.9    9e-10    
gb|KFZ57120.1|  DnaJ subfamily B member 14                            67.4    9e-10    
ref|XP_009325310.1|  PREDICTED: dnaJ homolog subfamily B member 1...  68.2    9e-10    
pdb|4J7Z|A  Chain A, Thermus Thermophilus Dnaj J- And G/f-domains     65.1    9e-10    
ref|XP_008454176.1|  PREDICTED: dnaJ homolog subfamily A member 2     68.9    9e-10    
gb|ERN20573.1|  hypothetical protein AMTR_s00070p00046580             68.9    1e-09    
gb|EAQ76202.1|  DnaJ-like protein                                     66.6    1e-09    



>ref|XP_009793156.1| PREDICTED: dnaJ homolog subfamily C member 14 [Nicotiana sylvestris]
Length=249

 Score =   322 bits (825),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 204/254 (80%), Gaps = 5/254 (2%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPP  623
            MAS T+P + F+ L   + TE R +       +        ++ AT +GP    RQ APP
Sbjct  1    MASATSPPAPFTFLSSNQSTEHR-TYGRWLTTKQRSQHGSFQVCATQEGPSK--RQRAPP  57

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVG  443
            GVDTRIHWENEDEGW+GGS S   + ++++KADE  LL +KFS+LLNSS DSHYQFLGV 
Sbjct  58   GVDTRIHWENEDEGWVGGSKSQ--SAQERIKADEKNLLDEKFSDLLNSSADSHYQFLGVS  115

Query  442  ADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQ  263
            A AD+EEIK AYRRLSKEYHPDTT+LP++AASEKFMKLKE+Y+VLS++E+RRFYDWTLAQ
Sbjct  116  ATADLEEIKAAYRRLSKEYHPDTTNLPIRAASEKFMKLKEIYDVLSDEEQRRFYDWTLAQ  175

Query  262  EAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFS  83
            E AS+EAEK+R+K QDP M E+ENWESVPDMVDRLGG+NMELS QAKSALTFDILII+FS
Sbjct  176  EVASREAEKMRIKLQDPRMLEIENWESVPDMVDRLGGRNMELSDQAKSALTFDILIIIFS  235

Query  82   VCCIVYAIYFKEQY  41
             CCI+YAI+FKEQY
Sbjct  236  FCCIIYAIFFKEQY  249



>ref|XP_009599104.1| PREDICTED: dnaJ homolog subfamily C member 14 [Nicotiana tomentosiformis]
Length=249

 Score =   321 bits (823),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 205/254 (81%), Gaps = 5/254 (2%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPP  623
            MAS T+P + F+ L   + TE R +       +        +++AT +GP    RQ APP
Sbjct  1    MASATSPPAPFTFLSSNQSTEHR-TYGQWLTAKQRSRCGGFQVYATQEGPSK--RQRAPP  57

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVG  443
             VDTRIHWENEDEGW+GGS S   + ++++KADE  LL +KFS+LLNSS DSHYQFLGV 
Sbjct  58   DVDTRIHWENEDEGWVGGSKSQ--SAQERIKADEKNLLDEKFSDLLNSSADSHYQFLGVS  115

Query  442  ADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQ  263
            A AD+EEIK AYRRLSKEYHPDTT+LP++AASEKFMKLKE+Y+VLS++E+RRFYDWTLAQ
Sbjct  116  ATADLEEIKAAYRRLSKEYHPDTTTLPIRAASEKFMKLKEIYDVLSDEEQRRFYDWTLAQ  175

Query  262  EAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFS  83
            EAAS+EAEK+R+K QDP M EVENWESVPDMVDRLGG+NMELS QAKSALTFDI+II+FS
Sbjct  176  EAASREAEKMRIKLQDPRMLEVENWESVPDMVDRLGGRNMELSDQAKSALTFDIVIIIFS  235

Query  82   VCCIVYAIYFKEQY  41
             CCI+YAI+FKEQY
Sbjct  236  FCCIIYAIFFKEQY  249



>ref|XP_006473166.1| PREDICTED: uncharacterized J domain-containing protein C17A3.05c-like 
[Citrus sinensis]
 gb|KDO83864.1| hypothetical protein CISIN_1g024973mg [Citrus sinensis]
Length=259

 Score =   319 bits (818),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/256 (62%), Positives = 204/256 (80%), Gaps = 2/256 (1%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPP  623
            MAST +PQS +S+  + +   L+Q     R        + +R+FA+ +      ++ A P
Sbjct  3    MASTVSPQSPYSLFLKTQHGSLQQLTKEPRAATARTRSKILRVFASQKAGSNKSQRRAQP  62

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQQLKADENE--LLGDKFSELLNSSTDSHYQFLG  449
            GVDTRIHWENEDEGWIGGSSSSS    Q   A+E +  LLG+KF++LLN+S+DSHYQFLG
Sbjct  63   GVDTRIHWENEDEGWIGGSSSSSHQTNQNFNAEEEQKNLLGEKFADLLNNSSDSHYQFLG  122

Query  448  VGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTL  269
            +   AD+EEIK+AYRRLSKEYHPDTTSLPLKAASEKF+KL+EVY+VLSN+E RRFYDWTL
Sbjct  123  ISPSADLEEIKSAYRRLSKEYHPDTTSLPLKAASEKFLKLREVYDVLSNEESRRFYDWTL  182

Query  268  AQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIIL  89
            AQEAAS++AEKL+MKF+DP+ Q ++N+ S+PDMVDRLGG+NMELS QA +ALTFD+++I+
Sbjct  183  AQEAASRKAEKLKMKFEDPYDQALKNYGSIPDMVDRLGGRNMELSDQAMTALTFDVVVII  242

Query  88   FSVCCIVYAIYFKEQY  41
            F+ CCI+YA+YFKE Y
Sbjct  243  FTFCCIIYALYFKEPY  258



>ref|XP_006376249.1| hypothetical protein POPTR_0013s11340g [Populus trichocarpa]
 gb|ERP54046.1| hypothetical protein POPTR_0013s11340g [Populus trichocarpa]
Length=256

 Score =   319 bits (817),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 207/263 (79%), Gaps = 16/263 (6%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRC------RRTE---LRQSPAVErrrrpygcrrevRIFATTQGPK  650
            MASTTA Q+ FS+  R       RR +   +R++P+     R     R   ++A    P+
Sbjct  1    MASTTATQAPFSLFLRTQNGSGHRRKKHLLIRKAPS----GRTGNRGRAFGVYAEQGSPE  56

Query  649  PPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTD  470
             P  Q APPGVDTRIHW+NEDEGW+GGSS+SS  Q +Q + ++ ++LG +F++LLN S+D
Sbjct  57   KP--QRAPPGVDTRIHWDNEDEGWVGGSSTSSE-QTKQAEDEQKDMLGKRFADLLNDSSD  113

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHYQFLGV ADAD+EEIKTAYRRLSKEYHPDTTSLPLK+ASEKFM+L+EVY++LSNDEKR
Sbjct  114  SHYQFLGVSADADMEEIKTAYRRLSKEYHPDTTSLPLKSASEKFMRLREVYDILSNDEKR  173

Query  289  RFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALT  110
            +FYDWTLAQEAAS++AE++RM+ +DP+ QE+  +ESVPDMVDRLGG+NM LS QA SALT
Sbjct  174  KFYDWTLAQEAASRQAEQMRMRLEDPYEQEINRYESVPDMVDRLGGRNMGLSDQAMSALT  233

Query  109  FDILIILFSVCCIVYAIYFKEQY  41
            FDI IILFS+ C+++ ++FKE Y
Sbjct  234  FDIFIILFSIGCLIFVLFFKEPY  256



>ref|XP_006434578.1| hypothetical protein CICLE_v10002209mg [Citrus clementina]
 gb|ESR47818.1| hypothetical protein CICLE_v10002209mg [Citrus clementina]
Length=259

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 205/256 (80%), Gaps = 2/256 (1%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPP  623
            MAST +PQS +S+  + +   L+Q     R        + +R+FA+ +      ++ A P
Sbjct  3    MASTVSPQSPYSLFLKTQHGSLQQLTKEPRAATARTRSKILRVFASQKAGSNKSQRRAQP  62

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQQLKADENE--LLGDKFSELLNSSTDSHYQFLG  449
            GVDTRIHWENEDEGWIGGSSSSS    Q   A+E +  LLG+KF++LL++S+DSHYQFLG
Sbjct  63   GVDTRIHWENEDEGWIGGSSSSSHQTNQNFNAEEEQKNLLGEKFADLLDNSSDSHYQFLG  122

Query  448  VGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTL  269
            +   AD+EEIK+AYRRLSKEYHPDTTSLPLKAASEKF+KL+EVY+VLSN+E RRFYDWTL
Sbjct  123  ISPSADLEEIKSAYRRLSKEYHPDTTSLPLKAASEKFLKLREVYDVLSNEESRRFYDWTL  182

Query  268  AQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIIL  89
            AQEAAS++AEKL+MKF+DP+ Q ++N+ES+PDMVDRLGG+N+ELS QA +ALTFD+++I+
Sbjct  183  AQEAASRKAEKLKMKFEDPYDQALKNYESIPDMVDRLGGRNIELSDQAMTALTFDVVVII  242

Query  88   FSVCCIVYAIYFKEQY  41
            F+ CCI+YA+YFKE Y
Sbjct  243  FTFCCIIYALYFKEPY  258



>ref|XP_011001096.1| PREDICTED: dnaJ homolog subfamily B member 14 [Populus euphratica]
Length=256

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 206/263 (78%), Gaps = 16/263 (6%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRC------RRTE---LRQSPAVErrrrpygcrrevRIFATTQGPK  650
            MASTTA Q+ FS+  R       RR +   +R++P+     R         ++A    P+
Sbjct  1    MASTTATQAPFSLFLRTENGSGHRRKKHLLVRKAPS----GRTGNRGSVFGVYAEQGSPE  56

Query  649  PPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTD  470
             P R  APPGVDTRIHW+NEDEGW+GG+S+SS  Q +Q + ++ ++LG +F++LLN S+D
Sbjct  57   KPRR--APPGVDTRIHWDNEDEGWVGGTSTSSE-QTKQAEDEQKDMLGKRFADLLNDSSD  113

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHYQFLGV ADAD+EEIKTAYRRLSKEYHPDTTSLPLK+ASEKFM+L+EVY++LS++EKR
Sbjct  114  SHYQFLGVSADADMEEIKTAYRRLSKEYHPDTTSLPLKSASEKFMRLREVYDILSSEEKR  173

Query  289  RFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALT  110
            +FYDWTLAQEAAS++AEK+RM+ +DP+ QE+  +ESVPDMVDRLGG+NM LS QA SALT
Sbjct  174  KFYDWTLAQEAASRQAEKMRMRLEDPYEQEINRYESVPDMVDRLGGRNMGLSDQAISALT  233

Query  109  FDILIILFSVCCIVYAIYFKEQY  41
            FDI IILFS+ C+++ I+FKE Y
Sbjct  234  FDIFIILFSIGCLIFVIFFKEPY  256



>emb|CDP03536.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   314 bits (805),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 183/205 (89%), Gaps = 5/205 (2%)
 Frame = -2

Query  661  QGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLN  482
            QGP    R+ APPGVDTRIHWENEDEGWIGG  S   TQEQ LK D+N LLG  FS+LLN
Sbjct  56   QGPNQ--RRRAPPGVDTRIHWENEDEGWIGGPKSQP-TQEQ-LKTDQN-LLGQNFSDLLN  110

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS+DSHYQFLGV A+AD+EEIK AYRRLSKEYHPDTTSLPLKAAS+KFMKL+EVY++LSN
Sbjct  111  SSSDSHYQFLGVSAEADMEEIKAAYRRLSKEYHPDTTSLPLKAASDKFMKLREVYDILSN  170

Query  301  DEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAK  122
            +EKR+FYDWTLAQEA S+EA+K+R K  DPHMQ+V+NWES+PDMVDRLGG+NMELS QAK
Sbjct  171  EEKRKFYDWTLAQEAVSREADKMRKKLADPHMQDVDNWESIPDMVDRLGGRNMELSDQAK  230

Query  121  SALTFDILIILFSVCCIVYAIYFKE  47
            SALTFD+LIILFS+CCIVYA++FKE
Sbjct  231  SALTFDVLIILFSICCIVYALFFKE  255



>ref|XP_004247453.1| PREDICTED: uncharacterized protein LOC101257008 [Solanum lycopersicum]
Length=270

 Score =   311 bits (797),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 166/258 (64%), Positives = 203/258 (79%), Gaps = 4/258 (2%)
 Frame = -2

Query  814  IPIPMASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQ  635
            I   MAS TAP + F+ L R +     ++       +    R  ++++A  +G     RQ
Sbjct  17   ISNSMASATAPPAPFTFLTRNQTNNEHRTDTRWLTTKQRRRRVGLQVYAKEEGA--TGRQ  74

Query  634  TAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQF  455
             APPGVDTRIHWENEDEGW+G  S S STQE+ +K DE  L  +KFS+LLNSS +SHYQF
Sbjct  75   RAPPGVDTRIHWENEDEGWVG-ESKSRSTQER-IKTDEKNLFDEKFSDLLNSSANSHYQF  132

Query  454  LGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDW  275
            LGV A AD+EEIK AYRRLSKEYHPDTT+LP++AASEKFMKL+E+Y+VLS++E+RRFYDW
Sbjct  133  LGVSATADLEEIKAAYRRLSKEYHPDTTNLPIRAASEKFMKLREIYDVLSDEEQRRFYDW  192

Query  274  TLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILI  95
            TLAQE AS+EAEK++M+ QDP M EVENWESVPDMVDRLGG+NMELS+QAK+ALTFDILI
Sbjct  193  TLAQETASREAEKMKMRLQDPRMLEVENWESVPDMVDRLGGRNMELSNQAKTALTFDILI  252

Query  94   ILFSVCCIVYAIYFKEQY  41
            I+FS CCI+YA+ FKEQY
Sbjct  253  IIFSFCCIIYAVVFKEQY  270



>ref|XP_006359423.1| PREDICTED: dnaJ homolog subfamily C member 14-like [Solanum tuberosum]
Length=250

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 204/254 (80%), Gaps = 4/254 (2%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPP  623
            MAS TAP + F+ L R       ++ A     +    R  ++++AT +G     +Q APP
Sbjct  1    MASATAPPTPFTFLSRNLSNNDHRTDARWLTTKQRRRRVGLQVYATEEGASG--QQRAPP  58

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVG  443
            GVDTRIHWENEDEGW+G  S S STQE+ +K ++  LL +KFS+LLNSS +SHYQFLGV 
Sbjct  59   GVDTRIHWENEDEGWVG-ESKSRSTQER-IKTEKKNLLDEKFSDLLNSSANSHYQFLGVS  116

Query  442  ADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQ  263
            A AD+EEIK AYRRLSKEYHPDTT+LP++AASEKFMKL+E+Y+VLS++E+RRFYDWTLAQ
Sbjct  117  ATADLEEIKAAYRRLSKEYHPDTTNLPIRAASEKFMKLREIYDVLSDEEQRRFYDWTLAQ  176

Query  262  EAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFS  83
            E AS+EAEK++M+ QDP M EVENWESVPDMVDRLGG+NMELS+QAK+ALTFDILII+FS
Sbjct  177  ETASREAEKMKMRLQDPRMLEVENWESVPDMVDRLGGRNMELSNQAKTALTFDILIIIFS  236

Query  82   VCCIVYAIYFKEQY  41
             CCI+YA+ FKEQY
Sbjct  237  FCCIIYAVVFKEQY  250



>ref|XP_007045885.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
 gb|EOY01717.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao]
Length=299

 Score =   310 bits (793),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 181/211 (86%), Gaps = 5/211 (2%)
 Frame = -2

Query  667  TTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENE--LLGDKFS  494
             +QGP    RQ APPGVDTRIHW+NEDEGWIGGSS S  T+E+ L A+E +  LLG+KF+
Sbjct  91   ASQGPSG--RQRAPPGVDTRIHWDNEDEGWIGGSSKSQQTEEK-LGAEEQQKNLLGEKFA  147

Query  493  ELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYE  314
            +LLN S+DSHYQFLGV A+AD+EE+K AYRRLSKEYHPDTTSLPLKAASEKFMKL+EVY 
Sbjct  148  DLLNDSSDSHYQFLGVSAEADLEEVKAAYRRLSKEYHPDTTSLPLKAASEKFMKLREVYN  207

Query  313  VLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELS  134
            VLS++E RRFYDWTLAQEAAS++AEKLR++ +DP+ Q++ N++  PDMVDRLGG+NMELS
Sbjct  208  VLSSEESRRFYDWTLAQEAASRKAEKLRIRLEDPYQQDLRNYKPKPDMVDRLGGRNMELS  267

Query  133  SQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
             QA +ALTFD+ +I+F++CCI+Y + FKE Y
Sbjct  268  DQAMTALTFDVFVIIFAICCIIYVLVFKEPY  298



>ref|XP_011079729.1| PREDICTED: dnaJ homolog subfamily C member 9 [Sesamum indicum]
Length=249

 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 207/253 (82%), Gaps = 6/253 (2%)
 Frame = -2

Query  799  ASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPPG  620
            A T  P + FS+  + + ++ R +  V +  R    R   R+ A  QG     RQ APPG
Sbjct  3    APTATPPASFSLSLKSQPSKPRATHLVNQGTRETNHRGRFRVLAV-QGSDG--RQRAPPG  59

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHWENEDEGWIGGSS  S TQEQ    D+++LLG+KFS+LL+SSTDS+YQFLGV A
Sbjct  60   VDTRIHWENEDEGWIGGSSPRS-TQEQ--VKDDDDLLGEKFSDLLDSSTDSYYQFLGVPA  116

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            +AD+EEIK+AYRRLSKEYHPDTT+LPL+AAS+KFM+L+E+Y VLS+DEKR+FYDWTLAQE
Sbjct  117  NADLEEIKSAYRRLSKEYHPDTTTLPLRAASDKFMQLREIYNVLSDDEKRKFYDWTLAQE  176

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            AAS+EAE++RMK +DP+MQ++ENWES+PDMVDRLGG+NMELS QAK ALTFDILII+FS+
Sbjct  177  AASREAERMRMKLEDPYMQDIENWESIPDMVDRLGGRNMELSDQAKQALTFDILIIIFSI  236

Query  79   CCIVYAIYFKEQY  41
            CCI+Y ++FKE Y
Sbjct  237  CCIIYVVFFKEPY  249



>ref|XP_010679887.1| PREDICTED: uncharacterized protein LOC104895126 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 199/257 (77%), Gaps = 8/257 (3%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRT-----ELRQSPAVErrrrpygcrrevRIFATTQGPKPPPR  638
            MAST+AP S  S+     R      + + +  +++         ++ +FA TQ      +
Sbjct  1    MASTSAPPSPLSLFLGNNRNGYPTWKKQVTILIQKAVAKRKNHAKLCVFAATQDAGE--Q  58

Query  637  QTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQ  458
            Q APPGVDTRIHWENEDEGWIGGS+S ++ ++ + + ++ +LLG+KF+ELLNSS DSHYQ
Sbjct  59   QRAPPGVDTRIHWENEDEGWIGGSTSKANEEQFKAETEQKDLLGEKFAELLNSS-DSHYQ  117

Query  457  FLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYD  278
            FLGV  DAD+EEIK AYRRLSKEYHPDTTSLPLK ASEKFM+L+++Y+VLS++E RRFYD
Sbjct  118  FLGVTPDADLEEIKGAYRRLSKEYHPDTTSLPLKTASEKFMRLRDIYDVLSDEESRRFYD  177

Query  277  WTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDIL  98
            WTLAQE AS+EAE ++MK +DP+ Q++ N+E VPD+VDRLGGKN+ELS QA +ALTFD +
Sbjct  178  WTLAQEVASREAEMMKMKLEDPYEQDLRNYEPVPDLVDRLGGKNLELSDQAMTALTFDAI  237

Query  97   IILFSVCCIVYAIYFKE  47
            I++FS+ CI+YA++FKE
Sbjct  238  IVVFSIGCIIYAVFFKE  254



>gb|KJB60803.1| hypothetical protein B456_009G326500 [Gossypium raimondii]
Length=257

 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 174/213 (82%), Gaps = 3/213 (1%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQ-QLKADENELLGDK  500
            +FA T GP  P  Q  PPGVDTRIHW+NEDEGWIG SS+S  T+E+   + ++  LLG+K
Sbjct  46   VFAATTGPSKP--QRPPPGVDTRIHWDNEDEGWIGESSNSRQTKEKLNPEEEQKSLLGEK  103

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F++LLN S+DSHYQFLGV A+AD+EEIK AYRRLSKEYHPDTTSLPLKAASEKFMKL+EV
Sbjct  104  FADLLNDSSDSHYQFLGVSAEADLEEIKAAYRRLSKEYHPDTTSLPLKAASEKFMKLREV  163

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y VLS+ E R FYDWTLAQEAAS++AEKLRM+  DP+ Q+V N+   PD VDRLGG+NME
Sbjct  164  YNVLSDGESRSFYDWTLAQEAASRKAEKLRMRLDDPYQQDVRNYVPKPDKVDRLGGRNME  223

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            L+ QA SALTFD  +I+F++CCIVY + FKE Y
Sbjct  224  LNDQALSALTFDAFVIIFAICCIVYVLVFKEPY  256



>ref|XP_008462782.1| PREDICTED: dnaJ homolog subfamily B member 12 [Cucumis melo]
Length=234

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 168/200 (84%), Gaps = 4/200 (2%)
 Frame = -2

Query  640  RQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHY  461
            R+  PPGVDTRIHW+NE+EGWIGG    S+ Q  +     N +LG   ++LLN+S+DSHY
Sbjct  38   RRRPPPGVDTRIHWQNEEEGWIGGKKKESNDQNNE----SNNMLGPSLADLLNNSSDSHY  93

Query  460  QFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFY  281
            QFLGVGA+A+VEEIK+AYRRLSKEYHPDTTSLPLK ASEKFMKLK+VYEVLSN+E R+FY
Sbjct  94   QFLGVGAEAEVEEIKSAYRRLSKEYHPDTTSLPLKVASEKFMKLKQVYEVLSNEESRKFY  153

Query  280  DWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDI  101
            DWTLAQE AS++A+KLR+K +DP+ QE++NW+S PDMVDRLGG+NMELS QA +ALT DI
Sbjct  154  DWTLAQEEASRQADKLRIKLEDPYEQELQNWQSTPDMVDRLGGRNMELSDQATTALTLDI  213

Query  100  LIILFSVCCIVYAIYFKEQY  41
             IILF++ CIVY + FKE Y
Sbjct  214  FIILFAIACIVYVLIFKEPY  233



>ref|XP_010104484.1| Chaperone protein DnaJ [Morus notabilis]
 gb|EXC01085.1| Chaperone protein DnaJ [Morus notabilis]
Length=252

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  667  TTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSEL  488
               G  P  R+ +PPGVDTRIHW+NEDEGW+GGSSSSS++   Q   D+  LLG+KF++L
Sbjct  43   AVSGEGPRKRERSPPGVDTRIHWDNEDEGWVGGSSSSSTSTSGQAHDDQKNLLGEKFADL  102

