BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12230

Length=1368
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228627.1|  PREDICTED: uncharacterized oxidoreductase C2...    506   2e-174   Solanum lycopersicum
ref|XP_009773348.1|  PREDICTED: uncharacterized protein LOC104223588    503   2e-173   Nicotiana sylvestris
ref|XP_009588958.1|  PREDICTED: uncharacterized protein YMR315W         503   2e-173   Nicotiana tomentosiformis
ref|XP_006348416.1|  PREDICTED: uncharacterized protein YMR315W-like    503   3e-173   Solanum tuberosum [potatoes]
ref|XP_012092787.1|  PREDICTED: uncharacterized protein YMR315W i...    464   4e-158   Jatropha curcas
emb|CDP14087.1|  unnamed protein product                                464   5e-158   Coffea canephora [robusta coffee]
ref|XP_002513445.1|  oxidoreductase, putative                           462   4e-157   Ricinus communis
emb|CBI16434.3|  unnamed protein product                                461   1e-156   Vitis vinifera
ref|XP_002285606.1|  PREDICTED: uncharacterized protein LOC100245...    460   2e-156   Vitis vinifera
ref|XP_012092785.1|  PREDICTED: uncharacterized protein YMR315W i...    459   2e-156   Jatropha curcas
ref|XP_011025252.1|  PREDICTED: uncharacterized protein YMR315W i...    459   5e-156   Populus euphratica
ref|XP_011025251.1|  PREDICTED: uncharacterized protein YMR315W i...    454   3e-154   Populus euphratica
ref|XP_006386094.1|  hypothetical protein POPTR_0003s22050g             452   1e-153   Populus trichocarpa [western balsam poplar]
ref|XP_006386095.1|  hypothetical protein POPTR_0003s22050g             448   7e-152   Populus trichocarpa [western balsam poplar]
ref|XP_008449757.1|  PREDICTED: uncharacterized protein YMR315W         444   2e-150   
ref|XP_011080243.1|  PREDICTED: uncharacterized protein LOC105163544    443   9e-150   Sesamum indicum [beniseed]
ref|XP_010031848.1|  PREDICTED: uncharacterized protein YMR315W         443   1e-149   Eucalyptus grandis [rose gum]
gb|ABK96297.1|  unknown                                                 443   1e-149   Populus trichocarpa x Populus deltoides
ref|XP_008243595.1|  PREDICTED: uncharacterized protein YMR315W         441   4e-149   Prunus mume [ume]
ref|XP_006494722.1|  PREDICTED: uncharacterized protein YMR315W-like    441   5e-149   Citrus sinensis [apfelsine]
ref|XP_009364727.1|  PREDICTED: uncharacterized protein LOC103954617    439   2e-148   Pyrus x bretschneideri [bai li]
ref|XP_009364714.1|  PREDICTED: uncharacterized protein LOC103954601    439   2e-148   Pyrus x bretschneideri [bai li]
ref|XP_006445974.1|  hypothetical protein CICLE_v10015756mg             438   4e-148   Citrus clementina [clementine]
ref|XP_011461910.1|  PREDICTED: uncharacterized protein YMR315W         436   4e-147   Fragaria vesca subsp. vesca
ref|XP_009145584.1|  PREDICTED: uncharacterized protein YMR315W         435   1e-146   Brassica rapa
ref|XP_003543553.1|  PREDICTED: uncharacterized protein YMR315W         434   3e-146   Glycine max [soybeans]
gb|KFK39395.1|  hypothetical protein AALP_AA3G239500                    434   4e-146   Arabis alpina [alpine rockcress]
ref|XP_008358862.1|  PREDICTED: uncharacterized protein YMR315W-l...    433   5e-146   Malus domestica [apple tree]
ref|XP_011653574.1|  PREDICTED: uncharacterized protein LOC101204258    432   1e-145   Cucumis sativus [cucumbers]
ref|XP_010257400.1|  PREDICTED: uncharacterized protein LOC104597...    431   6e-145   Nelumbo nucifera [Indian lotus]
ref|XP_006406349.1|  hypothetical protein EUTSA_v10021019mg             431   6e-145   Eutrema salsugineum [saltwater cress]
ref|XP_010257398.1|  PREDICTED: uncharacterized protein LOC104597...    431   1e-144   Nelumbo nucifera [Indian lotus]
ref|XP_008358864.1|  PREDICTED: uncharacterized protein YMR315W-l...    428   4e-144   Malus domestica [apple tree]