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            LN S DSHYQFLGV  +AD+EEIK AYRRLSKEYHPDTTSLPLKAAS+KF++L+EVY+VL
Sbjct  103  LNQSADSHYQFLGVSVEADLEEIKAAYRRLSKEYHPDTTSLPLKAASDKFLRLREVYDVL  162

Query  307  SNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQ  128
            SN+E RRFYDWTLAQEAAS++AEK+R+K +DP+ Q++ N+E VP++VDRLGG+NM+LS Q
Sbjct  163  SNEESRRFYDWTLAQEAASRQAEKMRVKLEDPYEQDLRNYEPVPEVVDRLGGRNMDLSDQ  222

Query  127  AKSALTFDILIILFSVCCIVYAIYFKEQY  41
            A +ALTFD+ I++F++CCI+Y I+FKE Y
Sbjct  223  AMTALTFDVFIVVFAICCIIYVIFFKEPY  251



>ref|XP_010530162.1| PREDICTED: dnaJ homolog subfamily B member 14 [Tarenaya hassleriana]
Length=253

 Score =   298 bits (764),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 168/202 (83%), Gaps = 6/202 (3%)
 Frame = -2

Query  649  PPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-KFSELLNSST  473
            P  RQ APPGVDTRIHW+N D+GWIGG   + S  E     D+  L GD KFS+LL  S+
Sbjct  54   PTERQRAPPGVDTRIHWDNPDDGWIGGPDPTKSEVE-----DKTTLFGDDKFSDLLMESS  108

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            DSHYQFLGV ADAD+EEIK AYRRLSKEYHPDTTSLPLK AS+KFMKL+EVY+VLS++E 
Sbjct  109  DSHYQFLGVNADADIEEIKAAYRRLSKEYHPDTTSLPLKTASDKFMKLREVYDVLSDEES  168

Query  292  RRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSAL  113
            RRFYDWTLAQEAAS++AEK+RMK  DP  +++ N++S+PDMVDRLGG+NMELS QA +AL
Sbjct  169  RRFYDWTLAQEAASRQAEKMRMKLDDPKERDLRNYQSIPDMVDRLGGRNMELSDQAMTAL  228

Query  112  TFDILIILFSVCCIVYAIYFKE  47
            TFD+LII+F++CCIVY + FKE
Sbjct  229  TFDVLIIIFAICCIVYVVVFKE  250



>ref|XP_009362458.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Pyrus x bretschneideri]
 ref|XP_009373252.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Pyrus x bretschneideri]
Length=257

 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 178/211 (84%), Gaps = 5/211 (2%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADE--NELLGDKFSE  491
            +QGP    R+ APPGVDTRIHWEN+DEGWIGGSSS     EQ+ ++++  + LLGDKF++
Sbjct  48   SQGPSN--RERAPPGVDTRIHWENDDEGWIGGSSSRKEQAEQEPESEQQKSNLLGDKFAD  105

Query  490  LLNSS-TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYE  314
            LLN S +DSHYQFLGV A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF++L+E+Y+
Sbjct  106  LLNDSISDSHYQFLGVPAEADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFVRLREIYD  165

Query  313  VLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELS  134
            VLSN+E RRFY+WTLAQEAAS++AE +RMK +DP+++ VE +E VPDMVDRLGGKNM L 
Sbjct  166  VLSNEESRRFYNWTLAQEAASRQAEIMRMKLEDPYVKAVETYEPVPDMVDRLGGKNMALG  225

Query  133  SQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
             QA +ALT D+LII+F++CCI Y I+FKE Y
Sbjct  226  DQAMTALTIDVLIIVFAICCITYVIFFKEPY  256



>ref|XP_010246036.1| PREDICTED: uncharacterized protein LOC104589413 [Nelumbo nucifera]
Length=245

 Score =   296 bits (757),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 201/255 (79%), Gaps = 11/255 (4%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPP  623
            MAST AP +  S+L   R+   R   A          RR  R+FA+     P  R+ APP
Sbjct  1    MASTAAPPTL-SLLFGSRKGGNRSEEA------HGRSRRNCRVFASEN---PDRRKRAPP  50

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQ-QLKADENELLGDKFSELLNSSTDSHYQFLGV  446
            GVDTRIHW+N DEGWIGGS+SSS    +  ++ ++  LLG+KFS+LLN+S+DSHYQFLGV
Sbjct  51   GVDTRIHWDNPDEGWIGGSTSSSQASRRLNVEEEQRNLLGEKFSDLLNTSSDSHYQFLGV  110

Query  445  GADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLA  266
              DAD+EEIK AYRRLSKEYHPDTTSLP+KAAS+KFMKLKEVY++LSN+E RRFYDWTLA
Sbjct  111  AVDADMEEIKAAYRRLSKEYHPDTTSLPIKAASDKFMKLKEVYDILSNEESRRFYDWTLA  170

Query  265  QEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILF  86
            QEAAS++AEK++MK +DP+MQEV+NWESVPDMVDRLGG+NM+LS QA +ALT D+ II+F
Sbjct  171  QEAASRKAEKMKMKLEDPYMQEVKNWESVPDMVDRLGGRNMDLSDQAMTALTIDVGIIIF  230

Query  85   SVCCIVYAIYFKEQY  41
            ++CCI+Y ++FKE Y
Sbjct  231  AICCIIYVLFFKEPY  245



>ref|XP_008339223.1| PREDICTED: dnaJ homolog subfamily B member 14 isoform X2 [Malus 
domestica]
Length=260

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 178/215 (83%), Gaps = 9/215 (4%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADE------NELLGD  503
            +QGP    R+ APPGVDTRIHWEN+DEGWIGGSSS     EQ+ ++++      + LLGD
Sbjct  47   SQGPSB--RERAPPGVDTRIHWENDDEGWIGGSSSRKEQAEQEPESEQQKSQRQSNLLGD  104

Query  502  KFSELLNSS-TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLK  326
            KF++LLN S +DSHYQFLGV A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF++L+
Sbjct  105  KFADLLNDSISDSHYQFLGVSAEADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFVRLR  164

Query  325  EVYEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKN  146
            E+Y+VLSN+E R+FY+WTLAQEAAS++AE +RMK +DP+++ VE ++ VPDMVDRLGGKN
Sbjct  165  EIYDVLSNEESRKFYNWTLAQEAASRQAEIMRMKLEDPYVKAVETYKPVPDMVDRLGGKN  224

Query  145  MELSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            M L  QA +ALT D+LII+F++CCI Y I+FKE Y
Sbjct  225  MALGDQAMTALTIDVLIIVFAICCITYVIFFKEPY  259



>ref|XP_008339222.1| PREDICTED: dnaJ homolog subfamily C member 14 isoform X1 [Malus 
domestica]
Length=276

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 178/215 (83%), Gaps = 9/215 (4%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADE------NELLGD  503
            +QGP    R+ APPGVDTRIHWEN+DEGWIGGSSS     EQ+ ++++      + LLGD
Sbjct  63   SQGPSB--RERAPPGVDTRIHWENDDEGWIGGSSSRKEQAEQEPESEQQKSQRQSNLLGD  120

Query  502  KFSELLNSS-TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLK  326
            KF++LLN S +DSHYQFLGV A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF++L+
Sbjct  121  KFADLLNDSISDSHYQFLGVSAEADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFVRLR  180

Query  325  EVYEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKN  146
            E+Y+VLSN+E R+FY+WTLAQEAAS++AE +RMK +DP+++ VE ++ VPDMVDRLGGKN
Sbjct  181  EIYDVLSNEESRKFYNWTLAQEAASRQAEIMRMKLEDPYVKAVETYKPVPDMVDRLGGKN  240

Query  145  MELSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            M L  QA +ALT D+LII+F++CCI Y I+FKE Y
Sbjct  241  MALGDQAMTALTIDVLIIVFAICCITYVIFFKEPY  275



>ref|XP_003539686.1| PREDICTED: uncharacterized protein LOC100819309 [Glycine max]
 gb|KHN32476.1| Chaperone protein DnaJ [Glycine soja]
Length=252

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 4/197 (2%)
 Frame = -2

Query  631  APPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFL  452
            APPGVDTRIHWENEDEGWIGG++    T+ QQ     N L  D F +LL++S  SHY+FL
Sbjct  58   APPGVDTRIHWENEDEGWIGGTN----TKHQQTHKPNNMLQADDFPDLLSASLGSHYEFL  113

Query  451  GVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWT  272
            GV  DAD+EEIK AYR+LSKEYHPDTTSLPLK ASEKFMKL+EVY VLSN+E R+FYDWT
Sbjct  114  GVSPDADLEEIKVAYRKLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSNEESRKFYDWT  173

Query  271  LAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILII  92
            LAQE AS+ AEK++MK +DP  Q+++NWE VPDMVDRLGG+NM+LS QA SA+T D+ II
Sbjct  174  LAQEVASRHAEKMKMKLEDPREQQLKNWEPVPDMVDRLGGRNMKLSDQAVSAITIDLFII  233

Query  91   LFSVCCIVYAIYFKEQY  41
            +F++CCI+Y I+FKE Y
Sbjct  234  VFAICCIIYVIFFKEPY  250



>emb|CDX75107.1| BnaC09g25750D [Brassica napus]
Length=243

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 166/213 (78%), Gaps = 13/213 (6%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-K  500
            +   +QGP  P      PGVDTRIHWEN D+GWIGG           +K D+  L  D K
Sbjct  42   LIHASQGPTKPL-----PGVDTRIHWENPDDGWIGGG-------SDPIKPDDTNLFSDDK  89

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F+EL+  S DSHYQFLGV  DAD+E+IK+AYRRLSKEYHPDTTSLPLK AS+KFMKLKEV
Sbjct  90   FAELIKDSFDSHYQFLGVSTDADLEDIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLKEV  149

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y+VLS++E RRFYDWTLAQE AS++AEK+RMK +DP  QE  N+ES+PDMVDRLGG+NME
Sbjct  150  YDVLSDEESRRFYDWTLAQEVASRQAEKMRMKLEDPKEQEFRNYESIPDMVDRLGGRNME  209

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            LS QA +ALTFD+LII+F+VCCIVY + FK+ Y
Sbjct  210  LSDQAMTALTFDVLIIVFAVCCIVYVVVFKDPY  242



>ref|XP_004137622.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit T, chloroplastic 
isoform X1 [Cucumis sativus]
 gb|KGN64159.1| hypothetical protein Csa_1G042670 [Cucumis sativus]
Length=234

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 164/200 (82%), Gaps = 4/200 (2%)
 Frame = -2

Query  640  RQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHY  461
            R+  PPGVDTRIHW+NE+EGWIG     S+ Q        N +LG   ++LLN+S+DSHY
Sbjct  38   RRRPPPGVDTRIHWQNEEEGWIGRKKKESNDQNNV----SNNMLGPSLADLLNNSSDSHY  93

Query  460  QFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFY  281
            QFLGV A+A+VEEIK+AYRRLSKEYHPDTTSLPLK ASEKFMKLK+VYEVLSN+E R+FY
Sbjct  94   QFLGVDAEAEVEEIKSAYRRLSKEYHPDTTSLPLKVASEKFMKLKQVYEVLSNEESRKFY  153

Query  280  DWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDI  101
            DWTLAQE AS++A+KLRMK +DP+ QE++NW S PDMVDRLGG+N+ELS QA +ALT DI
Sbjct  154  DWTLAQEEASRQADKLRMKLEDPYEQELQNWVSTPDMVDRLGGRNLELSDQASTALTLDI  213

Query  100  LIILFSVCCIVYAIYFKEQY  41
             IILF++ CIVY + FKE Y
Sbjct  214  FIILFAIACIVYVLLFKEPY  233



>ref|XP_002874566.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH50825.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=247

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 169/207 (82%), Gaps = 7/207 (3%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-KFSEL  488
            +QGP  PP+ +  PGVDTRIHWE+ DEGWIGG S  + + ++    D+  LL D KF+EL
Sbjct  44   SQGPTKPPKPS--PGVDTRIHWESPDEGWIGGRSDPTKSVDE----DKTNLLSDEKFAEL  97

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            +  S DSHYQFLGV  DAD+EEIK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EVY VL
Sbjct  98   IKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREVYNVL  157

Query  307  SNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQ  128
            S++E RRFYDWTLAQE AS++AEK+RMK +DP  Q+   +ES+PDMVDRLGG+NMELS Q
Sbjct  158  SDEETRRFYDWTLAQEVASRQAEKMRMKLEDPKEQDFRGYESIPDMVDRLGGRNMELSDQ  217

Query  127  AKSALTFDILIILFSVCCIVYAIYFKE  47
            A +ALTFDILIILF+VCCIV+ + FK+
Sbjct  218  AMTALTFDILIILFAVCCIVFVLVFKD  244



>ref|XP_009113533.1| PREDICTED: uncharacterized protein LOC103838834 [Brassica rapa]
 emb|CDY48053.1| BnaA09g23050D [Brassica napus]
Length=243

 Score =   291 bits (744),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 166/213 (78%), Gaps = 13/213 (6%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-K  500
            +   +QGP  P      PGVDTRIHWEN D+GWIGG           +K D+  L  D K
Sbjct  42   LIHASQGPTKPL-----PGVDTRIHWENPDDGWIGGG-------SDTIKPDDTNLFSDDK  89

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F+EL+  S DSHYQFLGV  DAD+E+IK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EV
Sbjct  90   FAELIKDSFDSHYQFLGVSTDADLEDIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREV  149

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y+VLS++E RRFYDWTLAQE AS++AEK+RMK +DP  QE  N+ES+PDMVDRLGG+NM+
Sbjct  150  YDVLSDEESRRFYDWTLAQEVASRQAEKMRMKLEDPKEQEFRNYESIPDMVDRLGGRNMD  209

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            LS QA +ALTFD+LII+F+VCCIVY + FK+ Y
Sbjct  210  LSDQAMTALTFDVLIIVFAVCCIVYVVVFKDPY  242



>ref|XP_010421846.1| PREDICTED: dnaJ homolog subfamily B member 12 [Camelina sativa]
Length=249

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 172/211 (82%), Gaps = 8/211 (4%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-K  500
            I+A+ QGP  PP+ +  PGVDTRIHWE+ DEGWIGG S+S+ + E+    D+  L  D K
Sbjct  43   IYAS-QGPTKPPKPS--PGVDTRIHWESLDEGWIGGGSNSTKSVEE----DKTNLFSDEK  95

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F+EL+  S DSHYQFLGV  DAD+EEIK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EV
Sbjct  96   FAELIKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREV  155

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y VLS+ E RRFYDWTLAQE AS++AEK+RMK +DP  QE  ++ES+PDMVDRLGGKNM+
Sbjct  156  YNVLSDVETRRFYDWTLAQEVASRQAEKMRMKLEDPKEQEFRSYESIPDMVDRLGGKNMD  215

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            LS QA +ALTFDI IILF+VCCIV+ I FK+
Sbjct  216  LSDQAMTALTFDIFIILFAVCCIVFVIVFKD  246



>gb|KFK32077.1| hypothetical protein AALP_AA6G196600 [Arabis alpina]
Length=251

 Score =   290 bits (743),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 168/207 (81%), Gaps = 7/207 (3%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLG-DKFSEL  488
            +QGP  PP+ +  PGVDTRIHWEN DEGWIGG S  + + ++    D+  L   DKF+EL
Sbjct  48   SQGPTKPPKPS--PGVDTRIHWENPDEGWIGGGSDPTKSVDE----DKTNLFSEDKFAEL  101

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            +  S DSHYQFLGV  DAD+E+IK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EVY VL
Sbjct  102  IKDSFDSHYQFLGVSTDADLEDIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREVYNVL  161

Query  307  SNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQ  128
            S+ E RRFYDWTLAQE AS++AEK+RMK +DP  Q+  N+ES+PD+VDRLGGKNM+LS Q
Sbjct  162  SDVESRRFYDWTLAQEVASRQAEKMRMKLEDPKEQDFRNYESIPDVVDRLGGKNMDLSDQ  221

Query  127  AKSALTFDILIILFSVCCIVYAIYFKE  47
            A +ALTFD+LII+F++CCIVY + FK+
Sbjct  222  AMTALTFDVLIIVFAICCIVYVVVFKD  248



>ref|XP_006397191.1| hypothetical protein EUTSA_v10028742mg [Eutrema salsugineum]
 gb|ESQ38644.1| hypothetical protein EUTSA_v10028742mg [Eutrema salsugineum]
Length=372

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 170/207 (82%), Gaps = 5/207 (2%)
 Frame = -2

Query  667  TTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSEL  488
            +++GP  PP+ +  PGVDTRIHWEN DEGWIGG S  + + +++     N    DKF+EL
Sbjct  168  SSRGPTKPPKPS--PGVDTRIHWENPDEGWIGGGSDPTKSVDEE---RNNLFSDDKFAEL  222

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            +  S DSHYQFLGV  DAD+EEIK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EVY+VL
Sbjct  223  IKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREVYDVL  282

Query  307  SNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQ  128
            S++E RRFYDWTLAQE AS++AEK+RMK +DP  QE  N+ES+PDMVDRLGG+NMELS Q
Sbjct  283  SDEESRRFYDWTLAQEVASRQAEKMRMKLEDPKEQEFRNYESIPDMVDRLGGRNMELSDQ  342

Query  127  AKSALTFDILIILFSVCCIVYAIYFKE  47
            A +ALTFD+LII+F++CCIVY I FK+
Sbjct  343  AMTALTFDVLIIVFAICCIVYVIAFKD  369



>ref|NP_192673.1| NADH dehydrogenase-like complex T [Arabidopsis thaliana]
 sp|Q9SMS0.1|NDHT_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit T, chloroplastic; 
AltName: Full=DNA J PROTEIN C75; AltName: Full=NAD(P)H 
dehydrogenase subunit T; Short=NDH subunit T; AltName: 
Full=NADH-plastoquinone oxidoreductase subunit T; AltName: Full=Protein 
CHLORORESPIRATORY REDUCTION J; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB55698.1| putative protein [Arabidopsis thaliana]
 emb|CAB78058.1| putative protein [Arabidopsis thaliana]
 gb|AEE82744.1| NADH dehydrogenase-like complex T [Arabidopsis thaliana]
Length=249

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 170/211 (81%), Gaps = 8/211 (4%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-K  500
            I+A+ QGP  P + +  PGVDTRIHWE+ DEGWIGG S  + + ++    D+  LL D K
Sbjct  43   IYAS-QGPTKPSKPS--PGVDTRIHWESPDEGWIGGRSDPAKSVDE----DKTNLLSDEK  95

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F+EL+  S DSHYQFLGV  DAD+EEIK+AYRRLSKEYHPDTTSLPLK ASEKFMKL+EV
Sbjct  96   FAELIKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASEKFMKLREV  155

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y VLS++E RRFYDWTLAQE AS++AEK+RMK +DP  Q+   +ES+PDMVDRLGG+NME
Sbjct  156  YNVLSDEETRRFYDWTLAQEVASRQAEKMRMKLEDPKEQDFRGYESIPDMVDRLGGRNME  215

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            LS QA +ALTFDILI+LF+VCCI + I FK+
Sbjct  216  LSDQAMTALTFDILIVLFAVCCIAFVIVFKD  246



>ref|XP_010435793.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Camelina 
sativa]
Length=249

 Score =   288 bits (736),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 168/211 (80%), Gaps = 8/211 (4%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-K  500
            I+A+ Q P  PP+ +  PGVDTRIHWE+ DEGWIGG S     Q + ++ D+  L  D K
Sbjct  43   IYAS-QDPTKPPKPS--PGVDTRIHWESPDEGWIGGGS----NQTKSVEEDKTNLFSDEK  95

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F+EL+  S DSHYQFLGV  DAD+EEIK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EV
Sbjct  96   FAELIKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREV  155

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y VLS+ E RRFYDWTLAQE AS++AEK+RMK +DP  Q+   +ES+PDMVDRLGGKNM+
Sbjct  156  YNVLSDVETRRFYDWTLAQEVASRQAEKMRMKLEDPKEQDFRGYESIPDMVDRLGGKNMD  215

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            LS QA +ALTFDI IILF+VCCIV+ I FK+
Sbjct  216  LSDQAMTALTFDIFIILFAVCCIVFVIVFKD  246



>ref|XP_010455337.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Camelina 
sativa]
Length=265

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 170/211 (81%), Gaps = 8/211 (4%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-K  500
            I+A+ QGP  PP+ +   GVDTRIHWE+ DEGWIGG S+S+ + E+    D+  LL D K
Sbjct  59   IYAS-QGPTKPPKPSH--GVDTRIHWESPDEGWIGGGSNSTKSVEE----DKTNLLSDEK  111

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F+EL+  S DSHYQFLGV  DAD+EEIK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EV
Sbjct  112  FAELIKDSFDSHYQFLGVSTDADLEEIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREV  171

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y VL + E RRFYDWTLAQE AS++AEK+RMK +DP  QE  ++ES+PDMVDRLGGKNM+
Sbjct  172  YNVLCDVETRRFYDWTLAQEVASRQAEKMRMKLEDPKEQEFRSYESIPDMVDRLGGKNMD  231

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            LS QA +ALTFDI IILF+VCCIV+ I F +
Sbjct  232  LSDQAMTALTFDIFIILFAVCCIVFVIVFTD  262



>gb|KHG19820.1| Triose phosphate/phosphate translocator, chloroplastic [Gossypium 
arboreum]
Length=685

 Score =   296 bits (758),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 173/213 (81%), Gaps = 3/213 (1%)
 Frame = -2

Query  676  IFATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENE-LLGDK  500
            +FA T GP  P R   PPGVDTRIHW+NEDEGWIG SS+S  T+E+    +E + LLG+K
Sbjct  474  VFAATTGPSKPQR--PPPGVDTRIHWDNEDEGWIGESSNSRQTKEKLNPEEEQKSLLGEK  531

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F++ LN S+DSHYQFLGV A+AD+E+IK AYRRLSKEYHPDTTSLPLKAASEKF+KL+EV
Sbjct  532  FADFLNDSSDSHYQFLGVSAEADLEDIKAAYRRLSKEYHPDTTSLPLKAASEKFVKLREV  591

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y VLS+ E R FYDWTLAQEAAS++AEKLRM+  DP+ Q+V N+   PD VDRLGG+NME
Sbjct  592  YNVLSDGESRSFYDWTLAQEAASRKAEKLRMRLDDPYQQDVRNYVPKPDKVDRLGGRNME  651

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            L+ QA SALTFD  +I+F++CCIVY + FKE Y
Sbjct  652  LNDQALSALTFDAFVIIFAICCIVYVLVFKEPY  684



>ref|XP_006288529.1| hypothetical protein CARUB_v10001800mg [Capsella rubella]
 gb|EOA21427.1| hypothetical protein CARUB_v10001800mg [Capsella rubella]
Length=250

 Score =   282 bits (722),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = -2

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD-KFSELLNSSTDSHYQFLGV  446
            GVDTRIHWE+ DEGWIGG S+S+ + E     D+  L  D KF+EL+  S DSHYQFLGV
Sbjct  59   GVDTRIHWESPDEGWIGGGSNSTKSVED----DKTNLFSDEKFAELIKDSFDSHYQFLGV  114