ref|XP_007150403.1|  hypothetical protein PHAVU_005G150400g             429   4e-144   Phaseolus vulgaris [French bean]
ref|XP_010091995.1|  Uncharacterized protein L484_007981                427   1e-143   
ref|XP_006298014.1|  hypothetical protein CARUB_v10014059mg             426   3e-143   
ref|XP_010488066.1|  PREDICTED: glucose-fructose oxidoreductase d...    426   4e-143   Camelina sativa [gold-of-pleasure]
gb|KJB66097.1|  hypothetical protein B456_010G128200                    426   5e-143   Gossypium raimondii
ref|XP_010544236.1|  PREDICTED: uncharacterized protein YMR315W i...    425   8e-143   Tarenaya hassleriana [spider flower]
ref|XP_010257399.1|  PREDICTED: uncharacterized protein LOC104597...    426   8e-143   Nelumbo nucifera [Indian lotus]
ref|XP_010544235.1|  PREDICTED: uncharacterized protein YMR315W i...    425   1e-142   Tarenaya hassleriana [spider flower]
gb|AFK46300.1|  unknown                                                 424   2e-142   Lotus japonicus
ref|XP_010509356.1|  PREDICTED: glucose-fructose oxidoreductase d...    422   9e-142   Camelina sativa [gold-of-pleasure]
gb|KJB66099.1|  hypothetical protein B456_010G128200                    421   2e-141   Gossypium raimondii
ref|NP_188715.2|  NAD(P)-binding Rossmann-fold superfamily protein      421   2e-141   Arabidopsis thaliana [mouse-ear cress]
gb|KJB66096.1|  hypothetical protein B456_010G128200                    416   3e-139   Gossypium raimondii
ref|XP_002883268.1|  oxidoreductase family protein                      415   6e-139   
gb|KJB66095.1|  hypothetical protein B456_010G128200                    415   7e-139   Gossypium raimondii
gb|KJB66098.1|  hypothetical protein B456_010G128200                    415   9e-139   Gossypium raimondii
ref|XP_007014899.1|  Oxidoreductase, putative isoform 1                 415   9e-139   
ref|XP_010913917.1|  PREDICTED: uncharacterized protein LOC105039...    415   1e-138   Elaeis guineensis
emb|CDY19604.1|  BnaA05g20120D                                          412   5e-138   Brassica napus [oilseed rape]
emb|CDY06381.1|  BnaC05g31490D                                          411   1e-137   
ref|XP_004486934.1|  PREDICTED: uncharacterized protein YMR315W-like    411   3e-137   Cicer arietinum [garbanzo]
ref|XP_009385566.1|  PREDICTED: glucose-fructose oxidoreductase d...    410   1e-136   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002459955.1|  hypothetical protein SORBIDRAFT_02g018670          409   1e-136   Sorghum bicolor [broomcorn]
ref|XP_004956459.1|  PREDICTED: uncharacterized protein YMR315W-like    407   9e-136   Setaria italica
ref|XP_008787293.1|  PREDICTED: uncharacterized protein LOC103705381    407   2e-135   Phoenix dactylifera
gb|KHG07862.1|  Uncharacterized protein F383_13730                      405   4e-135   Gossypium arboreum [tree cotton]
ref|XP_010651283.1|  PREDICTED: uncharacterized protein LOC100245...    403   8e-135   Vitis vinifera
ref|XP_003577920.1|  PREDICTED: uncharacterized protein LOC100827110    403   3e-134   Brachypodium distachyon [annual false brome]
ref|NP_001149836.1|  NAD-dependent dyhydrogenase, Gfo/Idh/MocA fa...    403   3e-134   Zea mays [maize]
ref|XP_007205433.1|  hypothetical protein PRUPE_ppa007778mg             403   4e-134   
ref|XP_006660493.1|  PREDICTED: uncharacterized protein YMR315W-like    400   3e-133   Oryza brachyantha
ref|XP_010673578.1|  PREDICTED: uncharacterized protein YMR315W i...    400   3e-133   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673579.1|  PREDICTED: uncharacterized protein YMR315W i...    400   4e-133   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008668038.1|  PREDICTED: NAD-dependent dyhydrogenase, Gfo/...    400   8e-133   Zea mays [maize]
ref|NP_001062764.1|  Os09g0280300                                       399   2e-132   
emb|CAN75498.1|  hypothetical protein VITISV_020272                     397   8e-132   Vitis vinifera
ref|XP_003597479.1|  Oxidoreductase, putative                           397   8e-132   Medicago truncatula
gb|EMT01460.1|  hypothetical protein F775_26364                         392   6e-130   
ref|XP_011090402.1|  PREDICTED: uncharacterized protein YMR315W-like    391   1e-129   Sesamum indicum [beniseed]
gb|EYU18011.1|  hypothetical protein MIMGU_mgv1a008840mg                389   9e-129   Erythranthe guttata [common monkey flower]
ref|XP_011625442.1|  PREDICTED: uncharacterized protein LOC18439853     389   2e-128   Amborella trichopoda
gb|ERN11653.1|  hypothetical protein AMTR_s00022p00213490               388   3e-128   Amborella trichopoda
gb|EEE69341.1|  hypothetical protein OsJ_28659                          382   9e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010913920.1|  PREDICTED: uncharacterized protein LOC105039...    372   6e-122   Elaeis guineensis
ref|XP_007014900.1|  Oxidoreductase, putative isoform 2                 370   2e-121   
gb|EPS68382.1|  hypothetical protein M569_06387                         358   9e-117   Genlisea aurea
ref|XP_010651284.1|  PREDICTED: uncharacterized protein LOC100245...    348   2e-113   
gb|KJB66094.1|  hypothetical protein B456_010G128200                    340   9e-111   Gossypium raimondii
gb|KJB66101.1|  hypothetical protein B456_010G128200                    320   4e-103   Gossypium raimondii
ref|XP_010466287.1|  PREDICTED: uncharacterized protein LOC104746495    317   4e-102   Camelina sativa [gold-of-pleasure]
gb|KCW51233.1|  hypothetical protein EUGRSUZ_J00813                     318   4e-102   Eucalyptus grandis [rose gum]
ref|XP_006445973.1|  hypothetical protein CICLE_v10015756mg             302   3e-96    
ref|XP_001762266.1|  predicted protein                                  305   1e-95    
ref|XP_001754780.1|  predicted protein                                  277   4e-85    
dbj|BAB02487.1|  unnamed protein product                                274   2e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KJB66100.1|  hypothetical protein B456_010G128200                    265   2e-82    Gossypium raimondii
gb|AFK42402.1|  unknown                                                 253   2e-78    Lotus japonicus
ref|XP_002969664.1|  hypothetical protein SELMODRAFT_92921              258   8e-78    
gb|ACU17312.1|  unknown                                                 249   2e-76    Glycine max [soybeans]
ref|XP_002973220.1|  hypothetical protein SELMODRAFT_413759             251   4e-75    
ref|XP_002976631.1|  hypothetical protein SELMODRAFT_416506             250   6e-75    Selaginella moellendorffii
ref|XP_002981277.1|  hypothetical protein SELMODRAFT_114540             248   5e-74    
gb|EYU46305.1|  hypothetical protein MIMGU_mgv1a0096472mg               224   1e-67    Erythranthe guttata [common monkey flower]
ref|XP_001776337.1|  predicted protein                                  230   6e-67    
ref|XP_002973823.1|  hypothetical protein SELMODRAFT_414190             226   9e-66    
gb|KGN54118.1|  hypothetical protein Csa_4G286420                       214   2e-63    Cucumis sativus [cucumbers]
ref|XP_006445972.1|  hypothetical protein CICLE_v10015756mg             215   4e-63    
gb|KGN54119.1|  hypothetical protein Csa_4G286920                       171   1e-46    Cucumis sativus [cucumbers]
gb|EYU46309.1|  hypothetical protein MIMGU_mgv1a0096471mg               143   8e-37    Erythranthe guttata [common monkey flower]
gb|KEQ84242.1|  NAD(P)-binding protein                                  135   6e-32    Aureobasidium pullulans EXF-150
gb|KEQ74017.1|  NAD(P)-binding protein                                  130   3e-30    Aureobasidium namibiae CBS 147.97