Query  445  GADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLA  266
             +DAD+EEIK+AYRRLSKEYHPDTTSLPLK AS+KFMKL+EVY+VLS++E RRFYDWTLA
Sbjct  115  SSDADLEEIKSAYRRLSKEYHPDTTSLPLKTASDKFMKLREVYDVLSDEETRRFYDWTLA  174

Query  265  QEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILF  86
            QE AS++AEK+RMK +DP  QE  ++ES+PDMVDRLGGKNM+LS QA +ALTFDI IILF
Sbjct  175  QEVASRQAEKMRMKLEDPKEQEFRSYESIPDMVDRLGGKNMDLSDQAMTALTFDIFIILF  234

Query  85   SVCCIVYAIYFKE  47
            +VCCIV+ I FK+
Sbjct  235  AVCCIVFVIVFKD  247



>gb|KHM98836.1| Chaperone protein DnaJ [Glycine soja]
Length=234

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHWENEDEGWIG +++     +Q  K + N L  D F + L +S  SHY+FLGV  
Sbjct  43   VDTRIHWENEDEGWIGATNTK---HQQTHKPNNNMLQADDFPDFLTASLGSHYEFLGVSP  99

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            DADVEEIK AYR+LSKEYHPDTTSLPLK ASEKFMKL+EVY VLSN+E R+FYDWTLAQE
Sbjct  100  DADVEEIKVAYRKLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSNEESRKFYDWTLAQE  159

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            AAS+ AEK++MK +DP  Q+++NWE VPDMVDRLGG+NM+LS QA SA+T D+ II+F++
Sbjct  160  AASRHAEKMKMKLEDPRQQQLKNWEPVPDMVDRLGGRNMKLSDQAVSAITIDLFIIVFAL  219

Query  79   CCIVYAIYFKEQY  41
            CCI+Y I+FKE Y
Sbjct  220  CCIIYVIFFKEPY  232



>ref|XP_003531831.1| PREDICTED: dnaJ homolog subfamily C member 14-like [Glycine max]
Length=246

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHWENEDEGWIG +++     +Q  K + N L  D F + L +S  SHY+FLGV  
Sbjct  55   VDTRIHWENEDEGWIGATNTK---HQQTHKPNNNMLQADDFPDFLTASLGSHYEFLGVSP  111

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            DADVEEIK AYR+LSKEYHPDTTSLPLK ASEKFMKL+EVY VLSN+E R+FYDWTLAQE
Sbjct  112  DADVEEIKVAYRKLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSNEESRKFYDWTLAQE  171

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            AAS+ AEK++MK +DP  Q+++NWE VPDMVDRLGG+NM+LS QA SA+T D+ II+F++
Sbjct  172  AASRHAEKMKMKLEDPRQQQLKNWEPVPDMVDRLGGRNMKLSDQAVSAITIDLFIIVFAL  231

Query  79   CCIVYAIYFKEQY  41
            CCI+Y I+FKE Y
Sbjct  232  CCIIYVIFFKEPY  244



>ref|XP_010064575.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Eucalyptus 
grandis]
 gb|KCW87888.1| hypothetical protein EUGRSUZ_A00280 [Eucalyptus grandis]
Length=261

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 180/213 (85%), Gaps = 6/213 (3%)
 Frame = -2

Query  670  ATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQE-QQLKADENE--LLGDK  500
            + TQGP+ P     PPGVDTRIHWENEDEGWIGG   S S +  +QL A+E +  LLG+K
Sbjct  51   SATQGPQEP---RPPPGVDTRIHWENEDEGWIGGGDGSRSEEGGKQLGAEEEQRNLLGEK  107

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F++LLN S DSHYQFLG+ A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF+KL+EV
Sbjct  108  FADLLNESADSHYQFLGISANADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFLKLREV  167

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y+VLS++E RRFYDWTLAQEAAS++AEK+RM+ +DP+ Q+++N++ VPDMVDRL G+NM+
Sbjct  168  YDVLSDEESRRFYDWTLAQEAASRQAEKMRMRLEDPYEQDLQNYKPVPDMVDRLSGRNMD  227

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            LS QA SALTFD+ II+F++CCI+Y IYFKE Y
Sbjct  228  LSDQAMSALTFDVFIIIFAICCIIYVIYFKEPY  260



>ref|XP_010045171.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Eucalyptus 
grandis]
 gb|KCW87708.1| hypothetical protein EUGRSUZ_A00085 [Eucalyptus grandis]
Length=262

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 180/213 (85%), Gaps = 6/213 (3%)
 Frame = -2

Query  670  ATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQE-QQLKADENE--LLGDK  500
            + TQGP+    +  PPGVDTRIHWENEDEGWIGG   S S +  +QL A+E +  LLG+K
Sbjct  52   SATQGPQ---ERRPPPGVDTRIHWENEDEGWIGGGDGSRSEEGGKQLGAEEEQRNLLGEK  108

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F++LLN S DSHYQFLG+ A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF+KL+EV
Sbjct  109  FADLLNESADSHYQFLGISANADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFLKLREV  168

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNME  140
            Y+VLS++E RRFYDWTLAQEAAS++AEK+RM+ +DP+ QE++N++ VPDMVDRL G+NM+
Sbjct  169  YDVLSDEESRRFYDWTLAQEAASRQAEKMRMRLEDPYEQELQNYKPVPDMVDRLSGRNMD  228

Query  139  LSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            LS QA SALTFD+ II+F++CCI+Y IYFKE Y
Sbjct  229  LSDQAMSALTFDVFIIIFAICCIIYVIYFKEPY  261



>ref|XP_008786524.1| PREDICTED: dnaJ homolog subfamily C member 24 isoform X2 [Phoenix 
dactylifera]
Length=210

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW N DEGWIGG ++ ++  E++      E+LG++F+EL++ S  SHYQFLGV A
Sbjct  23   VDTRIHWSNPDEGWIGGKTTPTTQSEKK-----EEILGERFAELIDKSAASHYQFLGVSA  77

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            +AD+EEIK AYRRLSKEYHPDTTSLPLKAA+EKF++L+E Y VLSN++ RRFYDWTLAQE
Sbjct  78   EADMEEIKAAYRRLSKEYHPDTTSLPLKAAAEKFIELREAYNVLSNEDSRRFYDWTLAQE  137

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+ AE++RMK +DP+ Q+V N ESVPDMVDRLGGKNM+LS QA +A+T D +IILFS+
Sbjct  138  AESRRAERMRMKLEDPYEQDVWNHESVPDMVDRLGGKNMKLSDQAMTAITIDAVIILFSI  197

Query  79   CCIVYAIYFKEQY  41
            CC++Y ++FKEQY
Sbjct  198  CCLIYVVFFKEQY  210



>ref|XP_008786523.1| PREDICTED: dnaJ homolog subfamily C member 24 isoform X1 [Phoenix 
dactylifera]
Length=236

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW N DEGWIGG ++ ++  E++      E+LG++F+EL++ S  SHYQFLGV A
Sbjct  49   VDTRIHWSNPDEGWIGGKTTPTTQSEKK-----EEILGERFAELIDKSAASHYQFLGVSA  103

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            +AD+EEIK AYRRLSKEYHPDTTSLPLKAA+EKF++L+E Y VLSN++ RRFYDWTLAQE
Sbjct  104  EADMEEIKAAYRRLSKEYHPDTTSLPLKAAAEKFIELREAYNVLSNEDSRRFYDWTLAQE  163

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+ AE++RMK +DP+ Q+V N ESVPDMVDRLGGKNM+LS QA +A+T D +IILFS+
Sbjct  164  AESRRAERMRMKLEDPYEQDVWNHESVPDMVDRLGGKNMKLSDQAMTAITIDAVIILFSI  223

Query  79   CCIVYAIYFKEQY  41
            CC++Y ++FKEQY
Sbjct  224  CCLIYVVFFKEQY  236



>ref|XP_012075786.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit T, chloroplastic 
[Jatropha curcas]
 gb|KDP34831.1| hypothetical protein JCGZ_11193 [Jatropha curcas]
Length=263

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 200/265 (75%), Gaps = 13/265 (5%)
 Frame = -2

Query  802  MASTTAPQ-SFFSILQRCRRTE-----LRQSPAVErrrrpygcrrevRIFATTQGPKP-P  644
            MAS  APQ S +S+  R           R++    +++         R+ A TQ P+   
Sbjct  1    MASIAAPQASSYSLFLRSHGNHSHQLLTRKAITRNKKKNSNNNNGGFRVLAETQEPQSQS  60

Query  643  PRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKA----DENELLGDKFSELLNSS  476
             RQ A PGVDTRIHWENE+EGWIGGSS+S  T +++L+         LLGDKF++LLN +
Sbjct  61   KRQRATPGVDTRIHWENEEEGWIGGSSNS--TSQKRLEEEEEEQRKSLLGDKFADLLNDT  118

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            + SHYQFLG+  DAD+EEIK AYRRLSKEYHPDTTSLPLKAAS+KFMKL++VY+VLSN+E
Sbjct  119  SGSHYQFLGISVDADIEEIKAAYRRLSKEYHPDTTSLPLKAASDKFMKLRQVYDVLSNEE  178

Query  295  KRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSA  116
            KR+FYDWTLAQEAAS++ EK+RMK +DP+ Q+++N++SVPDMVDRLGG+NMELS QA SA
Sbjct  179  KRKFYDWTLAQEAASRQQEKMRMKLEDPYQQDLDNYQSVPDMVDRLGGRNMELSDQAMSA  238

Query  115  LTFDILIILFSVCCIVYAIYFKEQY  41
            LT DILII+F++CCI+Y  +FKE Y
Sbjct  239  LTIDILIIIFAICCIIYVAFFKESY  263



>ref|XP_004979103.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Setaria italica]
Length=241

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW + DEGW+GG +      +   +  +NE LG +F++L+N++++SHYQFLG+  
Sbjct  51   VDTRIHWSDPDEGWVGGKAKKEGDGDG--RRGKNEPLGGRFADLINAASESHYQFLGIAP  108

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            +AD+EEIK AYRRLSKEYHPDTT+LPLK ASEKF++L+EVY VLS +E RRFYDWTLAQE
Sbjct  109  EADLEEIKAAYRRLSKEYHPDTTTLPLKTASEKFIRLREVYNVLSKEETRRFYDWTLAQE  168

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+  ++LR + +DP+ Q++EN+ESVPDMVDRLGG+NM+LS QA +ALT DI+II+FSV
Sbjct  169  AESRRLQQLRSRLEDPYEQDIENYESVPDMVDRLGGRNMKLSDQAMTALTVDIVIIIFSV  228

Query  79   CCIVYAIYFKEQY  41
            CCI+YA++FKEQY
Sbjct  229  CCIIYAVFFKEQY  241



>ref|XP_002272533.1| PREDICTED: uncharacterized protein LOC100252905 [Vitis vinifera]
 emb|CAN75474.1| hypothetical protein VITISV_002798 [Vitis vinifera]
 emb|CBI18515.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   273 bits (697),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 200/254 (79%), Gaps = 6/254 (2%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRT--ELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTA  629
            MAST AP   FS+L + + T  +LR      RRRR    +    I A  Q  K P RQ A
Sbjct  1    MASTAAPPPSFSLLLKTQNTTNQLRSVTPSRRRRRSSSSQGGFWILAAAQDSKNP-RQRA  59

Query  628  PPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLG  449
            PPGVDTRIHW+N DEGWIGGSSS      ++   +E  LLG++FS+LL+ S+DSHYQFLG
Sbjct  60   PPGVDTRIHWDNPDEGWIGGSSSKPKLNGEE---EEKNLLGEEFSDLLDDSSDSHYQFLG  116

Query  448  VGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTL  269
            + A AD+EEIK AYRRLSKEYHPDTTSLPLKAAS+KF+KL+EVY+VL ++E+RRFYDWTL
Sbjct  117  ISAQADLEEIKAAYRRLSKEYHPDTTSLPLKAASDKFLKLREVYDVLCDEERRRFYDWTL  176

Query  268  AQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIIL  89
            AQEAAS++AEK++MK +DP+ ++V+NWES+PDMVDRLGG+NMELS QA +ALTFDILII+
Sbjct  177  AQEAASRKAEKMKMKLEDPYQKDVQNWESIPDMVDRLGGRNMELSDQAVTALTFDILIII  236

Query  88   FSVCCIVYAIYFKE  47
            F++CCI+Y + FKE
Sbjct  237  FAICCIIYVLVFKE  250



>ref|XP_009406485.1| PREDICTED: dnaJ homolog subfamily B member 14 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 178/258 (69%), Gaps = 22/258 (9%)
 Frame = -2

Query  814  IPIPMASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQ  635
            + + MAST +P SF  +   C R +   +PA+ +            +      P      
Sbjct  43   VTLAMASTASP-SFSPLF--CGRKQ--ATPALRQ------------MHVVAAAPDSSGEP  85

Query  634  TAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQF  455
            T    VDTRIHW + DEGW+GG      T+     +++ E LG++F++L+N ST SHYQF
Sbjct  86   TRKRRVDTRIHWSSPDEGWVGGK-----TKPDTGASEKKEYLGERFADLINKSTASHYQF  140

Query  454  LGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDW  275
            LGV A+AD+EEIK AYRRLSKEYHPDTTSLPLKAASEKF++L+E Y V+SN++ RRFYDW
Sbjct  141  LGVSAEADMEEIKAAYRRLSKEYHPDTTSLPLKAASEKFIQLREAYNVVSNEDSRRFYDW  200

Query  274  TLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILI  95
            TLAQEA S+   ++RMK +DP+ Q++ NW+SVPD VDRLGGKNM+LS QA +ALT DI I
Sbjct  201  TLAQEAESRRLRQMRMKLEDPYEQDLRNWQSVPDTVDRLGGKNMKLSDQAMTALTIDIGI  260

Query  94   ILFSVCCIVYAIYFKEQY  41
            ILF++CCI+Y + FKE Y
Sbjct  261  ILFTICCIIYVVLFKESY  278



>ref|XP_010930616.1| PREDICTED: uncharacterized protein LOC105051729 [Elaeis guineensis]
Length=236

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW N DEGWIGG ++  +  E++      E+LG +F+EL++ S  SHYQFLGV A
Sbjct  49   VDTRIHWSNPDEGWIGGKTTPKTESEKK-----EEILGGRFAELIDKSAASHYQFLGVSA  103

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
             AD+EEIK AYRRLSKEYHPDTTSLPLKAA++KF++L+E Y VLS+ + RRFYDWTLAQE
Sbjct  104  KADMEEIKAAYRRLSKEYHPDTTSLPLKAAAQKFIQLREAYNVLSDGDSRRFYDWTLAQE  163

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+ AE++RMK +DP+ Q++ ++ESVPD VDRLGGKNM+LS QA +A+T D +IILFS+
Sbjct  164  AESRRAERMRMKLEDPYEQDLRDYESVPDTVDRLGGKNMKLSDQAMTAITIDAVIILFSI  223

Query  79   CCIVYAIYFKEQY  41
            CC++Y ++FKEQY
Sbjct  224  CCLIYVVFFKEQY  236



>ref|XP_003577706.1| PREDICTED: dnaJ homolog subfamily A member 3, mitochondrial [Brachypodium 
distachyon]
Length=242

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 154/193 (80%), Gaps = 5/193 (3%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW N DEGWIGG        ++     +NE LG +F++L+N   +SHYQFLG+  
Sbjct  55   VDTRIHWSNPDEGWIGGKDI-----KEGESGSKNEPLGRRFADLINDPAESHYQFLGIAP  109

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            +AD+EEIK AYRRLSKE+HPDTT LPLK+ASEKF+ L+EVY VLS +E RRFYDWTLAQE
Sbjct  110  EADIEEIKAAYRRLSKEFHPDTTRLPLKSASEKFIWLREVYNVLSEEETRRFYDWTLAQE  169

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+  ++LR + +DP+ Q+++++E VPDMVDRLGGKNMELS QA +AL FDI++I FS+
Sbjct  170  AESRRLQQLRSRLEDPYEQDIQSYEPVPDMVDRLGGKNMELSDQAMTALGFDIVVIFFSI  229

Query  79   CCIVYAIYFKEQY  41
            CCI+YA++FKEQY
Sbjct  230  CCIIYAVFFKEQY  242



>ref|XP_007223682.1| hypothetical protein PRUPE_ppa010245mg [Prunus persica]
 gb|EMJ24881.1| hypothetical protein PRUPE_ppa010245mg [Prunus persica]
Length=257

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 192/258 (74%), Gaps = 6/258 (2%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTAPP  623
            MA T APQ+  + L     T         R              + +QGP    R  APP
Sbjct  1    MAFTAAPQASHTFLLGSPTTTAATRRGARRATTRKATTHVRLHVSASQGPSKSER--APP  58

Query  622  GVDTRIHWENEDEGWIGGsssssSTQEQQLKADE---NELLGDKFSELLNSS-TDSHYQF  455
            GVDTRIHWENEDEGWIGGSS++SS++ QQ +A++   + LL DKF++LLN S +DSHYQF
Sbjct  59   GVDTRIHWENEDEGWIGGSSATSSSKAQQAQAEQEQQSNLLEDKFADLLNDSISDSHYQF  118

Query  454  LGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDW  275
            LGV A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF++L+E+Y VLSN+E RRFY+W
Sbjct  119  LGVSAEADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFVRLREIYNVLSNEETRRFYNW  178

Query  274  TLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILI  95
            TLAQEAAS++AE +RMK +DP+++EVE ++ VPDMVDRLGG+NM L  QA +ALT D+ I
Sbjct  179  TLAQEAASRQAEIMRMKLEDPYVKEVEKYKPVPDMVDRLGGRNMALGDQAMTALTIDVFI  238

Query  94   ILFSVCCIVYAIYFKEQY  41
            I+F++CCI++ I+FKE Y
Sbjct  239  IIFAICCIIFVIFFKEPY  256



>ref|XP_004506395.1| PREDICTED: uncharacterized protein LOC101493556 [Cicer arietinum]
Length=271

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 165/200 (83%), Gaps = 2/200 (1%)
 Frame = -2

Query  637  QTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADE-NELLGDKFSELLNSSTDSHY  461
            Q APPGVDTRIHWENEDEGW+GGS+ SS  ++Q    ++ N+LLG+ F +LL S   SHY
Sbjct  72   QRAPPGVDTRIHWENEDEGWVGGSTKSSEKKKQTNSEEKPNKLLGEDFGDLL-SFEGSHY  130

Query  460  QFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFY  281
            +FLGV  +AD+EEIK  +R+LSKEYHPDTTSLPLK ASEKFMKL+EVY VLSN+E RRFY
Sbjct  131  EFLGVSPEADLEEIKVTFRKLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSNEESRRFY  190

Query  280  DWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDI  101
            DWTLAQE AS++ EKL++K +DP+  E++N+E VPDMVDRLGGKNM+LS QA SALT DI
Sbjct  191  DWTLAQEVASRQQEKLKIKLEDPYEIELKNYEPVPDMVDRLGGKNMKLSDQAVSALTIDI  250

Query  100  LIILFSVCCIVYAIYFKEQY  41
             II+F++CC+ Y ++FKE Y
Sbjct  251  FIIIFAICCVTYVVFFKEPY  270



>gb|EYU46716.1| hypothetical protein MIMGU_mgv1a012583mg [Erythranthe guttata]
Length=246

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 177/200 (89%), Gaps = 6/200 (3%)
 Frame = -2

Query  640  RQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHY  461
            RQ A PG DTRIHWEN+DEGWIGG      T ++++K DE++  GDKFS+LLNSS+DSHY
Sbjct  53   RQPASPGFDTRIHWENDDEGWIGGK-----TSQEKVK-DESDFTGDKFSDLLNSSSDSHY  106

Query  460  QFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFY  281
            QFLGV ++AD+EEIK+AYRRLSKEYHPDTT+LPL+AASEKFMKL+E+Y+VLS++E RRFY
Sbjct  107  QFLGVSSNADLEEIKSAYRRLSKEYHPDTTTLPLRAASEKFMKLREIYDVLSDEETRRFY  166

Query  280  DWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDI  101
            DWTLAQE AS+EAEK+R++ +DP+M+EVE++  V DMVDRLGG+NMEL+ QAK ALTFDI
Sbjct  167  DWTLAQETASREAEKMRIRLEDPYMKEVESYVPVGDMVDRLGGRNMELNDQAKQALTFDI  226

Query  100  LIILFSVCCIVYAIYFKEQY  41
            LII+FS+CCI+Y ++FKEQY
Sbjct  227  LIIIFSICCIIYVVFFKEQY  246



>ref|XP_008219027.1| PREDICTED: dnaJ homolog subfamily B member 14 [Prunus mume]
Length=254

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 181/214 (85%), Gaps = 6/214 (3%)
 Frame = -2

Query  670  ATTQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADE---NELLGDK  500
            + +QGP    R  APPGVDTRIHWENEDEGWIGGSS+SSS++ QQ +A++   + LL DK
Sbjct  42   SASQGPSKHER--APPGVDTRIHWENEDEGWIGGSSASSSSKAQQARAEQEQQSNLLEDK  99

Query  499  FSELLNSS-TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKE  323
            F++LLN S +DSHYQFLGV A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF++L+E
Sbjct  100  FADLLNDSISDSHYQFLGVSAEADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFVRLRE  159

Query  322  VYEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNM  143
            +Y VLSN+E RRFY+WTLAQEAAS++AE +RMK +DP+++EVE ++ VPDMVDRLGG+NM
Sbjct  160  IYNVLSNEETRRFYNWTLAQEAASRQAEIMRMKLEDPYVKEVEKYKPVPDMVDRLGGRNM  219

Query  142  ELSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
             L  QA +ALT D+ II+F++CCI++ I+FKE Y
Sbjct  220  ALGDQAMTALTIDVFIIIFAICCIIFVIFFKEPY  253



>ref|XP_004299890.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit T, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=259

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 170/207 (82%), Gaps = 1/207 (0%)
 Frame = -2

Query  661  QGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLN  482
            +GP    R    PG+DTRIHWENEDEGWIGG+SS   TQ+Q  +  + ++ G+KF++LL+
Sbjct  53   EGPSKRGRPPPAPGIDTRIHWENEDEGWIGGTSSKK-TQQQVEQEQQKDVWGNKFADLLD  111

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
             S DSHYQFLGV A+AD+EEIK AYRRLSKEYHPDTTSLPLK AS+KF++L+E+Y+VLSN
Sbjct  112  DSADSHYQFLGVSAEADLEEIKAAYRRLSKEYHPDTTSLPLKTASDKFVRLREIYDVLSN  171

Query  301  DEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAK  122
            +E RRFY+WTLAQEAAS++AE +RM+ +DP ++EVE +E +PDMVDRLGGKNM L  QA 
Sbjct  172  EESRRFYNWTLAQEAASRQAEMMRMRLEDPFVKEVETYEPIPDMVDRLGGKNMALGDQAV  231

Query  121  SALTFDILIILFSVCCIVYAIYFKEQY  41
            +ALT DI II+F++CCIVY + FKE Y
Sbjct  232  TALTIDIFIIIFAICCIVYVLVFKEPY  258



>ref|XP_007131284.1| hypothetical protein PHAVU_011G001000g [Phaseolus vulgaris]
 gb|ESW03278.1| hypothetical protein PHAVU_011G001000g [Phaseolus vulgaris]
Length=245

 Score =   254 bits (649),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 164/208 (79%), Gaps = 7/208 (3%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELL  485
             Q  + PPR  APPGVDTRIHW+NEDEGWIGG      T+   + AD+     D    LL
Sbjct  43   VQSSRGPPR--APPGVDTRIHWDNEDEGWIGGGDRDKKTKSSNMFADD-----DFSDLLL  95

Query  484  NSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLS  305
             SS  SHY+FLGV  DAD+EEIK AYR+LSKEYHPDTTSLPLK+ASEKFMKL+E+Y VLS
Sbjct  96   TSSLSSHYEFLGVSPDADLEEIKVAYRKLSKEYHPDTTSLPLKSASEKFMKLREIYNVLS  155

Query  304  NDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQA  125
            ++E R+FYDW+LAQEAAS+ AEK++MK +DP MQ++ NWE VPDMVDRLGG+NM+LS+QA
Sbjct  156  DEESRKFYDWSLAQEAASRHAEKMKMKLEDPRMQQLRNWEPVPDMVDRLGGRNMKLSNQA  215

Query  124  KSALTFDILIILFSVCCIVYAIYFKEQY  41
             SA+T D+ II+FS+ CI+Y ++F+E Y
Sbjct  216  VSAITLDVFIIIFSIFCIIYVVFFREPY  243



>ref|NP_001067508.1| Os11g0216100 [Oryza sativa Japonica Group]
 gb|ABA92060.1| DNAJ heat shock N-terminal domain-containing protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF27871.1| Os11g0216100 [Oryza sativa Japonica Group]
 dbj|BAG86910.1| unnamed protein product [Oryza sativa Japonica Group]
Length=251

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 153/193 (79%), Gaps = 6/193 (3%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW + DEGW+GG        ++     + E LG +F++L+N+ ++SHYQFLGV  
Sbjct  65   VDTRIHWSDPDEGWVGG------NAKKDGGGRKKEPLGGRFADLINNPSESHYQFLGVEP  118

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
             AD+EEIK AYRRLSKEYHPDTTSLPL+ ASE+F++L+E Y VLS +E RRFYDWTLAQE
Sbjct  119  KADIEEIKAAYRRLSKEYHPDTTSLPLREASERFIRLREAYNVLSREESRRFYDWTLAQE  178

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+  ++LR + +DP+ Q++++++SVPDMVDRLGG+NM+LS QA +ALT DI II+F V
Sbjct  179  AESRRLQQLRSRLEDPYQQDLDSYQSVPDMVDRLGGRNMDLSDQAMTALTIDIGIIIFCV  238

Query  79   CCIVYAIYFKEQY  41
             C++YA++FKEQY
Sbjct  239  FCLIYAVFFKEQY  251



>ref|XP_006663300.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Oryza brachyantha]
Length=253

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 152/193 (79%), Gaps = 2/193 (1%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW + DEGW+    ++           + E  G +F++L+N+ ++SHYQFLGV A
Sbjct  63   VDTRIHWSDPDEGWV--GGNAKKGGGDGGGGRKKEPFGARFADLINNPSESHYQFLGVEA  120

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
             AD+EEIK AYRRLSKEYHPDTT+LPLKAASE+F++L+E Y VLS +E RRFYDWTLAQE
Sbjct  121  KADIEEIKAAYRRLSKEYHPDTTALPLKAASERFIRLREAYNVLSREESRRFYDWTLAQE  180

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+  ++LR + +DP+ Q+++N++SVPDMVDRLGGKNM+LS QA +ALT DI II+F V
Sbjct  181  AESRRLQQLRSRLEDPYEQDIQNYQSVPDMVDRLGGKNMKLSDQAMTALTIDIAIIIFCV  240

Query  79   CCIVYAIYFKEQY  41
             C++YA++FKEQY
Sbjct  241  LCLIYAVFFKEQY  253



>ref|XP_002449374.1| hypothetical protein SORBIDRAFT_05g008750 [Sorghum bicolor]
 gb|EES08362.1| hypothetical protein SORBIDRAFT_05g008750 [Sorghum bicolor]
Length=246

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 165/214 (77%), Gaps = 10/214 (5%)
 Frame = -2

Query  658  GPKPPPRQTA----PPG----VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGD  503
            G +P P   A    P G    VDTRIHW N DEGW+GG++             +NE LG 
Sbjct  35   GAEPTPATAADGAGPAGKKKTVDTRIHWSNPDEGWVGGNAKKEGGGSGGGS--KNEPLGG  92

Query  502  KFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKE  323
            +F++L+N++++SHYQFLG+  +AD+EEIK AYRRLSKEYHPDTT+LPLK AS+KF++L+E
Sbjct  93   RFADLINNASESHYQFLGIAPEADIEEIKAAYRRLSKEYHPDTTTLPLKVASQKFIRLRE  152

Query  322  VYEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNM  143
            VY VLS +E RRFYDWTLAQEA S+  ++LR + +DP+ Q++ N++SVPDMVDRLGGKNM
Sbjct  153  VYNVLSKEETRRFYDWTLAQEAESRRLQQLRSRLEDPYEQDIINYKSVPDMVDRLGGKNM  212

Query  142  ELSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            ELS QA +ALTFDI+II+ S+C I+YA+YFKEQY
Sbjct  213  ELSDQAMTALTFDIVIIIISICSIIYAVYFKEQY  246



>gb|AFK34686.1| unknown [Medicago truncatula]
Length=247

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 167/208 (80%), Gaps = 13/208 (6%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADEN--ELLGDKFSE  491
            +QGP     Q APPG+DTRIHWEN+DEGWIGGS     T++QQ  A+E   +LLG+ F++
Sbjct  50   SQGP-----QKAPPGIDTRIHWENDDEGWIGGS-----TKQQQTNAEEKPKKLLGEDFAD  99

Query  490  LLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEV  311
            LLN    SHY+FLG+  +ADVE IK A+R+LSKEYHPDTTSLPLK ASEKFMKLKEVY V
Sbjct  100  LLNFQ-GSHYEFLGISPEADVEAIKMAFRKLSKEYHPDTTSLPLKTASEKFMKLKEVYTV  158

Query  310  LSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSS  131
            LSN+E RRFYDWTLAQE AS++ EKL++K +DP+   ++N+E VPDMVDRLGGKNM+LS 
Sbjct  159  LSNEESRRFYDWTLAQEVASRQQEKLKIKLEDPYEVALKNYEPVPDMVDRLGGKNMKLSD  218

Query  130  QAKSALTFDILIILFSVCCIVYAIYFKE  47
            QA SA+T DI II+FS+CCI Y ++FKE
Sbjct  219  QAVSAITIDIFIIIFSICCITYVVFFKE  246



>ref|NP_001148857.1| LOC100282476 [Zea mays]
 gb|ACG33162.1| heat shock protein binding protein [Zea mays]
 gb|AFW60589.1| heat shock protein binding protein [Zea mays]
Length=253

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 182/256 (71%), Gaps = 13/256 (5%)
 Frame = -2

Query  808  IPMASTTAPQSFFSILQRCRRTELRQSPAVErrrrpygcrrevRIFATTQGPKPPPRQTA  629
             PMA++TA + F   L R +R    ++ AV                AT  G  P  ++T 
Sbjct  11   FPMAASTASRIFTPFLHRHQR----RTKAVVVAAASPPDAEPTP--ATADGAGPGKKKT-  63

Query  628  PPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLG  449
               VDTRIHW N DEGW+GG +     +     + +NE LG +F++L+N++ +SHYQFLG
Sbjct  64   ---VDTRIHWSNPDEGWVGGKAKK---EGDGRGSSKNEPLGGRFADLINNAAESHYQFLG  117

Query  448  VGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTL  269
            +  +AD+EEIKTAYRRLSKEYHPDTT+LPLK AS+KF++L+EVY VLS +E RRFYDWTL
Sbjct  118  IAPEADIEEIKTAYRRLSKEYHPDTTTLPLKVASQKFIRLREVYNVLSKEETRRFYDWTL  177

Query  268  AQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIIL  89
            AQEA S+  ++LR + +DP+ Q++ N++ VPDMVDRLGGKNM+LS QA +ALT DI+II+
Sbjct  178  AQEAESRRLQQLRSRLEDPYEQDIINYKPVPDMVDRLGGKNMKLSDQAMTALTIDIVIII  237

Query  88   FSVCCIVYAIYFKEQY  41
             S+CCI+YA++FKEQY
Sbjct  238  ISICCIIYAVFFKEQY  253



>gb|KEH29266.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=269

 Score =   248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 167/208 (80%), Gaps = 13/208 (6%)
 Frame = -2

Query  664  TQGPKPPPRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADEN--ELLGDKFSE  491
            +QGP     Q APPG+DTRIHWEN+DEGWIGGS     T++QQ  A+E   +LLG+ F++
Sbjct  72   SQGP-----QKAPPGIDTRIHWENDDEGWIGGS-----TKQQQTNAEEKPKKLLGEDFAD  121

Query  490  LLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEV  311
            LLN    SHY+FLG+  +ADVE IK A+R+LSKEYHPDTTSLPLK ASEKFMKLKEVY V
Sbjct  122  LLNFQ-GSHYEFLGISPEADVEAIKMAFRKLSKEYHPDTTSLPLKTASEKFMKLKEVYTV  180

Query  310  LSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSS  131
            LSN+E RRFYDWTLAQE AS++ EKL++K +DP+   ++N+E VPDMVDRLGGKNM+LS 
Sbjct  181  LSNEESRRFYDWTLAQEVASRQQEKLKIKLEDPYEVALKNYEPVPDMVDRLGGKNMKLSD  240

Query  130  QAKSALTFDILIILFSVCCIVYAIYFKE  47
            QA SA+T DI II+FS+CCI Y ++FKE
Sbjct  241  QAVSAITIDIFIIIFSICCITYVVFFKE  268



>ref|XP_006858482.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit T, chloroplastic 
[Amborella trichopoda]
 gb|ERN19949.1| hypothetical protein AMTR_s00071p00121290 [Amborella trichopoda]
Length=237

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 159/195 (82%), Gaps = 9/195 (5%)
 Frame = -2

Query  625  PGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGV  446
            PG+DTRIHW++ DEGWIGG S     +E+Q      E   +KFS+L++  TDSHYQFLG+
Sbjct  52   PGMDTRIHWDSPDEGWIGGKSRR--IEEKQ------ESFSEKFSDLIDR-TDSHYQFLGI  102

Query  445  GADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLA  266
              +AD EEIK A+RRLSKEYHPDTTSLPLK+AS+KFM+L+E Y VLSN+E RRFYDW LA
Sbjct  103  PPEADQEEIKAAFRRLSKEYHPDTTSLPLKSASDKFMRLREAYNVLSNEESRRFYDWGLA  162

Query  265  QEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILF  86
            QE+AS+ AEKL++K +DP+ Q+VEN+ESVPDMVDRLGGKN++LS QA +ALT DI II+F
Sbjct  163  QESASRRAEKLKLKLEDPYEQDVENFESVPDMVDRLGGKNIKLSDQAMTALTIDIAIIIF  222

Query  85   SVCCIVYAIYFKEQY  41
            S+CCI+Y  +FKE Y
Sbjct  223  SICCIIYVAFFKEPY  237



>gb|ACU17982.1| unknown [Glycine max]
Length=196

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 127/157 (81%), Gaps = 3/157 (2%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHWENEDEGWIG +++     +Q  K + N L  D F + L +S  SHY+FLGV  
Sbjct  43   VDTRIHWENEDEGWIGATNTK---HQQTHKPNNNMLRADDFPDFLTASLGSHYEFLGVSP  99

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            DADVEEIK AYR+LSKEYHPDTTSLPLK ASEKFMKL+EVY VLSN+E R+FYDWTLAQE
Sbjct  100  DADVEEIKVAYRKLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSNEESRKFYDWTLAQE  159

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGK  149
            AAS+ AEK++MK +DP  Q+++NWE VPDMVDRLGGK
Sbjct  160  AASRHAEKMKMKLEDPRQQQLKNWEPVPDMVDRLGGK  196



>ref|XP_011650709.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit T, chloroplastic 
isoform X2 [Cucumis sativus]
Length=207

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  460  QFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFY  281
            +FLGV A+A+VEEIK+AYRRLSKEYHPDTTSLPLK ASEKFMKLK+VYEVLSN+E R+FY
Sbjct  67   KFLGVDAEAEVEEIKSAYRRLSKEYHPDTTSLPLKVASEKFMKLKQVYEVLSNEESRKFY  126

Query  280  DWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDI  101
            DWTLAQE AS++A+KLRMK +DP+ QE++NW S PDMVDRLGG+N+ELS QA +ALT DI
Sbjct  127  DWTLAQEEASRQADKLRMKLEDPYEQELQNWVSTPDMVDRLGGRNLELSDQASTALTLDI  186

Query  100  LIILFSVCCIVYAIYFKEQY  41
             IILF++ CIVY + FKE Y
Sbjct  187  FIILFAIACIVYVLLFKEPY  206



>gb|EAY80365.1| hypothetical protein OsI_35539 [Oryza sativa Indica Group]
 gb|EAZ17827.1| hypothetical protein OsJ_33370 [Oryza sativa Japonica Group]
Length=237

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 140/193 (73%), Gaps = 20/193 (10%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW + DEGW+GG        ++     + E LG +F              LGV  
Sbjct  65   VDTRIHWSDPDEGWVGG------NAKKDGGGRKKEPLGGRF--------------LGVEP  104

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
             AD+EEIK AYRRLSKEYHPDTTSLPL+ ASE+F++L+E Y VLS +E RRFYDWTLAQE
Sbjct  105  KADIEEIKAAYRRLSKEYHPDTTSLPLREASERFIRLREAYNVLSREESRRFYDWTLAQE  164

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+  ++LR + +DP+ Q++++++SVPDMVDRLGG+NM+LS QA +ALT DI II+F V
Sbjct  165  AESRRLQQLRSRLEDPYQQDLDSYQSVPDMVDRLGGRNMDLSDQAMTALTIDIGIIIFCV  224

Query  79   CCIVYAIYFKEQY  41
             C++YA++FKEQY
Sbjct  225  FCLIYAVFFKEQY  237



>dbj|BAJ86486.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  511  LGDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMK  332
            LG  F++L+N+ ++SHYQFLGV   AD+EEIK AYRRLSKE HPDTT LPLK+ASEKF++
Sbjct  3    LGRSFADLINNPSESHYQFLGVAPGADLEEIKAAYRRLSKECHPDTTRLPLKSASEKFIR  62

Query  331  LKEVYEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGG  152
            L+EVY+VLS +E RRFYDWTLAQEA S+  ++LR + +DP+  +++N++ VPD VDRLGG
Sbjct  63   LREVYKVLSKEESRRFYDWTLAQEAESRRLQQLRSRLEDPYELDLQNYKPVPDTVDRLGG  122

Query  151  KNMELSSQAKSALTFDILIILFSVCCIVYAIYFKEQY  41
            KNMELS QA +ALTFDI II+FS+CCI+YAI+FKEQY
Sbjct  123  KNMELSDQAMTALTFDIGIIIFSICCIIYAIFFKEQY  159



>gb|EMT05725.1| Chaperone protein dnaJ [Aegilops tauschii]
Length=211

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 128/193 (66%), Gaps = 41/193 (21%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW + DEG                                         FLG+  
Sbjct  60   VDTRIHWSDPDEG-----------------------------------------FLGIAP  78

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
             AD+EEIK AYRRLSKEY PDTT LPLK ASEKF++L+EVY+VLS +E RRFYDWTLAQE
Sbjct  79   GADLEEIKAAYRRLSKEYPPDTTRLPLKTASEKFIRLREVYKVLSKEESRRFYDWTLAQE  138

Query  259  AASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSV  80
            A S+  ++LR + +DP+  +++N+E VPD VDRLGGKNMELS QA +AL FDI II+FS+
Sbjct  139  AESRRLQQLRSRLEDPYELDLQNYEPVPDTVDRLGGKNMELSDQAMTALAFDIGIIIFSI  198

Query  79   CCIVYAIYFKEQY  41
            CCI+YA++FKEQY
Sbjct  199  CCIIYALFFKEQY  211



>emb|CCI55385.1| NDH subunit NdhT [Marchantia polymorpha]
Length=162

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 105/155 (68%), Gaps = 14/155 (9%)
 Frame = -2

Query  490  LLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEV  311
            LL  + DSHY++LG+  DAD E+IK AYRRLSK YHPDTT+LPL+ A++KF++LKE Y V
Sbjct  3    LLFQAADSHYRYLGLTPDADTEDIKAAYRRLSKTYHPDTTALPLEVAAQKFVRLKEAYTV  62

Query  310  LSNDEKRRFYDWTLAQEAASK---------EAEKLRMKFQDPHMQEVENWESVPDM---V  167
            LS++++RRFYDW LAQE + +         EA   R   + P+  EV  W+   D    V
Sbjct  63   LSSEQERRFYDWQLAQEVSKRQGGRFIWPYEASGGRGDDRGPYSSEV--WDPENDSKEPV  120

Query  166  DRLGGKNMELSSQAKSALTFDILIILFSVCCIVYA  62
            DRLGG NMELS QA++AL FD   ++ S+  I++A
Sbjct  121  DRLGGDNMELSDQAQAALLFDAFALVVSIFAIIFA  155



>dbj|BAD43651.1| putative protein [Arabidopsis thaliana]
Length=96

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -2

Query  322  VYEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNM  143
            VY VLS++E RRFYDWTLAQE AS++AEK+RMK +DP  Q+   +ES+PDMVDRLGG+NM
Sbjct  2    VYNVLSDEETRRFYDWTLAQEVASRQAEKMRMKLEDPKEQDFRGYESIPDMVDRLGGRNM  61

Query  142  ELSSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            ELS QA +ALTFDILI+LF+VCCI + I FK+
Sbjct  62   ELSDQAMTALTFDILIVLFAVCCIAFVIVFKD  93



>ref|XP_001768838.1| predicted protein [Physcomitrella patens]
 gb|EDQ66391.1| predicted protein [Physcomitrella patens]
Length=368

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 116/198 (59%), Gaps = 16/198 (8%)
 Frame = -2

Query  619  VDTRIHWENEDEGWIGGsssssSTQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGA  440
            VDTRIHW +  EGWIG      ++ + +         G   S LL+ ++DSHY+++G+ +
Sbjct  178  VDTRIHWGDSAEGWIGIDCDDETSSQFRSWGRR----GRSNSSLLDQASDSHYRYMGLSS  233

Query  439  DADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLAQE  260
            DA++EEIK+AYRRLSK YHPDTT LPL+ A++KFM+LK+ Y+ LSN+E R  YD  L  +
Sbjct  234  DAELEEIKSAYRRLSKLYHPDTTQLPLEIAAQKFMRLKDAYDTLSNEELRNLYDSRLENK  293

Query  259  AASKEAEKL-------RMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDI  101
                    L       +  +  P  +  E  +     VD LGG NM LS QA +AL FD+
Sbjct  294  IVMNNEGSLYGYPTSSQQGYNSPTQKRPERVD-----VDTLGGDNMPLSDQALTALGFDL  348

Query  100  LIILFSVCCIVYAIYFKE  47
            L+ +  V  I+Y  YFK 
Sbjct  349  LVFVICVLVIIYVAYFKH  366



>ref|XP_002993582.1| hypothetical protein SELMODRAFT_163076 [Selaginella moellendorffii]
 gb|EFJ05357.1| hypothetical protein SELMODRAFT_163076 [Selaginella moellendorffii]
Length=252

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 122/210 (58%), Gaps = 23/210 (11%)
 Frame = -2

Query  607  IHWENEDEGWI--------------GGsssssSTQEQQLKADENELLGDKFSELLNSSTD  470
            I W + DEGWI              GG +++ +    Q   D+   L D  ++L+   + 
Sbjct  43   IEWSSPDEGWIRFDKDDDPDKEGQGGGRAAAEAAAATQEGKDDQAGLDDTITDLIAHVSG  102

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            +HY+FLG+  +AD EEIK AYR+LSK+YHPD+T+LPL+ A +KF++LKE Y VLS+++ R
Sbjct  103  THYEFLGITPEADTEEIKVAYRKLSKQYHPDSTTLPLEVAGKKFLRLKEAYNVLSSEDDR  162

Query  289  RFYDWTLAQEAASKEAEKLRMKFQDPHMQEVEN---------WESVPDMVDRLGGKNMEL  137
            + YDW LAQEA+     +    ++    Q  E+         W+   D ++ L GKN++L
Sbjct  163  KLYDWHLAQEASKARGGRFIWPYEVDRSQRRESSKPPKWKTEWQPKLDPIEVLDGKNLKL  222

Query  136  SSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            S Q ++AL FD+  IL SV  ++Y  +FK 
Sbjct  223  SDQQQTALAFDLFAILVSVATMIYVGFFKH  252



>ref|XP_002992725.1| hypothetical protein SELMODRAFT_448880 [Selaginella moellendorffii]
 gb|EFJ06206.1| hypothetical protein SELMODRAFT_448880 [Selaginella moellendorffii]
Length=252

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 122/210 (58%), Gaps = 23/210 (11%)
 Frame = -2

Query  607  IHWENEDEGWI--------------GGsssssSTQEQQLKADENELLGDKFSELLNSSTD  470
            I W + DEGWI              GG +++ +    Q   D+   L D  ++L+   + 
Sbjct  43   IEWSSPDEGWIRFDKDDDPDKEGQGGGRAAAEAAAATQEGKDDQAGLDDTITDLIAHVSG  102

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            +HY+FLG+  +AD EEIK AYR+LSK+YHPD+T+LPL+ A +KF++LKE Y VLS+++ R
Sbjct  103  THYEFLGITPEADTEEIKVAYRKLSKQYHPDSTTLPLEVAGKKFLRLKEAYNVLSSEDDR  162

Query  289  RFYDWTLAQEAASKEAEKLRMKFQDPHMQEVEN---------WESVPDMVDRLGGKNMEL  137
            + YDW LAQEA+     +    ++    Q  E+         W+   D ++ L GKN++L
Sbjct  163  KLYDWHLAQEASKARGGRFIWPYEVDRSQLRESSKPPKWKTEWQPKLDPIEVLDGKNLKL  222

Query  136  SSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            S Q ++AL FD+  IL SV  ++Y  +FK 
Sbjct  223  SDQQQTALAFDLFAILVSVATMIYVGFFKH  252



>ref|XP_002534485.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27898.1| conserved hypothetical protein [Ricinus communis]
Length=65

 Score =   100 bits (250),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -2

Query  235  LRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSVCCIVYAIY  56
            +RMK +DP+ Q++EN++SVPDMVDRLGG+N+ELS QA SALT DI I+LF++ CI+Y +Y
Sbjct  1    MRMKLEDPYEQDLENYQSVPDMVDRLGGRNLELSDQAMSALTIDIFIVLFAIGCIIYVLY  60

Query  55   FKEQY  41
            FKE Y
Sbjct  61   FKEPY  65



>ref|WP_015151194.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Oscillatoria acuminata]
 gb|AFY84580.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Oscillatoria acuminata PCC 6304]
Length=154

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 75/143 (52%), Gaps = 12/143 (8%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S  ++Y  LG+   A V EI+ AYR+LSK YHPDT+ LP + A EKF ++K+ Y+ LSND
Sbjct  7    SALNYYALLGLSNGATVPEIRRAYRQLSKRYHPDTSPLPQEEAREKFQQIKDAYKTLSND  66