gb|KEQ61018.1|  oxidoreductase-like protein family                      129   5e-30    Aureobasidium melanogenum CBS 110374
gb|EFQ28397.1|  oxidoreductase family protein                           127   4e-29    Colletotrichum graminicola M1.001
gb|KEQ94380.1|  hypothetical protein AUEXF2481DRAFT_270651              124   3e-28    Aureobasidium subglaciale EXF-2481
emb|CCF43203.1|  oxidoreductase                                         122   1e-27    Colletotrichum higginsianum
gb|ENH79899.1|  oxidoreductase nad-binding rossmann fold protein        122   2e-27    
gb|KDQ06959.1|  hypothetical protein BOTBODRAFT_60302                   120   7e-27    Botryobasidium botryosum FD-172 SS1
ref|XP_001942427.1|  conserved hypothetical protein                     116   1e-25    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007603283.1|  oxidoreductase                                     113   1e-24    
ref|XP_011117421.1|  hypothetical protein AOL_s00004g470                112   3e-24    Arthrobotrys oligospora ATCC 24927
gb|KEH18356.1|  NAD(P)-binding rossmann-fold protein, putative          105   7e-24    Medicago truncatula
ref|XP_007785079.1|  hypothetical protein W97_09025                     111   9e-24    Coniosporium apollinis CBS 100218
gb|EMD87949.1|  hypothetical protein COCHEDRAFT_1183091                 110   1e-23    Bipolaris maydis C5
ref|XP_007713573.1|  hypothetical protein COCCADRAFT_99511              110   1e-23    Bipolaris zeicola 26-R-13
gb|KEH18355.1|  NAD(P)-binding rossmann-fold protein, putative          105   1e-23    Medicago truncatula
ref|XP_003300258.1|  hypothetical protein PTT_11448                     110   1e-23    
ref|XP_003347717.1|  hypothetical protein SMAC_03815                    109   3e-23    Sordaria macrospora k-hell
ref|XP_008025728.1|  hypothetical protein SETTUDRAFT_135946             108   7e-23    Exserohilum turcica Et28A
gb|ERT03209.1|  hypothetical protein HMPREF1624_01515                   107   2e-22    Sporothrix schenckii ATCC 58251
ref|XP_001935897.1|  conserved hypothetical protein                     107   2e-22    Pyrenophora tritici-repentis Pt-1C-BFP
gb|EUN24448.1|  hypothetical protein COCVIDRAFT_106168                  107   3e-22    Bipolaris victoriae FI3
gb|KEZ45810.1|  Oxidoreductase-like protein                             106   4e-22    Scedosporium apiospermum
ref|XP_011112776.1|  hypothetical protein H072_7001                     105   7e-22    
ref|XP_007686203.1|  hypothetical protein COCMIDRAFT_90481              104   2e-21    Bipolaris oryzae ATCC 44560
ref|XP_003840030.1|  similar to oxidoreductase family                   103   2e-21    Leptosphaeria maculans JN3
ref|XP_001397204.1|  NAD-binding Rossmann fold oxidoreductase fam...    103   4e-21    Aspergillus niger CBS 513.88
emb|CDY27562.1|  BnaC01g32450D                                        99.8    6e-21    Brassica napus [oilseed rape]
dbj|GAA91490.1|  oxidoreductase family, NAD-binding Rossmann fold...    102   6e-21    Aspergillus kawachii IFO 4308
gb|KFZ16228.1|  hypothetical protein V501_02319                         102   8e-21    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|EQB57311.1|  hypothetical protein CGLO_02580                         102   1e-20    Colletotrichum gloeosporioides Cg-14
gb|EPS32813.1|  hypothetical protein PDE_07773                          101   2e-20    Penicillium oxalicum 114-2
gb|EWC48565.1|  hypothetical protein DRE_01787                          101   2e-20    Drechslerella stenobrocha 248
gb|KIM22883.1|  hypothetical protein M408DRAFT_332653                   101   3e-20    Serendipita vermifera MAFF 305830
ref|XP_007275100.1|  oxidoreductase nad-binding rossmann fold pro...    100   3e-20    
gb|EPS29944.1|  hypothetical protein PDE_04894                          100   4e-20    Penicillium oxalicum 114-2
gb|KIV83264.1|  hypothetical protein PV11_05309                         100   4e-20    Exophiala sideris
gb|KHE80312.1|  NAD(P)-binding protein                                  100   5e-20    Neurospora crassa
gb|KFY75511.1|  hypothetical protein V499_04510                         100   5e-20    Pseudogymnoascus sp. VKM F-103
gb|KIH86578.1|  hypothetical protein SPBR_08549                         100   6e-20    Sporothrix brasiliensis 5110
ref|XP_960192.1|  NAD-binding Rossmann fold oxidoreductase              100   6e-20    Neurospora crassa OR74A
gb|EKV16143.1|  Oxidoreductase family, NAD-binding Rossmann fold ...    102   7e-20    Penicillium digitatum Pd1
ref|XP_007839104.1|  hypothetical protein PFICI_12332                 99.8    7e-20    Pestalotiopsis fici W106-1
ref|XP_001906379.1|  hypothetical protein                             99.8    9e-20    Podospora anserina S mat+
ref|XP_003045334.1|  hypothetical protein NECHADRAFT_70521            99.4    1e-19    [Nectria] haematococca mpVI 77-13-4
gb|KFY61799.1|  hypothetical protein V496_04887                         102   1e-19    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_009854174.1|  hypothetical protein NEUTE1DRAFT_131795          99.4    1e-19    Neurospora tetrasperma FGSC 2508
gb|KIO22407.1|  hypothetical protein M407DRAFT_118073                 99.0    2e-19    Tulasnella calospora MUT 4182
gb|KIH93169.1|  hypothetical protein SPBR_02922                       99.0    2e-19    Sporothrix brasiliensis 5110
gb|KEZ39853.1|  Oxidoreductase-like protein                           98.6    2e-19    Scedosporium apiospermum
ref|XP_007588173.1|  putative oxidoreductase nad-binding rossmann...  98.2    2e-19    
emb|CCA69637.1|  hypothetical protein PIIN_03576                      98.6    3e-19    Serendipita indica DSM 11827
gb|KJK67904.1|  Oxidoreductase family NAD-binding Rossmann fold       98.2    3e-19    Aspergillus parasiticus SU-1
gb|EPE09779.1|  nad-binding rossmann fold oxidoreductase family p...  98.2    4e-19    Ophiostoma piceae UAMH 11346
dbj|GAM35894.1|  oxidoreductase                                       97.8    4e-19    Talaromyces cellulolyticus
ref|XP_002382548.1|  oxidoreductase family, NAD-binding Rossmann ...  97.4    5e-19    Aspergillus flavus NRRL3357
ref|XP_007367395.1|  oxidoreductase family protein                    97.8    5e-19    Dichomitus squalens LYAD-421 SS1
ref|XP_001275918.1|  NAD-binding Rossmann fold oxidoreductase fam...  97.4    5e-19    Aspergillus clavatus NRRL 1
dbj|BAE61316.1|  unnamed protein product                              97.1    7e-19    Aspergillus oryzae RIB40
gb|ERT01696.1|  hypothetical protein HMPREF1624_02949                 97.4    7e-19    Sporothrix schenckii ATCC 58251
gb|EER41723.1|  NAD-binding Rossmann fold oxidoreductase              96.7    1e-18    Histoplasma capsulatum H143
ref|XP_007699535.1|  hypothetical protein COCSADRAFT_89105            96.7    1e-18    Bipolaris sorokiniana ND90Pr
gb|EWG49872.1|  glucose-fructose oxidoreductase                       96.3    1e-18    Fusarium verticillioides 7600
ref|XP_009263289.1|  hypothetical protein FPSE_11897                  96.3    1e-18    Fusarium pseudograminearum CS3096
gb|KJR88931.1|  hypothetical protein SPSK_07648                       96.7    1e-18    Sporothrix schenckii 1099-18
gb|KKA24050.1|  NAD-binding Rossmann fold oxidoreductase family p...  97.1    1e-18    Rasamsonia emersonii CBS 393.64
gb|KIH88824.1|  hypothetical protein SPBR_07486                       95.9    2e-18    Sporothrix brasiliensis 5110
ref|XP_011399715.1|  Uncharacterized protein F751_0699                95.9    2e-18    Auxenochlorella protothecoides
gb|ESZ98482.1|  hypothetical protein SBOR_1144                        95.5    2e-18    Sclerotinia borealis F-4128