Query  298  EKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMV-DRLGGKNMELSSQAK  122
             +R  YD  L  E        + +    PH      W+  PD    R  G   ELS +  
Sbjct  67   RERHLYDVKLRLEREGMGGNGVSLP---PH------WKRTPDSAYGRSPGMGRELSERPL  117

Query  121  SALTFDILIIL--FSVCCIVYAI  59
            S+    +L+IL    + C++ AI
Sbjct  118  SSGELFVLLILGITLIGCLLLAI  140



>ref|WP_006909844.1| molecular chaperone DnaJ [Cyanobium sp. PCC 7001]
 gb|EDY37943.1| DnaJ protein [Cyanobium sp. PCC 7001]
Length=156

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            ++ SHY  L + + A  EE++ A+R LSK YHPDTT+LP++ A+E F +LK+ Y VLSN 
Sbjct  8    ASPSHYSLLQLPSSASTEELRQAFRSLSKLYHPDTTALPVEEAAEAFQRLKQAYAVLSNP  67

Query  298  EKRRFYD  278
            E RR YD
Sbjct  68   ESRRRYD  74



>ref|XP_002533580.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28798.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 11/123 (9%)
 Frame = -2

Query  802  MASTTAPQSFFSILQRCRRT-------ELRQSPAVErrrrpygcrrevRIFATTQGPKPP  644
            MASTT+PQ+ +S+L R R +       +L    A+  R +         + A  QGP+  
Sbjct  1    MASTTSPQASYSLLFRSRSSIHSSKEHQLIVRGAI-TRSKKNNGGSSFLVLAAAQGPEKK  59

Query  643  PRQTAPPGVDTRIHWENEDEGWIGGsssssSTQEQQLKADENE-LLGDKFSELLNSSTDS  467
             R  APPGVDTRIHW+N DEGWIGGSSSSSS+Q+Q  + +E + L G  F++LLN ++ S
Sbjct  60   ER--APPGVDTRIHWDNPDEGWIGGSSSSSSSQQQLNEEEEQKNLFGQNFADLLNDASGS  117

Query  466  HYQ  458
            HYQ
Sbjct  118  HYQ  120



>ref|WP_008275921.1| molecular chaperone DnaJ [Cyanothece sp. CCY0110]
 gb|EAZ90912.1| Heat shock protein DnaJ-like [Cyanothece sp. CCY0110]
Length=173

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 52/91 (57%), Gaps = 8/91 (9%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +SHY  LG+   A V EI+ AYR LSK YHPDTT LP   A+ KF +L E Y VLSN +K
Sbjct  5    NSHYAILGLHPSASVIEIRRAYRELSKRYHPDTTELPSAMATAKFQRLNEAYGVLSNPQK  64

Query  292  RRFYDWTLAQEAASKEAEKLRMKFQDPHMQE  200
            R  YD  +          +L +  QDP +Q 
Sbjct  65   RSLYDLQIGY-------SRLNV-IQDPSIQR  87



>dbj|BAD79437.1| DnaJ protein [Synechococcus elongatus PCC 6301]
Length=195

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y  L + + A   +I+ AYR LSK+YHPDTT+LPL AA ++F KL+E Y VLS+ E+RR
Sbjct  17   YYARLRIPSSASDRDIRQAYRELSKQYHPDTTTLPLPAALQEFQKLQEAYAVLSDPERRR  76

Query  286  FYDWTLAQE  260
             YD+ L Q 
Sbjct  77   LYDFQLEQH  85



>ref|WP_011377514.1| MULTISPECIES: molecular chaperone DnaJ [Synechococcus]
 gb|ABB56298.1| Heat shock protein DnaJ-like [Synechococcus elongatus PCC 7942]
 gb|AJD56653.1| molecular chaperone DnaJ [Synechococcus sp. UTEX 2973]
Length=185

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y  L + + A   +I+ AYR LSK+YHPDTT+LPL AA ++F KL+E Y VLS+ E+RR
Sbjct  7    YYARLRIPSSASDRDIRQAYRELSKQYHPDTTTLPLPAALQEFQKLQEAYAVLSDPERRR  66

Query  286  FYDWTLAQE  260
             YD+ L Q 
Sbjct  67   LYDFQLEQH  75



>gb|ACB49806.1| hypothetical protein cce_0455 [Cyanothece sp. ATCC 51142]
Length=191

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +SHY  LG+   A V EI+ AYR LSK YHPDTT LP   A+ KF +L E Y VLSN + 
Sbjct  23   NSHYAILGLHPSASVIEIRRAYRELSKRYHPDTTELPSAMATAKFQRLNEAYGVLSNPQA  82

Query  292  RRFYD  278
            R  YD
Sbjct  83   RSLYD  87



>ref|WP_009546541.1| MULTISPECIES: molecular chaperone DnaJ [Cyanothece]
Length=173

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +SHY  LG+   A V EI+ AYR LSK YHPDTT LP   A+ KF +L E Y VLSN + 
Sbjct  5    NSHYAILGLHPSASVIEIRRAYRELSKRYHPDTTELPSAMATAKFQRLNEAYGVLSNPQA  64

Query  292  RRFYD  278
            R  YD
Sbjct  65   RSLYD  69



>ref|WP_011055973.1| heat shock protein [Thermosynechococcus elongatus]
 ref|NP_680909.1| heat shock protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07671.1| heat shock protein [Thermosynechococcus elongatus BP-1]
Length=157

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            S + +HY  L V   A + EI+ AYR  SK YHPDTT+LPL  A E+F +L E Y VL+N
Sbjct  5    SPSRTHYDILEVAPTASLAEIRRAYREKSKLYHPDTTTLPLAIAREEFHRLNEAYAVLTN  64

Query  301  DEKRRFYDWTLAQEAASK  248
             E+R++YD  L   + SK
Sbjct  65   PEQRQWYDLQLRLRSQSK  82



>ref|WP_012597008.1| MULTISPECIES: molecular chaperone DnaJ [Cyanothece]
 gb|ACK67750.1| heat shock protein DnaJ domain protein [Cyanothece sp. PCC 8801]
 gb|ACV02656.1| heat shock protein DnaJ domain protein [Cyanothece sp. PCC 8802]
Length=179

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +S+Y  LG+   A V EI+ AYR+LSK+YHPDTT+LP + A+  F +L E Y  LSN E+
Sbjct  23   NSYYAILGLHPSASVIEIRRAYRQLSKQYHPDTTTLPTEVATSHFQRLNEAYGTLSNPER  82

Query  292  RRFYD  278
            R  YD
Sbjct  83   RSLYD  87



>emb|CCQ67455.1| DnaJ protein [Crocosphaera watsonii WH 0402]
Length=200

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +SHY  LG+   A V EI+ AYR LSK YHPDTT LP   A+ KF  L E Y VLSN + 
Sbjct  37   NSHYAILGLHPSASVIEIRRAYRELSKRYHPDTTELPSTLATAKFQSLNEAYGVLSNPQT  96

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  97   RSLYDLKIG  105



>ref|WP_041234854.1| heat shock protein, partial [Cyanobacterium stanieri]
Length=138

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            +D++Y   G+   A V EI+ AYR LSK YHPDTTSLPL+ A  KF  L E Y VL+N E
Sbjct  4    SDTYYGLFGLHPSASVMEIRRAYRELSKLYHPDTTSLPLEEARSKFQSLNEAYGVLANPE  63

Query  295  KRRFYD  278
            +R  YD
Sbjct  64   RRSLYD  69



>ref|WP_007310790.1| molecular chaperone DnaJ [Crocosphaera watsonii]
 gb|EHJ12672.1| DnaJ protein [Crocosphaera watsonii WH 0003]
 emb|CCQ63261.1| DnaJ protein [Crocosphaera watsonii WH 0401]
 emb|CCQ52808.1| DnaJ protein [Crocosphaera watsonii WH 8502]
Length=168

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +SHY  LG+   A V EI+ AYR LSK YHPDTT LP   A+ KF  L E Y VLSN + 
Sbjct  5    NSHYAILGLHPSASVIEIRRAYRELSKRYHPDTTELPSTLATAKFQSLNEAYGVLSNPQT  64

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  65   RSLYDLKIG  73



>gb|AFZ47901.1| heat shock protein DnaJ domain protein [Cyanobacterium stanieri 
PCC 7202]
Length=150

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            +D++Y   G+   A V EI+ AYR LSK YHPDTTSLPL+ A  KF  L E Y VL+N E
Sbjct  16   SDTYYGLFGLHPSASVMEIRRAYRELSKLYHPDTTSLPLEEARSKFQSLNEAYGVLANPE  75

Query  295  KRRFYD  278
            +R  YD
Sbjct  76   RRSLYD  81



>ref|WP_044170976.1| molecular chaperone DnaJ [Oscillatoria sp. PCC 10802]
Length=180

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +S+Y  LG+   A V EI+ AYR LSK YHPDTT LP   A+EKF KL E Y  LS+ E+
Sbjct  9    NSYYTLLGLHPSASVIEIRRAYRELSKRYHPDTTELPPAIATEKFQKLNEAYATLSSPER  68

Query  292  RRFYD  278
            R  YD
Sbjct  69   RMAYD  73



>ref|WP_024125592.1| membrane protein with DnaJ domain [Thermosynechococcus sp. NK55a]
 gb|AHB89214.1| membrane protein with DnaJ domain [Thermosynechococcus sp. NK55a]
Length=159

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            S + +HY  L V   A + EI+ AYR  SK YHPDTT+LPL  A E+F +L E Y VL+N
Sbjct  5    SPSRTHYDILEVAPTASLAEIRRAYREKSKLYHPDTTTLPLAIAREEFHRLNEAYAVLTN  64

Query  301  DEKRRFYDWTLAQEAASK  248
             E+R++YD  L     S+
Sbjct  65   PEQRQWYDLQLRLRGQSQ  82



>ref|WP_044450896.1| molecular chaperone DnaJ, partial [Mastigocladus laminosus]
 gb|KIY12159.1| molecular chaperone DnaJ, partial [Mastigocladus laminosus UU774]
Length=140

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -2

Query  484  NSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLS  305
            +S T ++Y  LG+   A   EI+ AYR LSK YHPDTTSLP  AA+ KF +L E Y  LS
Sbjct  4    SSETTTYYTLLGLHPSASPIEIRRAYRELSKRYHPDTTSLPTVAATAKFQQLNEAYATLS  63

Query  304  NDEKRRFYD  278
            N E+R  YD
Sbjct  64   NPERRLSYD  72



>ref|WP_044106348.1| hypothetical protein [cyanobacterium endosymbiont of Epithemia 
turgida]
 dbj|BAP17621.1| molecular chaperone DnaJ [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=154

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +S+Y  LG+   A   EI+ AYR LSK YHPDTT LPL+ A+++F KL E Y  LSN E 
Sbjct  23   NSYYAILGLHPSASAVEIRRAYRELSKLYHPDTTDLPLETATKQFQKLNEAYGTLSNPEG  82

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  83   RSLYDLKIG  91



>ref|WP_041919148.1| molecular chaperone DnaJ [Gloeocapsa sp. PCC 7428]
Length=173

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +SHY  LG+   A   EI+ AYR LSK YHPDTT LP  +A+ KF +L E Y  LSN E+
Sbjct  5    NSHYALLGLHPSASAIEIRRAYRELSKRYHPDTTDLPKASATAKFQQLNEAYATLSNPER  64

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  65   RMQYDLKIG  73



>ref|WP_035122175.1| molecular chaperone DnaJ [Fischerella sp. PCC 9431]
Length=158

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  490  LLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEV  311
            L +S T ++Y  LG+   A   EI+ AYR LSK YHPDTTSLP  AA+ KF +L E Y  
Sbjct  2    LQSSETTTYYTLLGLHPSASPIEIRRAYRELSKRYHPDTTSLPTVAATAKFQQLNEAYAT  61

Query  310  LSNDEKRRFYDWTLA  266
            LSN E+R  YD  + 
Sbjct  62   LSNPERRLSYDLKIG  76



>ref|WP_033378504.1| molecular chaperone DnaJ [Fischerella muscicola]
Length=160

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -2

Query  484  NSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLS  305
            +S T ++Y  LG+   A   EI+ AYR LSK YHPDTTSLP  AA+ KF +L E Y  LS
Sbjct  4    SSETTTYYTLLGLHPSASPIEIRRAYRELSKRYHPDTTSLPTVAATAKFQQLNEAYATLS  63

Query  304  NDEKRRFYDWTLA  266
            N E+R  YD  + 
Sbjct  64   NPERRLSYDLKIG  76



>gb|AFZ31212.1| heat shock protein DnaJ domain protein [Gloeocapsa sp. PCC 7428]
Length=189

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +SHY  LG+   A   EI+ AYR LSK YHPDTT LP  +A+ KF +L E Y  LSN E+
Sbjct  21   NSHYALLGLHPSASAIEIRRAYRELSKRYHPDTTDLPKASATAKFQQLNEAYATLSNPER  80

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  81   RMQYDLKIG  89



>gb|KHF31246.1| Chaperone protein DnaJ [Anoxybacillus sp. BCO1]
Length=121

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_017311353.1| molecular chaperone DnaJ [Fischerella sp. PCC 9339]
Length=160

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -2

Query  484  NSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLS  305
            +S T ++Y  LG+   A   EI+ AYR LSK YHPDTTSLP  AA+ KF +L E Y  LS
Sbjct  4    SSETTTYYTLLGLHPSASPIEIRRAYRELSKRYHPDTTSLPTVAATAKFQQLNEAYATLS  63

Query  304  NDEKRRFYDWTLA  266
            N E+R  YD  + 
Sbjct  64   NPERRLSYDLKIG  76



>ref|WP_038027909.1| heat shock protein, partial [Synechococcus sp. NKBG15041c]
Length=152

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY   G+   A V EI+  YR LSK+YHPDTT LP   A+ KF +L E Y +LSN E+R
Sbjct  24   SHYGLFGLSPTASVIEIRQRYRELSKQYHPDTTVLPEAEATAKFQRLNEAYGILSNPERR  83

Query  289  RFYDWTLA  266
              YD  + 
Sbjct  84   SLYDLKIG  91



>ref|WP_010311009.1| molecular chaperone DnaJ [Synechococcus sp. CB0101]
Length=169

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            +  +HY+ L +  DA  +E++ A+RRLSK YHPDTT LP + A E F  L++ Y  LS+ 
Sbjct  2    AAANHYELLQIAPDASQQELRQAFRRLSKRYHPDTTDLPAEQAEEAFRHLQQAYLTLSDP  61

Query  298  EKRRFYDWTL  269
            E+RR YD +L
Sbjct  62   ERRRVYDVSL  71



>ref|WP_039729747.1| MULTISPECIES: hypothetical protein, partial [Oscillatoriophycideae]
Length=144

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            T +HY  L V   A  +EI+ AYR +SK YHPDTT+LP   A+EKF  L + Y  LSN E
Sbjct  7    TPNHYTLLNVKPTASPQEIRRAYRDMSKLYHPDTTTLPPAIATEKFKYLNDAYATLSNPE  66

Query  295  KRRFYDWTLA  266
            KR  YD+++ 
Sbjct  67   KRTAYDYSIG  76



>ref|WP_016875608.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=186

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            ST ++Y  LG+   A   EI+ AYR LSK YHPDTTSLP   A+ KF +L E Y  LSN 
Sbjct  7    STSTYYTLLGLHPAASPIEIRRAYRELSKRYHPDTTSLPTAVATAKFQQLNEAYATLSNP  66

Query  298  EKRRFYD  278
            E+R  YD
Sbjct  67   ERRLSYD  73



>ref|WP_017285969.1| hypothetical protein [Leptolyngbya boryana]
Length=210

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            +HY  LG+     V EI+ AYR LSK YHPDTT LP   A+ KF +L E Y  LSN E+R
Sbjct  14   NHYALLGLHPSTSVREIRQAYRELSKLYHPDTTELPTAIATRKFQRLNEAYATLSNPERR  73

Query  289  RFYDWTLA  266
              YD  + 
Sbjct  74   TAYDRAIG  81



>gb|KIJ80791.1| molecular chaperone DnaJ [Scytonema tolypothrichoides VB-61278]
Length=173

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A V EI+ AYR LSK YHPDTT LP   A+ KF +L E Y  LSN
Sbjct  4    SSKPTYYSLLGLHPSASVIEIRRAYRELSKHYHPDTTKLPTAVATGKFQQLNEAYATLSN  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRFSYDLKIG  75



>ref|WP_038546157.1| hypothetical protein [Synechococcus sp. KORDI-100]
Length=178

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -2

Query  490  LLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEV  311
            LLNS    HY+ LGV + AD E ++ A+RR SK+ HPDTT+LP   A+ +F  L++ YE+
Sbjct  3    LLNSRC--HYERLGVASTADSETLRQAFRRRSKDLHPDTTALPADQAASEFQMLRQSYEL  60

Query  310  LSNDEKRRFYDWTLAQEAAS  251
            L + E+RR YD   A + A+
Sbjct  61   LQDPERRRRYDEQRAHDRAA  80



>ref|WP_008179949.1| molecular chaperone DnaJ [Moorea producens]
 gb|EGJ34651.1| DnaJ domain protein [Moorea producens 3L]
Length=204

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            S+  S+Y+ LG+   A    I+ AYR+LSK YHPDTT LP ++A+ KF KL E Y  LSN
Sbjct  16   SNPTSYYEILGLHPSASPIAIRRAYRQLSKRYHPDTTDLPTESATIKFQKLNEAYATLSN  75

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  76   PERRAMYDQKIG  87



>gb|AFY90826.1| heat shock protein DnaJ domain protein [Chroococcidiopsis thermalis 
PCC 7203]
Length=184

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 58/113 (51%), Gaps = 14/113 (12%)
 Frame = -2

Query  511  LGDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMK  332
            + D+ S+ +     +HY  LG+   A   EI+ AYR LSK YHPDTT LP   A+ KF +
Sbjct  9    MSDRVSDRMTDQA-THYTLLGLHPSASPIEIRRAYRHLSKLYHPDTTDLPSAIATVKFQQ  67

Query  331  LKEVYEVLSNDEKRRFYDWTLA-------------QEAASKEAEKLRMKFQDP  212
            L E Y  LSN E+R  YD  +              Q AA+++ E+    + DP
Sbjct  68   LNEAYATLSNPERRTNYDLHIGYSRLYVIQPPPDFQRAAARQDERRSSAYLDP  120



>ref|WP_041463569.1| molecular chaperone DnaJ [Chroococcidiopsis thermalis]
Length=176

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 58/113 (51%), Gaps = 14/113 (12%)
 Frame = -2

Query  511  LGDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMK  332
            + D+ S+ +     +HY  LG+   A   EI+ AYR LSK YHPDTT LP   A+ KF +
Sbjct  1    MSDRVSDRMTDQA-THYTLLGLHPSASPIEIRRAYRHLSKLYHPDTTDLPSAIATVKFQQ  59

Query  331  LKEVYEVLSNDEKRRFYDWTLA-------------QEAASKEAEKLRMKFQDP  212
            L E Y  LSN E+R  YD  +              Q AA+++ E+    + DP
Sbjct  60   LNEAYATLSNPERRTNYDLHIGYSRLYVIQPPPDFQRAAARQDERRSSAYLDP  112



>ref|WP_035138981.1| molecular chaperone DnaJ [Fischerella muscicola]
Length=159

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS +++Y  LG+   A   EI+ AYR LSK YHPDTTSLP   A+ KF +L E Y  LSN
Sbjct  4    SSENTYYTLLGLHPSASPIEIRRAYRELSKRYHPDTTSLPTVVATAKFQQLNEAYATLSN  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRLSYDLKIG  75



>ref|WP_015170578.1| heat shock protein DnaJ domain-containing protein [Geitlerinema 
sp. PCC 7407]
 gb|AFY65010.1| heat shock protein DnaJ domain protein [Geitlerinema sp. PCC 
7407]
Length=188

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            +HY  LG+   A V +I+ AYR LSK+YHPDTT LP   A+ KF +L E Y  LSN ++R
Sbjct  15   NHYALLGLHPSASVRDIRQAYRDLSKQYHPDTTLLPPAIATAKFQQLNEAYATLSNPDRR  74

Query  289  RFYD  278
              YD
Sbjct  75   TTYD  78



>ref|WP_006455876.1| molecular chaperone DnaJ [Synechococcus sp. PCC 7335]
 gb|EDX86117.1| DnaJ domain protein [Synechococcus sp. PCC 7335]
Length=150

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY  LG+  +A V+EI+ AYR LSK YHPDTT L    A+ KF  L E Y +LS+ EKR
Sbjct  11   SHYDLLGLRPNASVQEIRRAYRDLSKLYHPDTTELESAIATRKFQALNEAYAILSSPEKR  70

Query  289  RFYDW  275
              YD+
Sbjct  71   LSYDY  75



>ref|WP_013324900.1| molecular chaperone DnaJ [Cyanothece sp. PCC 7822]
 gb|ADN16862.1| heat shock protein DnaJ domain protein [Cyanothece sp. PCC 7822]
Length=180

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            ++HY  LG+   A V EI+ AYR LSK YHPDTT+L  + A  KF +L E Y  LSN E+
Sbjct  23   NTHYAILGLHPSASVIEIRRAYRELSKLYHPDTTALAPEVAKTKFHRLNEAYATLSNPER  82

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  83   RSLYDLKIG  91



>ref|WP_038315502.1| molecular chaperone DnaJ, partial [cyanobacterium PCC 7702]
Length=168

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A   EI+ AYR LSK YHPDTT+LP+  A+ KF +L E Y  LSN
Sbjct  4    SSKPTYYTVLGLHPSASPIEIRRAYRELSKRYHPDTTNLPISVATAKFQQLNEAYATLSN  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRLSYDLKIG  75



>gb|EHA60431.1| heat shock protein DnaJ domain protein [Synechococcus sp. WH 
8016]
Length=184

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -2

Query  493  ELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYE  314
            +L+++ST  HY+ LGVG   D E ++ A+RRLSK  HPDTT+LP   A+ +F  L+E Y+
Sbjct  7    DLMSAST--HYERLGVGRGVDAETLRRAFRRLSKSVHPDTTTLPAAEAARQFQLLREAYD  64

Query  313  VLSNDEKRRFYD  278
             L++   RR YD
Sbjct  65   QLADPSLRRLYD  76



>ref|WP_015117010.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Rivularia sp. PCC 7116]
 gb|AFY53432.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Rivularia sp. PCC 7116]
Length=179

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            S T ++Y  LG+   A   EI+ AYR LSK YHPDTT LP   A+ KF KL E Y  LSN
Sbjct  9    SRTSTYYSLLGLHPAASAIEIRRAYRELSKCYHPDTTDLPTGLATVKFQKLNEAYATLSN  68

Query  301  DEKRRFYDWTLA  266
             +KR  YD  + 
Sbjct  69   PQKRLTYDLKIG  80



>ref|WP_038014590.1| molecular chaperone DnaJ [Synechococcus sp. WH 8016]
Length=176

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S  +HY+ LGVG   D E ++ A+RRLSK  HPDTT+LP   A+ +F  L+E Y+ L++ 
Sbjct  2    SASTHYERLGVGRGVDAETLRRAFRRLSKSVHPDTTTLPAAEAARQFQLLREAYDQLADP  61

Query  298  EKRRFYD  278
              RR YD
Sbjct  62   SLRRLYD  68



>gb|EMS64006.1| hypothetical protein TRIUR3_03738 [Triticum urartu]
Length=162

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  226  KFQDPHMQEVENWESVPDMVDRLGGKNMELSSQAKSALTFDILIILFSVCCIVYAIYFKE  47
            + +DP+  +++N+E VPD VDRLGGKNMELS QA +AL FDI II+FS+CCI+YA++FKE
Sbjct  101  RLEDPYELDLQNYEPVPDTVDRLGGKNMELSDQAMTALAFDIGIIIFSICCIIYALFFKE  160

Query  46   QY  41
            QY
Sbjct  161  QY  162



>gb|EKE97499.1| heat shock protein DnaJ [Tolypothrix sp. PCC 7601]
Length=188

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A V +I+ AYR LSK YHPDTT LP   A+ KF +L E Y  LSN
Sbjct  15   SSEPTYYSLLGLHPSASVIDIRRAYRELSKRYHPDTTDLPATLATAKFQRLNEAYATLSN  74

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  75   PERRLNYDLKIG  86



>ref|WP_011127494.1| molecular chaperone DnaJ [Synechococcus sp. WH 8102]
 emb|CAE07142.1| DnaJ-like protein [Synechococcus sp. WH 8102]
Length=179

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY+ LGV   A    ++ A+RR SK  HPDTT+LP+  A++ F +LKE YE L++ E+R
Sbjct  14   SHYERLGVSTQASQASLRQAFRRRSKALHPDTTTLPVAEAAKNFQQLKESYEFLADPERR  73

Query  289  RFYDWTLAQ  263
            R YD  L Q
Sbjct  74   RHYDEQLRQ  82



>gb|EHC12180.1| heat shock protein DnaJ domain protein [Fischerella sp. JSC-11]
Length=170

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS +++Y  LG+   A   EI+ AYR LSK YHPDTTSLP   A+ KF ++ E Y  LSN
Sbjct  15   SSENTYYTLLGLHPSASPIEIRRAYRELSKRYHPDTTSLPTVVATAKFQQINEAYATLSN  74

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  75   PERRLSYDLKIG  86



>ref|WP_011430869.1| molecular chaperone DnaJ [Synechococcus sp. JA-3-3Ab]
 gb|ABD00195.1| DnaJ family protein [Synechococcus sp. JA-3-3Ab]
Length=310

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 61/116 (53%), Gaps = 16/116 (14%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            S    +YQ LGV  DA +EEIK AYR+L+++YHPD      KAA E+F ++ E YEVLS+
Sbjct  4    SDFKDYYQILGVSRDASLEEIKRAYRKLARQYHPDVNP-GNKAAEERFKQINEAYEVLSD  62

Query  301  DEKRRFYD-----WTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGK  149
             +KRR YD     W      A+            P M+    + S  D ++ L G+
Sbjct  63   PDKRRRYDQFGQYWQRVGSGAAA----------GPGMEGFAQYASFEDFINELLGR  108



>ref|WP_045874023.1| molecular chaperone DnaJ [Tolypothrix sp. PCC 7601]
Length=177

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A V +I+ AYR LSK YHPDTT LP   A+ KF +L E Y  LSN
Sbjct  4    SSEPTYYSLLGLHPSASVIDIRRAYRELSKRYHPDTTDLPATLATAKFQRLNEAYATLSN  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRLNYDLKIG  75



>ref|WP_011933941.1| molecular chaperone DnaJ [Synechococcus sp. WH 7803]
 emb|CAK24476.1| DnaJ-class molecular chaperone [Synechococcus sp. WH 7803]
Length=176

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY+ LGV   AD E ++ A+RRLSK  HPDTT LP + A+ +F  L+E YE L++   R
Sbjct  9    SHYERLGVPKGADSEMLRQAFRRLSKAVHPDTTRLPAQDAARQFRLLREAYEQLADPRLR  68

Query  289  RFYDWTLAQEAASKEA  242
            R YD  L +  A+  A
Sbjct  69   RLYDAALEERKATPVA  84



>ref|WP_033334744.1| molecular chaperone DnaJ, partial [Scytonema hofmanni]
Length=145

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A   EI+ AYR LSK YHPDTTSLP   A+ KF +L E Y  LSN
Sbjct  4    SSKPTYYSLLGLHPSASAIEIRRAYRELSKCYHPDTTSLPAALATAKFQQLNEAYATLSN  63

Query  301  DEKRRFYD  278
             E+R  YD
Sbjct  64   PERRFSYD  71



>ref|WP_016870909.1| MULTISPECIES: molecular chaperone DnaJ [Fischerella]
Length=159

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS +++Y  LG+   A   EI+ AYR LSK YHPDTTSLP   A+ KF ++ E Y  LSN
Sbjct  4    SSENTYYTLLGLHPSASPIEIRRAYRELSKRYHPDTTSLPTVVATAKFQQINEAYATLSN  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRLSYDLKIG  75



>ref|WP_041391617.1| hypothetical protein, partial [Prochlorococcus marinus]
Length=146

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            +S+ S+Y+ LG+   AD   ++ A+ RLSK+ HPDTT+LP+  A+++F +L E YE+LS+
Sbjct  2    TSSGSYYELLGISRSADAYALRKAFHRLSKDLHPDTTALPVDEAAQRFRELCEAYELLSD  61

Query  301  DEKRRFYDWTLAQE  260
              +R  YD TL  E
Sbjct  62   PLRREAYDKTLDNE  75



>dbj|BAQ63658.1| DnaJ-class molecular chaperone CbpA [Geminocystis sp. NIES-3709]
Length=155

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            T++HY  L +   A   +I+ AYR LSK YHPDTT+LPL+ A +KF +L E Y  L+N E
Sbjct  17   TNTHYGLLNLHPSASPIDIRRAYRELSKLYHPDTTNLPLEEAKQKFQRLNEAYGTLANPE  76

Query  295  KRRFYD  278
            +R  YD
Sbjct  77   RRSLYD  82



>ref|WP_037218347.1| molecular chaperone DnaJ [Richelia intracellularis]
Length=163

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -2

Query  484  NSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLS  305
            +SS  +HY  LG+   A V EI+ AYR LSK YHPDTT L    A+ KF +L E Y  LS
Sbjct  3    HSSKPTHYTLLGLHPSASVIEIRRAYRELSKRYHPDTTDLSASDATAKFQQLNEAYATLS  62

Query  304  NDEKRRFYDWTLA  266
            N E+R  YD  + 
Sbjct  63   NPERRFTYDLKIG  75



>ref|WP_037990838.1| hypothetical protein [Synechococcus sp. CC9616]
Length=176

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            HY+ LGV + AD E ++ A+RR SK+ HPDTT+LP   A+ +F  L++ YE+L + E+RR
Sbjct  9    HYERLGVVSTADAEALRQAFRRRSKDLHPDTTALPPDQAASEFQMLRQSYELLQDPERRR  68

Query  286  FYDWTLAQEAASK  248
             YD    + AAS+
Sbjct  69   RYDEQRLRAAASR  81



>emb|CDN11993.1| DnaJ protein [Richelia intracellularis]
Length=169

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -2

Query  484  NSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLS  305
            +SS  +HY  LG+   A V EI+ AYR LSK YHPDTT L    A+ KF +L E Y  LS
Sbjct  9    HSSKPTHYTLLGLHPSASVIEIRRAYRELSKRYHPDTTDLSASDATAKFQQLNEAYATLS  68

Query  304  NDEKRRFYDWTLA  266
            N E+R  YD  + 
Sbjct  69   NPERRFTYDLKIG  81



>ref|WP_039713552.1| molecular chaperone DnaJ [Scytonema millei]
 gb|KIF22222.1| molecular chaperone DnaJ [Scytonema millei VB511283]
Length=171

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 14/113 (12%)
 Frame = -2

Query  511  LGDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMK  332
            + D+ S+ +     +HY  LG+   A   EI+ AYR LSK YHPDTT LP   A+ KF +
Sbjct  1    MSDRVSDRMTDQA-THYTLLGLHPSASPIEIRRAYRHLSKLYHPDTTDLPSAIATVKFQQ  59

Query  331  LKEVYEVLSNDEKRRFYDWTLA-------------QEAASKEAEKLRMKFQDP  212
            L E Y  LSN E+R  YD  +              Q AAS++  +    + DP
Sbjct  60   LNEAYATLSNPERRTNYDMHIGYSRLYVIQPPPDFQRAASRQDGRRSSAYLDP  112



>ref|WP_035050582.1| molecular chaperone DnaJ [Anoxybacillus sp. KU2-6(11)]
 gb|KFZ41820.1| molecular chaperone DnaJ [Anoxybacillus sp. KU2-6(11)]
Length=373

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRGYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>gb|KGG15804.1| DnaJ-class molecular chaperone [Prochlorococcus sp. MIT 0603]
Length=144

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            T S+Y+ LGV   AD+  IK A+  LSK  HPD T LP+  ASE+F ++ E YE+LS+  
Sbjct  2    TRSYYKILGVPHSADLHSIKKAFHGLSKVLHPDITLLPVDEASEQFREVCEAYEILSDPI  61

Query  295  KRRFYDWTLAQEAASKEA  242
            +R+ YD TL     + E 
Sbjct  62   RRKLYDHTLKDSTLTNEV  79



>ref|WP_043121112.1| molecular chaperone DnaJ, partial [Sinomonas sp. MUSC 117]
 gb|KHL04135.1| molecular chaperone DnaJ, partial [Sinomonas sp. MUSC 117]
Length=240

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY+ LGV  DA  EEIK AYR+L++++HPD    P   ASE+F  +   YEVLS+ +KR
Sbjct  3    SHYETLGVSPDASGEEIKKAYRKLARKFHPDVN--PGDEASERFKAVTHAYEVLSDPDKR  60

Query  289  RFYDWT  272
            R YD T
Sbjct  61   RVYDAT  66



>ref|WP_036919193.1| MULTISPECIES: hypothetical protein [Prochlorococcus]
Length=146

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            T S+Y+ LGV   AD+  IK A+  LSK  HPD T LP+  ASE+F ++ E YE+LS+  
Sbjct  4    TRSYYKILGVPHSADLHSIKKAFHGLSKVLHPDITLLPVDEASEQFREVCEAYEILSDPI  63

Query  295  KRRFYDWTLAQEAASKEA  242
            +R+ YD TL     + E 
Sbjct  64   RRKLYDHTLKDSTLTNEV  81



>ref|WP_006509069.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Xenococcus sp. PCC 7305]
 gb|ELS03830.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Xenococcus sp. PCC 7305]
Length=153

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = -2

Query  550  TQEQQLKADENELLGDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTT  371
            TQ++  +A +N      F        +++Y  LG+   A V EI+  YR+LSK+YHPDTT
Sbjct  2    TQQRTTRATKNITDASHF-------VNTYYSILGLHPAASVIEIRRTYRKLSKKYHPDTT  54

Query  370  SLPLKAASEKFMKLKEVYEVLSNDEKRRFYDWTLA  266
              PL  A  KF ++ E Y  LSN E+R  YD  + 
Sbjct  55   EQPLAVAEAKFRQINEAYATLSNPERRSLYDMKIG  89



>emb|CDI80665.1| DnaJ domain-containing protein, putative [Eimeria acervulina]
Length=154

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            T  +Y  LGV   A  EEI+ AYRRL+ ++HPD      + A+EKF  + E YEVLSN+E
Sbjct  5    TADYYAVLGVSKGATNEEIRRAYRRLAIQWHPDKNRDRQQEATEKFKAISEAYEVLSNEE  64

Query  295  KRRFYDWTLAQ  263
            KRR YD + +Q
Sbjct  65   KRRLYDVSCSQ  75



>ref|WP_015145499.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Pleurocapsa minor]
 gb|AFY79201.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Pleurocapsa sp. PCC 7327]
Length=164

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 4/79 (5%)
 Frame = -2

Query  502  KFSEL-LNSST---DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFM  335
            +F+EL + +ST   +S+Y  LG+   A   EI+ AYR +SK YHPDTT L L+ A  KF 
Sbjct  9    QFTELQIPASTRLANSYYAILGLHPSASAIEIRRAYREMSKRYHPDTTKLSLEVAKAKFQ  68

Query  334  KLKEVYEVLSNDEKRRFYD  278
            +L E Y  LSN E+R  YD
Sbjct  69   QLNEAYATLSNPERRSLYD  87



>emb|CDJ62703.1| DnaJ domain-containing protein, putative [Eimeria necatrix]
Length=183

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            +   T  +Y  LGV   A  EEI+ AYR+L+ ++HPD      + A+E+F  + E YEVL
Sbjct  1    MEVHTSDYYAILGVSRGASSEEIRKAYRKLAIKWHPDKNRERQQEATERFKAISEAYEVL  60

Query  307  SNDEKRRFYDWTLAQ  263
            SNDEKRR YD + +Q
Sbjct  61   SNDEKRRLYDISFSQ  75



>gb|ABX09525.1| DnaJ-like protein [Prochlorococcus marinus str. MIT 9211]
Length=190

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            +S+ S+Y+ LG+   AD   ++ A+ RLSK+ HPDTT+LP+  A+++F +L E YE+LS+
Sbjct  2    TSSGSYYELLGISRSADAYALRKAFHRLSKDLHPDTTALPVDEAAQRFRELCEAYELLSD  61

Query  301  DEKRRFYDWTLAQE  260
              +R  YD TL  E
Sbjct  62   PLRREAYDKTLDNE  75



>ref|WP_032100499.1| molecular chaperone DnaJ [Anoxybacillus flavithermus]
Length=373

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_003393893.1| chaperone protein DnaJ [Anoxybacillus flavithermus]
 gb|EMT47096.1| chaperone protein DnaJ [Anoxybacillus flavithermus AK1]
Length=373

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_035019456.1| MULTISPECIES: molecular chaperone DnaJ [Anoxybacillus]
 gb|KIQ94771.1| Chaperone protein DnaJ [Anoxybacillus thermarum]
Length=373

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_004889456.1| molecular chaperone DnaJ [Anoxybacillus flavithermus]
 gb|ELK22520.1| molecular chaperone DnaJ [Anoxybacillus flavithermus TNO-09.006]
Length=373

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>dbj|GAC89597.1| molecular chaperone DnaJ [Anoxybacillus flavithermus NBRC 109594]
Length=375

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  4    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  61

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  62   QKRAHYD  68



>ref|WP_041638102.1| molecular chaperone DnaJ [Anoxybacillus flavithermus]
Length=373

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>gb|ACJ33214.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Anoxybacillus flavithermus WK1]
Length=375

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  4    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  61

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  62   QKRAHYD  68



>emb|CDJ40420.1| DnaJ domain-containing protein, putative [Eimeria tenella]
Length=230

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            T  +Y  LGV   A  EEI+ AYR+L+ ++HPD      + A+E+F  + E YEVLSNDE
Sbjct  5    TSDYYAILGVSRGASSEEIRKAYRKLAIKWHPDKNRERQQEATERFKAISEAYEVLSNDE  64

Query  295  KRRFYDWTLAQ  263
            KRR YD + +Q
Sbjct  65   KRRLYDISFSQ  75



>ref|WP_009374033.1| MULTISPECIES: chaperone protein DnaJ [Anoxybacillus]
 gb|EMI09923.1| chaperone protein DnaJ [Anoxybacillus sp. DT3-1]
 gb|KGP59930.1| molecular chaperone DnaJ [Anoxybacillus gonensis]
Length=373

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_009633604.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Synechocystis sp. PCC 7509]
Length=189

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            S+Y  LG+   A V EI+ AYR LSK YHPDTT L  + A+ KF +L + Y  LSN E+R
Sbjct  12   SYYSLLGLHPSASVIEIRRAYRELSKHYHPDTTKLSTEIATSKFQELNQAYATLSNIERR  71

Query  289  RFYDWTLA  266
              YD+ + 
Sbjct  72   IAYDYVIG  79



>ref|WP_021095117.1| MULTISPECIES: chaperone protein DnaJ [Anoxybacillus]
 gb|EPZ38228.1| chaperone protein DnaJ [Anoxybacillus sp. SK3-4]
 gb|KIP22129.1| Chaperone protein DnaJ [Anoxybacillus ayderensis]
Length=373

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKEEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_035139973.1| molecular chaperone DnaJ [Fischerella sp. PCC 9605]
Length=166

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A   EI+ AYR LSK YHPDTT LP   A+ KF +L E Y  LSN
Sbjct  4    SSEPTYYTLLGLHPSASAIEIRRAYRELSKRYHPDTTDLPTVIATAKFQQLNEAYATLSN  63

Query  301  DEKRRFYD  278
             E+R  YD
Sbjct  64   PERRLSYD  71



>ref|WP_010315267.1| molecular chaperone DnaJ [Synechococcus sp. CB0205]
Length=170

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            +HY+ L V ++A  +E++ A+R LSK YHPDTT LP   A E F +L++ Y  LS+ E+R
Sbjct  5    NHYELLEVPSEASSQELRQAFRSLSKRYHPDTTDLPEAEAREAFRRLQQAYLTLSDPERR  64

Query  289  RFYDWTL  269
            R YD TL
Sbjct  65   RSYDATL  71



>ref|WP_008230610.1| Heat shock protein DnaJ-like [Richelia intracellularis]
 emb|CCH65960.1| Heat shock protein DnaJ-like [Richelia intracellularis HM01]
Length=156

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            +++S  ++Y  LG+   A + EI+ AYRRLSK YHPDTT LP+  A+ KF  L E Y  L
Sbjct  1    MHTSKPTYYNLLGLEPSASMLEIRCAYRRLSKCYHPDTTVLPMSDATVKFQHLNEAYTTL  60

Query  307  SNDEKRRFYDWTLA  266
             N E+R  YD  + 
Sbjct  61   INLEERYAYDLQIG  74



>ref|WP_004438009.1| molecular chaperone DnaJ [Bacillus methanolicus]
 gb|EIJ78930.1| chaperone protein DnaJ [Bacillus methanolicus PB1]
Length=378

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  DA  +EIK AYR+LSK+YHPD    P   A EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKDASKDEIKKAYRKLSKKYHPDINKEP--GADEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRTQYD  66



>ref|WP_012964519.1| chaperone protein DnaJ [Hydrogenobacter thermophilus]
 sp|Q75VW3.1|DNAJ_HYDTT RecName: Full=Chaperone protein DnaJ [Hydrogenobacter thermophilus 
TK-6]
 dbj|BAD17849.1| putative chaperone DnaJ [Hydrogenobacter thermophilus]
 dbj|BAI70339.1| chaperone protein [Hydrogenobacter thermophilus TK-6]
 gb|ADO46257.1| chaperone protein DnaJ [Hydrogenobacter thermophilus TK-6]
Length=356

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +YQ LGV  DA  EEIK AYRRL+KEYHPD ++   + ASEKF ++ E Y +LS++E+R+
Sbjct  6    YYQILGVSKDATAEEIKKAYRRLAKEYHPDISA--DENASEKFKEINEAYHILSDEERRK  63

Query  286  FYDWTL  269
             YD  L
Sbjct  64   EYDRIL  69



>ref|WP_015136504.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Nostoc sp. PCC 7524]
 gb|AFY46034.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Nostoc sp. PCC 7524]
Length=167

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A V +I+ AYR LSK YHPDTT LP   A+ KF ++ E Y  LSN
Sbjct  4    SSEPNYYSLLGLHPSASVIDIRRAYRELSKRYHPDTTELPAVVATPKFQRINEAYATLSN  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRLNYDIKIG  75



>ref|WP_044077446.1| hypothetical protein [Prochlorothrix hollandica]
Length=175

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y  L +   A + EI+ AYR LSK+YHPDTT+L  + A  KF +++E Y  L N ++R
Sbjct  10   NYYDLLAISPYATLPEIRQAYRELSKQYHPDTTTLAPEVAISKFQQIQEAYATLVNPDQR  69

Query  289  RFYDWTLAQEA  257
            RFYD   A EA
Sbjct  70   RFYDLYRAYEA  80



>ref|XP_001024093.1| DnaJ domain containing protein [Tetrahymena thermophila]
Length=970

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            S+Y+ L +G DA  EEIK AYR+ + EYHPD T   +  A EKF +L E Y+VLSND++R
Sbjct  2    SYYEILNIGQDAKEEEIKKAYRQKALEYHPDKTQYDIYEAREKFRELDEAYKVLSNDDRR  61

Query  289  RFYD  278
              YD
Sbjct  62   ALYD  65



>ref|WP_036800102.1| heat shock protein [Pleurocapsa sp. PCC 7319]
Length=142

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +++Y  +G+   A    I+  YR+LSK+YHPDTTSLP   A+ KF ++ E Y VLS+ EK
Sbjct  11   NTYYDLMGLHPSASTITIRRTYRQLSKKYHPDTTSLPPNIATAKFQRINEAYAVLSSPEK  70

Query  292  RRFYD  278
            R  YD
Sbjct  71   RSLYD  75



>gb|EAS03848.2| DnaJ domain protein [Tetrahymena thermophila SB210]
Length=952

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            S+Y+ L +G DA  EEIK AYR+ + EYHPD T   +  A EKF +L E Y+VLSND++R
Sbjct  2    SYYEILNIGQDAKEEEIKKAYRQKALEYHPDKTQYDIYEAREKFRELDEAYKVLSNDDRR  61

Query  289  RFYD  278
              YD
Sbjct  62   ALYD  65



>ref|WP_031408168.1| molecular chaperone DnaJ [Geobacillus vulcani]
Length=381

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDVNKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_044730790.1| molecular chaperone DnaJ [Geobacillus kaustophilus]
 gb|KJE27962.1| chaperone protein DnaJ [Geobacillus kaustophilus]
Length=382

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDVNKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_011231982.1| MULTISPECIES: chaperone protein DnaJ [Geobacillus]
 sp|Q5KWZ8.1|DNAJ_GEOKA RecName: Full=Chaperone protein DnaJ [Geobacillus kaustophilus 
HTA426]
 dbj|BAD76788.1| chaperone protein (heat shock protein) [Geobacillus kaustophilus 
HTA426]
 gb|AEV20124.1| hypothetical protein GTCCBUS3UF5_28210 [Geobacillus thermoleovorans 
CCB_US3_UF5]
 dbj|GAD12570.1| molecular chaperone DnaJ [Geobacillus kaustophilus GBlys]
 gb|EQB94991.1| molecular chaperone DnaJ [Geobacillus sp. A8]
 gb|ESU70527.1| molecular chaperone DnaJ [Geobacillus sp. MAS1]
 dbj|GAJ58127.1| chaperone protein heat shock protein [Geobacillus thermoleovorans 
B23]
 gb|KDE47700.1| molecular chaperone DnaJ [Geobacillus sp. CAMR5420]
Length=382

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDVNKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_041650752.1| hypothetical protein, partial [Marivirga tractuosa]
Length=87

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +++YQ LG+   A + EIK AY++L+K YHPD    P  AA EKF  +   Y +LSN++ 
Sbjct  2    ENYYQILGLSEMATLSEIKVAYKKLAKAYHPDIN--PTSAAEEKFKSISTAYTILSNNDL  59