ref|XP_007793174.1|  putative oxidoreductase nad-binding rossmann...  95.1    2e-18    
ref|XP_006696746.1|  hypothetical protein CTHT_0064410                97.1    3e-18    Chaetomium thermophilum var. thermophilum DSM 1495
gb|EEQ92492.1|  NAD-binding Rossmann fold oxidoreductase              95.1    4e-18    Blastomyces dermatitidis ER-3
gb|EQL35203.1|  hypothetical protein BDFG_03181                       95.1    4e-18    Blastomyces dermatitidis ATCC 26199
ref|XP_001554573.1|  hypothetical protein BC1G_07162                  95.1    4e-18    Botrytis cinerea B05.10
ref|XP_007295758.1|  oxidoreductase family protein                    95.1    4e-18    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_002626131.1|  NAD-binding Rossmann fold oxidoreductase         95.1    4e-18    Blastomyces gilchristii SLH14081
ref|XP_008085160.1|  NAD(P)-binding Rossmann-fold containing protein  95.1    4e-18    Glarea lozoyensis ATCC 20868
gb|ERT02500.1|  hypothetical protein HMPREF1624_00799                 94.7    4e-18    Sporothrix schenckii ATCC 58251
gb|EGE83963.1|  NAD-binding Rossmann fold oxidoreductase              94.7    5e-18    Blastomyces dermatitidis ATCC 18188
gb|KFY88446.1|  hypothetical protein V500_06334                       94.4    6e-18    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_001593666.1|  hypothetical protein SS1G_05094                  94.4    6e-18    Sclerotinia sclerotiorum 1980 UF-70
gb|ELR09495.1|  hypothetical protein GMDG_00677                       94.4    7e-18    Pseudogymnoascus destructans 20631-21
gb|KFZ09203.1|  hypothetical protein V502_08867                       94.4    7e-18    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|KIL95797.1|  glucose-fructose oxidoreductase                       94.0    8e-18    Fusarium avenaceum
ref|XP_011318574.1|  hypothetical protein FGSG_02628                  94.0    1e-17    Fusarium graminearum PH-1
gb|KGO75187.1|  Oxidoreductase, N-terminal                            95.5    1e-17    Penicillium italicum
ref|XP_001822449.2|  hypothetical protein AOR_1_404134                95.5    1e-17    
ref|XP_002839683.1|  hypothetical protein                             93.6    1e-17    Tuber melanosporum Mel28
ref|XP_009153161.1|  glucose-fructose oxidoreductase                  93.2    1e-17    Exophiala dermatitidis NIH/UT8656
ref|XP_680622.1|  hypothetical protein AN7353.2                       93.2    1e-17    Aspergillus nidulans FGSC A4
gb|KJJ26537.1|  Ribosomal protein L32e                                95.9    1e-17    
ref|XP_002146783.1|  oxidoreductase family, NAD-binding Rossmann ...  93.2    2e-17    Talaromyces marneffei ATCC 18224
gb|KFY35329.1|  hypothetical protein V494_06008                       93.2    2e-17    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY14890.1|  hypothetical protein V492_02347                       92.8    2e-17    Pseudogymnoascus sp. VKM F-4246
gb|KGO40526.1|  Oxidoreductase, N-terminal                            94.7    2e-17    Penicillium expansum
gb|EHK24126.1|  hypothetical protein TRIVIDRAFT_45259                 92.8    2e-17    Trichoderma virens Gv29-8
ref|XP_008045096.1|  oxidoreductase family protein                    93.2    2e-17    Trametes versicolor FP-101664 SS1
dbj|BAE63558.1|  unnamed protein product                              92.8    3e-17    Aspergillus oryzae RIB40
gb|KJJ31534.1|  Oxidoreductase family NAD-binding Rossmann fold       92.8    3e-17    
gb|EHK50187.1|  hypothetical protein TRIATDRAFT_233440                92.4    3e-17    Trichoderma atroviride IMI 206040
gb|KIY44168.1|  NAD(P)-binding protein                                92.4    3e-17    Fistulina hepatica ATCC 64428
gb|EWZ38499.1|  glucose-fructose oxidoreductase                       92.4    3e-17    Fusarium oxysporum Fo47