Query  292  RRFYDWTLAQ  263
            RR YD  LAQ
Sbjct  60   RRQYDVKLAQ  69



>ref|WP_013524167.1| MULTISPECIES: chaperone protein DnaJ [Geobacillus]
 gb|ACX77679.1| chaperone protein DnaJ [Geobacillus sp. Y412MC61]
 gb|ADU94918.1| chaperone protein DnaJ [Geobacillus sp. Y412MC52]
 gb|AGE23089.1| heat shock protein [Geobacillus sp. GHH01]
Length=382

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDVNKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_020753793.1| Chaperone protein dnaJ [Geobacillus sp. WSUCF1]
 gb|EPR30073.1| Chaperone protein dnaJ [Geobacillus sp. WSUCF1]
Length=382

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDVNKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_013144702.1| molecular chaperone DnaJ [Geobacillus sp. C56-T3]
 gb|ADI26029.1| chaperone protein DnaJ [Geobacillus sp. C56-T3]
Length=382

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDVNKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_011133102.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 emb|CAE19933.1| DnaJ-like protein [Prochlorococcus marinus subsp. pastoris str. 
CCMP1986]
 gb|KGF86725.1| DnaJ-like protein [Prochlorococcus marinus str. EQPAC1]
Length=148

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y+ LGV  +A   E++ A+ +LS E HPDTTSL L+ A  KF K+ E YE L+N   R
Sbjct  6    TYYKILGVNENASNNELRKAFCKLSIELHPDTTSLELEDAKNKFQKVLEAYENLNNSNLR  65

Query  289  RFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPD  173
            + YD  L  +  SK+  K  +   +P + +  N + V +
Sbjct  66   KIYDEKL--QVNSKKPNKTNLNVLNPLVMDANNQQLVGN  102



>ref|WP_025948898.1| molecular chaperone DnaJ [Geobacillus thermocatenulatus]
Length=381

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDVNKAP--DAAEKFKEIKEAYEVLSHDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_039896035.1| hypothetical protein [Lyngbya sp. PCC 8106]
Length=182

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            D+HY  LG+   A   EI+ AYR LSK YHPDTT L    A+ KF  L E Y  LSN E+
Sbjct  23   DTHYGLLGLHPSASSIEIRRAYRELSKRYHPDTTELSKTVATAKFQHLNEAYATLSNPER  82

Query  292  RRFYDWTL  269
            R+ YD  +
Sbjct  83   RQAYDLKI  90



>ref|WP_039740338.1| molecular chaperone DnaJ [Hassallia byssoidea]
 gb|KIF37308.1| molecular chaperone DnaJ [Hassallia byssoidea VB512170]
Length=172

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            +D++Y  LG+   A V EI+ AYR LSK +HPDTT LP   A+ KF +L E Y  LS+ E
Sbjct  5    SDTYYSLLGLHPSASVIEIRHAYRELSKRFHPDTTELPAAIATAKFQQLNEAYATLSSPE  64

Query  295  KRRFYDWTLA  266
            +R  YD  + 
Sbjct  65   RRLSYDLKIG  74



>sp|Q45552.1|DNAJ_GEOSE RecName: Full=Chaperone protein DnaJ [Geobacillus stearothermophilus]
 emb|CAA62240.1| dnaJ [Geobacillus stearothermophilus]
Length=380

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  6    YYEILGVSKNATKEEIKKAYRKLSKKYHPDVNKEP--DAAEKFKEIKEAYEVLSDDQKRA  63

Query  286  FYD  278
             YD
Sbjct  64   HYD  66



>gb|EAW37085.1| DnaJ protein [Lyngbya sp. PCC 8106]
Length=202

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            D+HY  LG+   A   EI+ AYR LSK YHPDTT L    A+ KF  L E Y  LSN E+
Sbjct  43   DTHYGLLGLHPSASSIEIRRAYRELSKRYHPDTTELSKTVATAKFQHLNEAYATLSNPER  102

Query  292  RRFYDWTL  269
            R+ YD  +
Sbjct  103  RQAYDLKI  110



>gb|EGK88795.1| heat shock protein DnaJ domain protein [Microcoleus vaginatus 
FGP-2]
Length=159

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
             +HY  LG+   A   EI+ +YR LSK YHPDTT LP   A+ KF +L   Y  LSN E+
Sbjct  23   STHYSLLGLHPSASAIEIRRSYRELSKLYHPDTTDLPPAVATAKFQQLNNAYATLSNPER  82

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  83   RLAYDLKIG  91



>dbj|BAN02560.1| hypothetical protein YM304_22460 [Ilumatobacter coccineus YM16-304]
Length=216

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            ++ +HY  LGVG +A +E ++ AYRRL++EYHPD T +   A S+K   + E Y VLS+ 
Sbjct  3    TSRNHYAVLGVGQEASIETVREAYRRLAREYHPDRT-MGSAAGSDKMPAINEAYRVLSDP  61

Query  298  EKRRFYDWTLAQEAASKEA  242
             +R  YD +L    AS  A
Sbjct  62   ARRAVYDASLRSGTASPSA  80



>ref|WP_033018918.1| MULTISPECIES: molecular chaperone DnaJ [Geobacillus]
 gb|KFX34867.1| molecular chaperone DnaJ [Geobacillus sp. G1w1]
Length=387

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEILGVSKNATKDEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_006043269.1| molecular chaperone DnaJ [Synechococcus sp. WH 7805]
 gb|EAR19714.1| Heat shock protein DnaJ-like [Synechococcus sp. WH 7805]
Length=176

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY+ LGV   AD E ++ A+RR SK  HPDTT LP + A+ +F  L+E YE L++   R
Sbjct  9    SHYERLGVPKGADSEMLRQAFRRRSKAVHPDTTRLPAQDAARQFRLLREAYEQLADPRLR  68

Query  289  RFYDWTLAQEAASKEA  242
            R YD  L +  AS  A
Sbjct  69   RLYDAALEERNASPVA  84



>ref|WP_044822224.1| molecular chaperone DnaJ, partial [Bacillus thuringiensis]
Length=123

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGVG  A  +EIK AYR+LSK+YHPD        A+EKF ++KE YE LS+D
Sbjct  2    SKRDYYEVLGVGKSASKDEIKKAYRKLSKKYHPDINKEA--GAAEKFKEVKEAYETLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_015176362.1| heat shock protein DnaJ domain protein [Oscillatoria nigro-viridis]
 gb|AFZ07073.1| heat shock protein DnaJ domain protein [Oscillatoria nigro-viridis 
PCC 7112]
Length=159

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
             S+Y  LG+   A   EI+ +YR LSK YHPDTT LP   A+ KF +L   Y  LSN E+
Sbjct  23   SSYYGLLGLHPSASPIEIRRSYRELSKLYHPDTTELPPAVATAKFQQLNNAYATLSNPER  82

Query  292  RRFYDWTLA  266
            R  YD T+ 
Sbjct  83   RLAYDLTIG  91



>ref|WP_033014701.1| molecular chaperone DnaJ [Geobacillus stearothermophilus]
Length=382

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEVLGVSKNATKDEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_043905524.1| molecular chaperone DnaJ [Geobacillus stearothermophilus]
 gb|EZP76205.1| chaperone protein DnaJ [Geobacillus stearothermophilus NUB3621]
Length=380

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  6    YYEILGVSKNATKEEIKKAYRKLSKKYHPDVNKEP--DAAEKFKEIKEAYEVLSDDQKRA  63

Query  286  FYD  278
             YD
Sbjct  64   HYD  66



>gb|EKQ70905.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Oscillatoriales cyanobacterium JSC-12]
Length=266

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            S+Y+ LG+   A   EI+ AYR LSK YHPDTT LP   A+ +F KL E Y  LS+ E+R
Sbjct  23   SYYELLGLHPSASAREIRQAYRDLSKLYHPDTTKLPTAIATTQFQKLNEAYATLSSPERR  82

Query  289  RFYD  278
              YD
Sbjct  83   SRYD  86



>ref|WP_018716616.1| hypothetical protein [Arhodomonas aquaeolei]
Length=315

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGVG DAD +EIK AYR+L+++YHPD +S P   A ++F ++ E YEVL + EKRR
Sbjct  6    YYRILGVGRDADADEIKRAYRKLARKYHPDVSSEP--DAEQRFKEVAEAYEVLRDPEKRR  63

Query  286  FYD  278
             YD
Sbjct  64   AYD  66



>ref|WP_033375419.1| molecular chaperone DnaJ [Spirulina subsalsa]
Length=167

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y +LGV   A   EI+ AYR LSK+YHPDTT LP   A++KF +L E Y  LS+ E+R
Sbjct  11   TYYGWLGVDPCASPVEIRRAYRELSKQYHPDTTELPGDVATQKFQQLNEAYATLSSPERR  70

Query  289  RFYD  278
              YD
Sbjct  71   MLYD  74



>ref|XP_012073151.1| PREDICTED: chaperone protein dnaJ 1, mitochondrial isoform X1 
[Jatropha curcas]
 gb|KDP37064.1| hypothetical protein JCGZ_06120 [Jatropha curcas]
Length=503

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = -2

Query  505  DKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLK  326
            ++F   +++S D +Y  LGV   A+++EIK AYRRL+++YHPD    P   A+EKF ++ 
Sbjct  74   NRFRPFVSASGD-YYATLGVSKAANIKEIKAAYRRLARQYHPDVNKEP--GATEKFKEIS  130

Query  325  EVYEVLSNDEKRRFYD  278
              YEVLS+D+KR  YD
Sbjct  131  AAYEVLSDDKKRALYD  146



>ref|XP_012073153.1| PREDICTED: dnaJ homolog subfamily A member 2 isoform X3 [Jatropha 
curcas]
Length=457

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = -2

Query  505  DKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLK  326
            ++F   +++S D +Y  LGV   A+++EIK AYRRL+++YHPD    P   A+EKF ++ 
Sbjct  74   NRFRPFVSASGD-YYATLGVSKAANIKEIKAAYRRLARQYHPDVNKEP--GATEKFKEIS  130

Query  325  EVYEVLSNDEKRRFYD  278
              YEVLS+D+KR  YD
Sbjct  131  AAYEVLSDDKKRALYD  146



>gb|EKD11307.1| Heat shock protein DnaJ domain protein [Arthrospira platensis 
C1]
Length=158

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y  LG+   A   EI+ AYR LSK YHPDTT L    A  KF +L E Y +LSN ++R
Sbjct  19   TYYTLLGLHPSASSMEIRRAYRELSKRYHPDTTDLSEDCAKAKFQELNEAYSILSNPDRR  78

Query  289  RFYDWTLA  266
            + YD T++
Sbjct  79   QIYDQTIS  86



>ref|WP_004163460.1| molecular chaperone DnaJ [Microcystis aeruginosa]
 dbj|BAG00828.1| DnaJ-like protein [Microcystis aeruginosa NIES-843]
 emb|CCI29306.1| DnaJ-like protein [Microcystis aeruginosa PCC 9809]
Length=164

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            D++Y  LG+   A V E++ AYR LSK YHPDTT L  + A+ KF +L E Y  LSN ++
Sbjct  23   DTYYAILGLHPSASVIEVRRAYRELSKRYHPDTTELSPEVATVKFQRLNEAYATLSNPDR  82

Query  292  RRFYD  278
            R  YD
Sbjct  83   RSLYD  87



>ref|WP_008879918.1| MULTISPECIES: chaperone protein DnaJ [Geobacillus]
 sp|A4IR30.1|DNAJ_GEOTN RecName: Full=Chaperone protein DnaJ [Geobacillus thermodenitrificans 
NG80-2]
 gb|ABO67784.1| Heat-shock protein DnaJ [Geobacillus thermodenitrificans NG80-2]
 gb|EDY06605.1| chaperone protein DnaJ [Geobacillus sp. G11MC16]
Length=381

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEVLGVSKNATKDEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_044743135.1| molecular chaperone DnaJ [Anoxybacillus sp. ATCC BAA-2555]
Length=382

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEVLGVSKNATKDEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_033009633.1| molecular chaperone DnaJ [Geobacillus stearothermophilus]
 gb|KFL16396.1| molecular chaperone DnaJ [Geobacillus stearothermophilus]
 gb|KFX36128.1| molecular chaperone DnaJ [Geobacillus stearothermophilus]
Length=382

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEVLGVSKNATKDEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_017318707.1| molecular chaperone DnaJ [Mastigocladopsis repens]
Length=173

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A   EI+ AYR LSK YHPDTT LP   A+ KF +L E Y  LS+
Sbjct  4    SSEPTYYSLLGLHPSASAIEIRRAYRELSKHYHPDTTKLPTPVATAKFQQLNEAYATLSS  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRFSYDLKIG  75



>ref|WP_017435624.1| molecular chaperone DnaJ [Geobacillus caldoxylosilyticus]
 dbj|GAJ38123.1| chaperone protein DnaJ [Geobacillus caldoxylosilyticus NBRC 107762]
Length=380

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  6    YYEILGVSKNATKEEIKKAYRKLSKKYHPDVNKEP--DAAEKFKEIKEAYEVLSDDQKRA  63

Query  286  FYD  278
             YD
Sbjct  64   HYD  66



>ref|WP_039886992.1| heat shock protein [Microcoleus vaginatus]
Length=145

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
             +HY  LG+   A   EI+ +YR LSK YHPDTT LP   A+ KF +L   Y  LSN E+
Sbjct  9    STHYSLLGLHPSASAIEIRRSYRELSKLYHPDTTDLPPAVATAKFQQLNNAYATLSNPER  68

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  69   RLAYDLKIG  77



>ref|WP_029638490.1| molecular chaperone DnaJ [[Scytonema hofmanni] UTEX B 1581]
Length=173

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            +D++Y  LG+   A V EI+ AYR LSK +HPDTT LP   A+ KF +L E Y  LS+ E
Sbjct  5    SDTYYSLLGLHPSASVIEIRHAYRELSKCFHPDTTDLPTAIATAKFQQLNEAYATLSSPE  64

Query  295  KRRFYDWTLA  266
            +R  YD  + 
Sbjct  65   RRLSYDLKIG  74



>gb|ADP73874.1| chaperone protein DnaJ [Geobacillus sp. Y4.1MC1]
 dbj|GAJ42396.1| chaperone protein DnaJ [Geobacillus thermoglucosidasius NBRC 
107763]
Length=382

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  8    YYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEP--DAAEKFKEIKEAYEVLSDDQKRA  65

Query  286  FYD  278
             YD
Sbjct  66   HYD  68



>ref|XP_004235949.1| PREDICTED: dnaJ homolog 1, mitochondrial [Solanum lycopersicum]
Length=498

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = -2

Query  508  GDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKL  329
            G +F  L+ ++   +Y  LGV   A+ ++IK AYRRL+++YHPD    P   A EKF ++
Sbjct  63   GRRFGRLVVAAAADYYSTLGVPKSANSKDIKAAYRRLARQYHPDVNKEP--NAPEKFKEI  120

Query  328  KEVYEVLSNDEKRRFYD  278
            K+ YE+LS+D+KR  YD
Sbjct  121  KDAYEILSDDKKRALYD  137



>emb|CEA08179.1| Chaperone protein DnaJ [Arthrobacter sp. 11W110_air]
Length=377

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            HYQ LGV  DA  EEIK AYR+L+++ HPD  + P   A+++F  +   YEVLS+ EKRR
Sbjct  4    HYQVLGVSRDATGEEIKKAYRKLARKLHPDVNTAP--GAADEFKAVTHAYEVLSDPEKRR  61

Query  286  FYDWT  272
             YD T
Sbjct  62   IYDTT  66



>ref|WP_024566441.1| conjugal transfer protein TraG [Elizabethkingia anophelis]
 gb|AIL45325.1| Conjugative transposon protein TraG [Elizabethkingia anophelis 
NUHP1]
Length=1028

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 2/85 (2%)
 Frame = -2

Query  523  ENELLGDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASE  344
            E ++L D   E+  S   S+Y  LG+  DAD +E+K A+R+L+ EYHPD         SE
Sbjct  567  EEDILADYEEEM--SDRHSYYDVLGIAFDADSDEVKEAFRKLAIEYHPDKNVNNPDYDSE  624

Query  343  KFMKLKEVYEVLSNDEKRRFYDWTL  269
            KF K+ E YE+LS++EKRR Y+ TL
Sbjct  625  KFYKVYEAYEILSSEEKRRAYNETL  649



>ref|WP_025726661.1| molecular chaperone DnaJ [Bacillus ginsengihumi]
Length=376

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVEKNATKEEIKKAYRKLSKKYHPDINKAP--DAAEKFKEVKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>ref|WP_020153962.1| molecular chaperone DnaJ [Caldibacillus debilis]
Length=378

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYRRLSK+YHPD      + A+EKF ++ E YEVLS+DEKRR
Sbjct  6    YYEILGVDRNATKEEIKKAYRRLSKKYHPDLNK--EEGAAEKFKEITEAYEVLSDDEKRR  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



>ref|WP_003249049.1| MULTISPECIES: chaperone protein DnaJ [Geobacillus]
 sp|Q9KWS6.1|DNAJ_GEOTM RecName: Full=Chaperone protein DnaJ [Geobacillus thermoglucosidasius]
 dbj|BAB03216.1| dnaJ [Geobacillus thermoglucosidasius]
 gb|EID45381.1| chaperone protein dnaJ [Geobacillus thermoglucosidans TNO-09.020]
 gb|KJX69719.1| molecular chaperone DnaJ [Geobacillus thermoglucosidasius]
Length=380

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  6    YYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEP--DAAEKFKEIKEAYEVLSDDQKRA  63

Query  286  FYD  278
             YD
Sbjct  64   HYD  66



>ref|WP_015864546.1| chaperone protein DnaJ [Geobacillus sp. WCH70]
 sp|C5D4U0.1|DNAJ_GEOSW RecName: Full=Chaperone protein DnaJ [Geobacillus sp. WCH70]
 gb|ACS25132.1| chaperone protein DnaJ [Geobacillus sp. WCH70]
Length=380

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  6    YYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEP--DAAEKFKEIKEAYEVLSDDQKRA  63

Query  286  FYD  278
             YD
Sbjct  64   HYD  66



>gb|AEH47168.1| Chaperone protein dnaJ [Geobacillus thermoglucosidasius C56-YS93]
Length=382

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  8    YYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEP--DAAEKFKEIKEAYEVLSDDQKRA  65

Query  286  FYD  278
             YD
Sbjct  66   HYD  68



>ref|WP_041270196.1| molecular chaperone DnaJ [Geobacillus thermoglucosidasius]
Length=380

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D+KR 
Sbjct  6    YYEILGVSKNATKEEIKKAYRKLSKKYHPDINKEP--DAAEKFKEIKEAYEVLSDDQKRA  63

Query  286  FYD  278
             YD
Sbjct  64   HYD  66



>ref|WP_004268885.1| molecular chaperone DnaJ [Microcystis aeruginosa]
 emb|CCI36822.1| DnaJ-like protein [Microcystis aeruginosa PCC 9701]
Length=164

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            D++Y  LG+   A V E++ AYR LSK YHPDTT L  + A+ KF +L E Y  LSN ++
Sbjct  23   DTYYAILGLHPSASVIEVRRAYRELSKRYHPDTTELNPEVATVKFQRLNEAYATLSNPDR  82

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  83   RSLYDLQIG  91



>ref|WP_036616040.1| molecular chaperone DnaJ, partial [Oscillatoriales cyanobacterium 
JSC-12]
Length=148

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            S+Y+ LG+   A   EI+ AYR LSK YHPDTT LP   A+ +F KL E Y  LS+ E+R
Sbjct  5    SYYELLGLHPSASAREIRQAYRDLSKLYHPDTTKLPTAIATTQFQKLNEAYATLSSPERR  64

Query  289  RFYD  278
              YD
Sbjct  65   SRYD  68



>ref|WP_041237627.1| molecular chaperone DnaJ [Cyanothece sp. PCC 7424]
Length=180

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +S+Y  LG+   A   EI+ AYR LSK YHPDTT LP + A  KF +L E Y  LSN ++
Sbjct  23   NSYYAILGLHPSASPIEIRRAYRELSKRYHPDTTELPPEEAKTKFHRLNEAYGTLSNPDR  82

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  83   RSLYDLKIG  91



>ref|WP_045054745.1| molecular chaperone DnaJ [Chroococcales cyanobacterium CENA595]
 gb|KJH71640.1| molecular chaperone DnaJ [Chroococcales cyanobacterium CENA595]
Length=169

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            ++S   S+Y  LG+   A   EI+ AYR LSK+YHPDTTSLP   A+ KF +L + Y  L
Sbjct  8    VSSEQSSYYTLLGLHPSASAMEIRRAYRELSKQYHPDTTSLPKAIATAKFQELNQAYATL  67

Query  307  SNDEKRRFYD  278
            S+ E+R  YD
Sbjct  68   SHLERRANYD  77



>ref|WP_040697180.1| hypothetical protein, partial [Nodosilinea nodulosa]
Length=145

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            LN    +HY+ LGV   A  ++I+ A+R LSK YHPDTT LP   A+EKF +L + Y +L
Sbjct  4    LNPKPKTHYEQLGVKPTASPQQIRRAFRDLSKLYHPDTTELPAAEATEKFQQLNDAYAIL  63

Query  307  SNDEKRRFYD  278
            S+ ++R  YD
Sbjct  64   SSPDRRWTYD  73



>ref|WP_026552223.1| molecular chaperone DnaJ [Arthrobacter sp. H20]
Length=375

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 2/66 (3%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            +HY+ LGV  DA  EEIK AYR+L+++ HPD  S P   ASE+F  +   YEVLS+ +KR
Sbjct  3    NHYEVLGVNRDASGEEIKKAYRKLARKLHPDVNSGP--DASEEFKMVTRAYEVLSDAQKR  60

Query  289  RFYDWT  272
            R YD T
Sbjct  61   RVYDTT  66



>ref|WP_021793819.1| hypothetical protein [Thermoplasmatales archaeon A-plasma]
 gb|EQB72821.1| hypothetical protein AMDU1_APLC00001G0001 [Thermoplasmatales 
archaeon A-plasma]
Length=370

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 61/112 (54%), Gaps = 5/112 (4%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  DA  +EIK A+R L+K+YHPD        A EKF ++ E YEVLS+++KRR
Sbjct  5    YYEILGVSRDATPDEIKKAFRNLAKKYHPDANPDNKAQAEEKFKEISEAYEVLSDEQKRR  64

Query  286  FYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDMVDRLGGKNMELSS  131
             YD T   E  S  +      +QD       ++  + D+ +R+ G N    +
Sbjct  65   MYDQTGHVEFGSGGSN---FTWQD--FSHFNDFSDLGDIFNRIFGGNFGFGN  111



>ref|WP_012412226.1| molecular chaperone DnaJ [Nostoc punctiforme]
 gb|ACC84285.1| heat shock protein DnaJ domain protein [Nostoc punctiforme PCC 
73102]
Length=174

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  ++Y  LG+   A V +I+ AYR LSK YHPDTT LP   A+ KF ++ E Y  LS+
Sbjct  4    SSKPTYYSLLGLHPSASVIDIRRAYRELSKRYHPDTTDLPTAIATPKFQQINEAYATLSH  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRLSYDLKIG  75



>ref|WP_036535801.1| molecular chaperone DnaJ, partial [Neosynechococcus sphagnicola]
Length=170

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y  LG+   A ++EI+ +YR LSK YHPDTT LP   A+ KF +L E Y  LS+ E+R
Sbjct  10   TYYTLLGLPPSASIQEIRRSYRELSKLYHPDTTILPSAIATTKFQQLNEAYATLSSAERR  69

Query  289  RFYD  278
              YD
Sbjct  70   LVYD  73



>ref|WP_041922593.1| heat shock protein [Cyanobacterium aponinum]
Length=143

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            D+HY  L +   A V EI+ AYR LSK YHPDTT LP + A +KF +L E Y VL+N E 
Sbjct  8    DTHYGLLKLHPSASVMEIRRAYRELSKFYHPDTTDLPPEEAKQKFQRLNEAYGVLANPET  67

Query  292  RRFYD  278
            R  YD
Sbjct  68   RLKYD  72



>gb|ERN40893.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
protein [Rubidibacter lacunae KORDI 51-2]
Length=192

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = -2

Query  475  TDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDE  296
            T+S+Y  LG+   A    I+ AYR LSK YHPDTT LP   A  KF  L E Y  LSN +
Sbjct  19   TNSYYALLGLHPSASPIAIRRAYRELSKRYHPDTTDLPADLAKAKFQILNEAYATLSNPQ  78

Query  295  KRRFYD  278
            +R  YD
Sbjct  79   RRSLYD  84



>ref|XP_001767471.1| predicted protein [Physcomitrella patens]
 gb|EDQ67795.1| predicted protein [Physcomitrella patens]
Length=443

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 2/85 (2%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y  LGVG +AD  EIK+AYR+L+++YHPD    P   A +KF  +   YEVLS+DEKR 
Sbjct  89   YYATLGVGKNADKSEIKSAYRKLARQYHPDVNKEP--GAEQKFKDISNAYEVLSDDEKRS  146

Query  286  FYDWTLAQEAASKEAEKLRMKFQDP  212
             YD                  F +P
Sbjct  147  IYDRFGEAGLKGAGGAGGAAGFNNP  171



>ref|WP_006103090.1| molecular chaperone DnaJ [Coleofasciculus chthonoplastes]
 gb|EDX73810.1| DnaJ domain protein [Coleofasciculus chthonoplastes PCC 7420]
Length=207

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y  LGV   A   +I+ AYR LSK YHPDTT LP + A  KF +L E Y  LS+ E+R
Sbjct  20   TYYGILGVHPSASALDIRRAYRELSKRYHPDTTDLPKETAKTKFQQLNEAYATLSSPERR  79

Query  289  RFYDWTL  269
              YD T+
Sbjct  80   ILYDRTI  86



>emb|CCD75667.1| putative chaperone protein DNAj [Schistosoma mansoni]
Length=198

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 72/160 (45%), Gaps = 19/160 (12%)
 Frame = -2

Query  502  KFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKE  323
             F  L++S T  HY  LG+G  A   EI++A+  LSK+YHPD     +    E F ++ E
Sbjct  16   NFRRLVSSQT--HYDTLGIGKSASYSEIRSAFIELSKKYHPDKNDGDI----EMFKRINE  69

Query  322  VYEVLSNDEKRRFYDWTLAQEAASKEAEKLRMKFQDPHMQEVENWESVPDM---VDRLGG  152
             Y VLS ++ RR YD++LA  A              P+  +V NWE   +      R GG
Sbjct  70   AYSVLSQEKSRRIYDFSLASRAKPSFT-------NSPNEYDVSNWERDFNFHLRAMRFGG  122

Query  151  KNMELSSQ---AKSALTFDILIILFSVCCIVYAIYFKEQY  41
                       ++S      LI +F+    +Y     +QY
Sbjct  123  NKCNTKRNPNISRSIFISTTLIAVFTYFISIYTFIKNKQY  162



>ref|WP_012306171.1| molecular chaperone DnaJ [Synechococcus sp. PCC 7002]
 gb|ACA98547.1| Molecular chaperone, DnaJ class [Synechococcus sp. PCC 7002]
Length=161

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY  LG+   A   EI+  YR LSK++HPDTT LP   A+ KF +L E Y +LS+ E+R
Sbjct  24   SHYGLLGLSPTASPLEIRQRYRELSKQFHPDTTVLPEAEATAKFQRLNEAYGILSSPERR  83

Query  289  RFYDWTLA  266
              YD  + 
Sbjct  84   SLYDLQIG  91



>ref|WP_030005815.1| heat shock protein [Synechococcus sp. NKBG042902]
Length=161

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            SHY  LG+   A   EI+  YR LSK++HPDTT LP   A+ KF +L E Y +LS+ E+R
Sbjct  24   SHYGLLGLSPTASPLEIRQRYRELSKQFHPDTTVLPEAEATAKFQRLNEAYGILSSPERR  83

Query  289  RFYDWTLA  266
              YD  + 
Sbjct  84   SLYDLQIG  91



>ref|WP_029911975.1| hypothetical protein, partial [Pelobacter seleniigenes]
Length=81

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y+ LG+  DAD   IK+ YR L+K +HPD      +AA+E F ++ + Y++LSN E R
Sbjct  2    NYYRLLGIPPDADQNRIKSVYRSLAKRFHPDANHGS-EAAAELFRQVNQAYKILSNSETR  60

Query  289  RFYDWTLAQEAASKEAEK  236
              YD  LAQE A++E ++
Sbjct  61   AAYDRKLAQEEAAQEKQR  78



>ref|WP_028085059.1| molecular chaperone DnaJ [Dolichospermum circinale]
Length=148

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S  ++Y  LG+   A V +I+ AYR LSK YHPDTT LP   A+ KF ++ E Y  LSN 
Sbjct  8    SNTTYYSLLGLHPSASVIDIRRAYRELSKIYHPDTTELPANLATTKFQQINEAYATLSNP  67

Query  298  EKRRFYDWTLA  266
            E+R  YD  + 
Sbjct  68   ERRLSYDLKIG  78



>ref|WP_044805076.1| molecular chaperone DnaJ, partial [Bacillus amyloliquefaciens]
 gb|KJD52408.1| molecular chaperone DnaJ, partial [Bacillus amyloliquefaciens]
Length=159

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGVG  A  +EIK AYR+LSK+YHPD        A EKF ++KE YE LS+D+KR 
Sbjct  6    YYEVLGVGKSASKDEIKKAYRKLSKKYHPDINKEA--GADEKFKEVKEAYETLSDDQKRA  63

Query  286  FYD  278
             YD
Sbjct  64   HYD  66



>ref|WP_006529593.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Gloeocapsa sp. PCC 73106]
 gb|ELR97612.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Gloeocapsa sp. PCC 73106]
Length=142

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y  LG+   A   EI+ +YR LSK +HPDTTSLPL  A  KF +L E Y  LS+ E+R
Sbjct  11   TYYAVLGLHPSASTLEIRRSYRELSKRFHPDTTSLPLAIAKIKFQELNEAYATLSSPERR  70

Query  289  RFYDWTLA  266
              YD  + 
Sbjct  71   SLYDLKIG  78



>ref|WP_029141907.1| molecular chaperone DnaJ [Bacillus coagulans]
 gb|AJH77215.1| chaperone protein DnaJ [Bacillus coagulans DSM 1 = ATCC 7050]
Length=378

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  DA  +EIK AYR+LSK+YHPD    P   A+EKF +++E YEVLS+D
Sbjct  2    SKRDYYEVLGVAKDASKDEIKKAYRKLSKKYHPDINKAP--DAAEKFKEIQEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAQYD  66



>ref|WP_015216284.1| heat shock protein DnaJ domain protein [Anabaena cylindrica]
 gb|AFZ59667.1| heat shock protein DnaJ domain protein [Anabaena cylindrica PCC 
7122]
Length=187

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            L S   ++Y  LG+   A V  I+ AYR LSK+YHPDTT LP   A+ KF ++ E Y  L
Sbjct  8    LQSGKTTYYSLLGLHPSASVINIRRAYRELSKQYHPDTTELPATLATAKFQQINEAYATL  67

Query  307  SNDEKRRFYDWTLA  266
            S+ E+R  YD  + 
Sbjct  68   SHPERRLSYDIKIG  81



>gb|ACK68999.1| heat shock protein DnaJ domain protein [Cyanothece sp. PCC 7424]
Length=193

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +S+Y  LG+   A   EI+ AYR LSK YHPDTT LP + A  KF +L E Y  LSN ++
Sbjct  36   NSYYAILGLHPSASPIEIRRAYRELSKRYHPDTTELPPEEAKTKFHRLNEAYGTLSNPDR  95

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  96   RSLYDLKIG  104



>ref|WP_013859697.1| molecular chaperone DnaJ [Bacillus coagulans]
 gb|AEH53804.1| chaperone protein DnaJ [Bacillus coagulans 2-6]
Length=378

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  DA  +EIK AYR+LSK+YHPD    P   A+EKF +++E YEVLS+D
Sbjct  2    SKRDYYEVLGVAKDASKDEIKKAYRKLSKKYHPDINKAP--DAAEKFKEIQEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAQYD  66



>ref|WP_015202675.1| heat shock protein DnaJ domain-containing protein [Crinalium 
epipsammum]
 gb|AFZ12555.1| heat shock protein DnaJ domain protein [Crinalium epipsammum 
PCC 9333]
Length=201

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +S+Y  LG+   A   EI+ AY  LSK YHPDTT LP K A+ KF +L E Y  LS+ E+
Sbjct  19   ESYYALLGLHPAASALEIRRAYITLSKRYHPDTTELPAKVATAKFQQLNEAYATLSSPER  78

Query  292  RRFYD  278
            R+ YD
Sbjct  79   RQAYD  83



>ref|WP_044894750.1| molecular chaperone DnaJ [Bacillus alveayuensis]
Length=376

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNATKDEIKKAYRKLSKQYHPDINKEP--DAAEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAHYD  66



>gb|KHJ31437.1| putative chaperone j-domain-containing protein [Erysiphe necator]
Length=417

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 4/97 (4%)
 Frame = -2

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F +++    D +Y+ LGV  DA ++EIK AYR+LSK+YHPD        A +KF K+ EV
Sbjct  13   FLQIVTCEED-YYKLLGVTRDASIKEIKRAYRQLSKKYHPDKNPGD-NEAKKKFAKVAEV  70

Query  319  YEVLSNDEKRRFYDWTLAQEAASKEAE-KLRMKFQDP  212
            YE LS+ E RR YD     E   K+++   R  +QDP
Sbjct  71   YEALSDQEMRRIYD-DYGHEGVKKQSQGGGRGGYQDP  106



>ref|WP_028090610.1| molecular chaperone DnaJ [Dolichospermum circinale]
Length=148

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S  ++Y  LG+   A V +I+ AYR LSK YHPDTT LP   A+ KF ++ E Y  LSN 
Sbjct  8    SNTTYYSLLGLHPSASVIDIRRAYRELSKIYHPDTTELPANLATAKFQQINEAYATLSNP  67

Query  298  EKRRFYDWTLA  266
            E+R  YD  + 
Sbjct  68   ERRLNYDLKIG  78



>ref|WP_017552610.1| molecular chaperone DnaJ [Bacillus coagulans]
Length=378

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  DA  +EIK AYR+LSK+YHPD    P   A+EKF +++E YEVLS+D
Sbjct  2    SKRDYYEVLGVAKDASKDEIKKAYRKLSKKYHPDINKAP--DAAEKFKEIQEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAQYD  66



>ref|WP_040553421.1| molecular chaperone DnaJ [Raphidiopsis brookii]
Length=157

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y  LG+   A V +I+ AYR +SK YHPDTT LP + A+ KF +L E Y  LSN E+R
Sbjct  16   NYYTLLGLHPSASVIDIRRAYREMSKHYHPDTTELPDQVATAKFQQLNEAYATLSNPERR  75

Query  289  RFYDWTLA  266
              YD  + 
Sbjct  76   LSYDLKIG  83



>dbj|BAE24035.1| unnamed protein product [Mus musculus]
Length=185

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y+ LGV  DA  E++K AYR+L+ ++HPD    P   A++ F K+   Y VLSN EKR
Sbjct  58   NYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAP--GATDAFKKIGNAYAVLSNPEKR  115

Query  289  RFYDWTLAQEAASKEAEKLRMKFQ  218
            + YD T ++E A       R  F 
Sbjct  116  KQYDLTGSEEQACNHQNNGRFNFH  139



>gb|EFA73682.1| Heat shock protein DnaJ-like protein [Raphidiopsis brookii D9]
Length=155

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++Y  LG+   A V +I+ AYR +SK YHPDTT LP + A+ KF +L E Y  LSN E+R
Sbjct  14   NYYTLLGLHPSASVIDIRRAYREMSKHYHPDTTELPDQVATAKFQQLNEAYATLSNPERR  73

Query  289  RFYDWTLA  266
              YD  + 
Sbjct  74   LSYDLKIG  81



>ref|WP_014097971.1| molecular chaperone DnaJ [Bacillus coagulans]
 gb|AEP01939.1| chaperone protein DnaJ [Bacillus coagulans 36D1]
 gb|KGB28621.1| molecular chaperone DnaJ [Bacillus coagulans]
 gb|KGT40086.1| molecular chaperone DnaJ [Bacillus coagulans P38]
 gb|AJO22549.1| chaperone protein DnaJ [Bacillus coagulans]
Length=378

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  DA  +EIK AYR+LSK+YHPD    P   A+EKF +++E YEVLS+D
Sbjct  2    SKRDYYEVLGVAKDASKDEIKKAYRKLSKKYHPDINKAP--DAAEKFKEIQEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAQYD  66



>ref|WP_027881238.1| molecular chaperone DnaJ [Meiothermus rufus]
Length=291

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV  +A  EEIK A+RRL+++YHPD    P   A EKF ++ E Y VLS+ EKRR
Sbjct  6    YYKILGVAKNASEEEIKKAFRRLARKYHPDVNKEP--GAEEKFKEINEAYTVLSDPEKRR  63

Query  286  FYD  278
            FYD
Sbjct  64   FYD  66



>gb|AFZ52425.1| heat shock protein DnaJ domain protein [Cyanobacterium aponinum 
PCC 10605]
Length=156

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            D+HY  L +   A V EI+ AYR LSK YHPDTT LP + A +KF +L E Y VL+N E 
Sbjct  21   DTHYGLLKLHPSASVMEIRRAYRELSKFYHPDTTDLPPEEAKQKFQRLNEAYGVLANPET  80

Query  292  RRFYD  278
            R  YD
Sbjct  81   RLKYD  85



>dbj|BAL56358.1| molecular chaperone DnaJ [uncultured Aquificae bacterium]
Length=356

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y  LGV  DA  EEIK AYRRL+KEYHPD ++   + ASEKF ++ E Y +LS++E+R+
Sbjct  6    YYHILGVSKDATAEEIKKAYRRLAKEYHPDISA--DENASEKFKEINEAYHILSDEERRK  63

Query  286  FYDWTL  269
             YD  L
Sbjct  64   EYDRIL  69



>ref|WP_004435827.1| molecular chaperone DnaJ [Bacillus methanolicus]
 gb|EIJ83560.1| chaperone protein DnaJ [Bacillus methanolicus MGA3]
 gb|AIE60799.1| Chaperone protein DnaJ [Bacillus methanolicus MGA3]
Length=375

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -2

Query  478  STDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSND  299
            S   +Y+ LGV  +A  +EIK AYR+LSK+YHPD    P   A EKF ++KE YEVLS+D
Sbjct  2    SKRDYYEVLGVSKNASKDEIKKAYRKLSKKYHPDINKEP--GADEKFKEIKEAYEVLSDD  59

Query  298  EKRRFYD  278
            +KR  YD
Sbjct  60   QKRAQYD  66



>ref|XP_009382672.1| PREDICTED: dnaJ homolog 1, mitochondrial [Musa acuminata subsp. 
malaccensis]
Length=490

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 3/74 (4%)
 Frame = -2

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
            F+  +++S D +Y  LGV   A  +EIK AYRRL+++YHPD    P   A+EKF ++   
Sbjct  63   FTSFVSASAD-YYSTLGVPKSASAKEIKAAYRRLARQYHPDVNKQP--GATEKFKEISTA  119

Query  319  YEVLSNDEKRRFYD  278
            YEVLS+D+KR  YD
Sbjct  120  YEVLSDDKKRALYD  133



>ref|WP_011130863.1| molecular chaperone DnaJ [Prochlorococcus marinus]
 emb|CAE21670.1| DnaJ-like protein [Prochlorococcus marinus str. MIT 9313]
Length=210

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  532  KADENELLGDKFSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKA  353
            K D+   + D+   L+ +   SHY+ LGV   ADVE I  A+RR SK  HPDT  LP + 
Sbjct  17   KGDDVLRVADQL--LVLTLAKSHYERLGVARSADVETIHLAFRRRSKVLHPDTAPLPAEQ  74

Query  352  ASEKFMKLKEVYEVLSNDEKRRFYDWTLAQEA  257
            A+++F  L E YE+L++  +R+ YD +L  E 
Sbjct  75   AAKQFQLLCEAYELLTDPVRRQAYDASLMAEG  106



>ref|WP_026926813.1| molecular chaperone DnaJ [Granulicoccus phenolivorans]
Length=388

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +YQ LGV  DA  E IK AYRRL+ +YHPD  + P   A EKF  ++E Y+VLS+D KR 
Sbjct  5    YYQTLGVARDASAEAIKKAYRRLAMQYHPDVNTEP--GADEKFKSIQEAYDVLSDDRKRS  62

Query  286  FYD  278
             YD
Sbjct  63   IYD  65



>dbj|BAL54562.1| molecular chaperone DnaJ [uncultured Aquificae bacterium]
Length=356

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y  LGV  DA  EEIK AYRRL+KEYHPD ++   + ASEKF ++ E Y +LS++E+R+
Sbjct  6    YYHILGVSKDATAEEIKKAYRRLAKEYHPDISA--DENASEKFKEINEAYHILSDEERRK  63

Query  286  FYDWTL  269
             YD  L
Sbjct  64   EYDRIL  69



>ref|WP_002736811.1| MULTISPECIES: molecular chaperone DnaJ [Microcystis]
 emb|CCI31754.1| DnaJ protein [Microcystis sp. T1-4]
 gb|ELP54279.1| hypothetical protein O53_3095 [Microcystis aeruginosa TAIHU98]
Length=164

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +++Y  LG+   A V E++ AYR LSK YHPDTT L  + A+ KF +L E Y  LSN ++
Sbjct  23   NTYYAILGLHPSASVIEVRRAYRELSKRYHPDTTELSPEVATAKFQRLNEAYATLSNPDR  82

Query  292  RRFYDWTLA  266
            R  YD  + 
Sbjct  83   RSLYDLQIG  91



>ref|WP_044879573.1| molecular chaperone DnaJ [Paenibacillus sp. IHBB 10380]
 gb|AJS61102.1| molecular chaperone DnaJ [Paenibacillus sp. IHBB 10380]
Length=148

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -2

Query  469  SHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKR  290
            ++YQ LGVG DA   EIK AYR+L+K YHPDT     +AA ++F ++ E YEVLS +  R
Sbjct  3    NYYQILGVGRDAQAVEIKQAYRQLAKRYHPDTNQGSEEAA-QRFKQIHEAYEVLSKESSR  61

Query  289  RFYDWTLA  266
            + YD   A
Sbjct  62   QAYDAKSA  69



>gb|ADI65926.1| heat shock protein DnaJ domain protein ['Nostoc azollae' 0708]
Length=145

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y  LG+   A V +I+ AYR LSK+YHPDTT LP   A+EKF ++ E Y  LS+ E+R 
Sbjct  9    YYALLGLHPSASVIDIRRAYRELSKQYHPDTTELPAIVATEKFQQINEAYATLSHPERRL  68

Query  286  FYDWTLA  266
             YD  + 
Sbjct  69   RYDLKIG  75



>ref|WP_008231827.1| DnaJ protein [Richelia intracellularis]
 emb|CCH66406.1| DnaJ protein [Richelia intracellularis HH01]
Length=156

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  487  LNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVL  308
            +++S  ++Y  LG+   A + EI+ AY+RLSK YHPDTT LP+  A+ KF  L E Y  L
Sbjct  1    MHTSKPTYYNLLGLEPSASMLEIRCAYKRLSKCYHPDTTVLPISDATVKFQHLNEAYTTL  60

Query  307  SNDEKRRFYDWTLA  266
             N E R  YD  + 
Sbjct  61   MNLEDRYAYDLQIG  74



>gb|KEF43024.1| molecular chaperone DnaJ [Cyanobium sp. CACIAM 14]
Length=186

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  499  FSELLNSSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEV  320
             S     ST ++YQ L +   A  +E++ A+R LSK YHPDTT+LP   A   F +L + 
Sbjct  1    MSSTAKPSTPTYYQVLELSPGATDQELRQAFRGLSKRYHPDTTTLPAGEAEAAFRRLSQA  60

Query  319  YEVLSNDEKRRFYD  278
            Y VLS+ + RR YD
Sbjct  61   YAVLSDPDARRIYD  74



>ref|WP_002751861.1| molecular chaperone DnaJ [Microcystis aeruginosa]
 emb|CCH95644.1| DnaJ protein [Microcystis aeruginosa PCC 9432]
 emb|CCI04053.1| DnaJ protein [Microcystis aeruginosa PCC 9443]
 emb|CCI08104.1| DnaJ protein [Microcystis aeruginosa PCC 7941]
Length=164

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 8/95 (8%)
 Frame = -2

Query  472  DSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEK  293
            +++Y  LG+   A V E++ AYR LSK YHPDTT L  + A+ KF +L E Y  LSN ++
Sbjct  23   NTYYAILGLHPSASVIEVRRAYRELSKRYHPDTTELSPEVATVKFQRLNEAYATLSNPDR  82

Query  292  RRFYD-------WTLAQEAA-SKEAEKLRMKFQDP  212
            R  YD       W + Q    S E    R  + DP
Sbjct  83   RSLYDLQIGYSRWNVIQTIPDSDEPIANRSAYLDP  117



>ref|WP_016952185.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=176

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  481  SSTDSHYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSN  302
            SS  S+Y  LG+   A V +I+  YR LSK+YHPDTT LP   A+ KF ++ E Y  LS+
Sbjct  4    SSEISYYALLGLHPSASVIDIRRTYRELSKQYHPDTTELPATVATAKFQQINEAYATLSH  63

Query  301  DEKRRFYDWTLA  266
             E+R  YD  + 
Sbjct  64   PERRLSYDLKIG  75



>ref|WP_020960633.1| molecular chaperone DnaJ [Geobacillus sp. JF8]
 gb|AGT32842.1| molecular chaperone DnaJ [Geobacillus sp. JF8]
Length=381

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = -2

Query  466  HYQFLGVGADADVEEIKTAYRRLSKEYHPDTTSLPLKAASEKFMKLKEVYEVLSNDEKRR  287
            +Y+ LGV   A  +EIK AYR+LSK+YHPD    P   A+EKF ++KE YEVLS+DEKR 
Sbjct  6    YYEVLGVSKTATKDEIKKAYRKLSKQYHPDINKAP--DAAEKFKEIKEAYEVLSDDEKRA  63

Query  286  FYD  278
             YD
Sbjct  64   RYD  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2104600723148