ref|XP_006455042.1|  hypothetical protein AGABI2DRAFT_194743          92.8    3e-17    Agaricus bisporus var. bisporus H97
gb|EWY91836.1|  glucose-fructose oxidoreductase                       92.4    3e-17    Fusarium oxysporum FOSC 3-a
emb|CDM31202.1|  NAD(P)-binding domain                                92.0    4e-17    Penicillium roqueforti FM164
gb|EHK17838.1|  hypothetical protein TRIVIDRAFT_136949                91.7    5e-17    Trichoderma virens Gv29-8
gb|EIT72400.1|  putative dehydrogenase                                92.8    5e-17    Aspergillus oryzae 3.042
ref|XP_755974.1|  oxidoreductase family, NAD-binding Rossmann fol...  92.0    5e-17    Aspergillus fumigatus Af293
gb|KKA20212.1|  hypothetical protein T310_5781                        91.7    5e-17    Rasamsonia emersonii CBS 393.64
gb|ETS04874.1|  NAD-binding Rossmann fold oxidoreductase              91.7    6e-17    Trichoderma reesei RUT C-30
gb|EEH05857.1|  NAD-binding Rossmann fold oxidoreductase              91.7    6e-17    Histoplasma capsulatum G186AR
ref|XP_007330917.1|  hypothetical protein AGABI1DRAFT_114560          91.7    7e-17    Agaricus bisporus var. burnettii JB137-S8
gb|KJJ31192.1|  Ribosomal protein L32                                 93.2    7e-17    
gb|KFH44383.1|  hypothetical protein ACRE_048520                      90.9    9e-17    Acremonium chrysogenum ATCC 11550
gb|KIY03803.1|  hypothetical protein Z520_00494                       90.9    1e-16    Fonsecaea multimorphosa CBS 102226
gb|EXL57961.1|  glucose-fructose oxidoreductase                       90.9    1e-16    Fusarium oxysporum f. sp. radicis-lycopersici 26381
ref|XP_773472.1|  hypothetical protein CNBI0860                       90.9    1e-16    Cryptococcus neoformans var. neoformans B-3501A
gb|KIV93979.1|  hypothetical protein PV10_05146                       90.5    1e-16    Exophiala mesophila
gb|KIR53880.1|  NAD-binding Rossmann fold oxidoreductase              90.9    1e-16    Cryptococcus gattii Ru294
ref|XP_003194017.1|  hypothetical protein CGB_D1030C                  90.9    1e-16    Cryptococcus gattii WM276
gb|EXK91996.1|  glucose-fructose oxidoreductase                       90.5    1e-16    Fusarium oxysporum f. sp. raphani 54005
gb|KIR59526.1|  NAD-binding Rossmann fold oxidoreductase              90.5    1e-16    Cryptococcus gattii CA1873
gb|EIT80267.1|  putative dehydrogenase                                90.1    2e-16    Aspergillus oryzae 3.042
gb|KIR46389.1|  NAD-binding Rossmann fold oxidoreductase              90.1    2e-16    Cryptococcus gattii CA1280
gb|KIS02481.1|  NAD-binding Rossmann fold oxidoreductase              90.1    2e-16    Cryptococcus gattii VGII 2001/935-1
gb|KIR26739.1|  NAD-binding Rossmann fold oxidoreductase              90.1    2e-16    Cryptococcus gattii VGII LA55
gb|KIR85165.1|  NAD-binding Rossmann fold oxidoreductase              90.1    2e-16    Cryptococcus gattii VGIV IND107
ref|XP_568129.1|  hypothetical protein                                89.7    2e-16    Cryptococcus neoformans var. neoformans JEC21
ref|XP_001261103.1|  hypothetical protein NFIA_091650                 89.7    3e-16    Aspergillus fischeri NRRL 181
gb|EGU88150.1|  hypothetical protein FOXB_01288                       92.0    3e-16    Fusarium oxysporum Fo5176
emb|CCX08562.1|  Similar to Putative uracil phosphoribosyltransfe...  91.3    4e-16    Pyronema omphalodes CBS 100304
ref|XP_002183307.1|  predicted protein                                90.1    4e-16    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007350429.1|  NAD(P)-binding protein                           89.4    4e-16    
ref|XP_002479070.1|  oxidoreductase family, NAD-binding Rossmann ...  89.0    4e-16    Talaromyces stipitatus ATCC 10500
gb|KGB78824.1|  hypothetical protein CNBG_4662                        89.0    5e-16    Cryptococcus gattii VGII R265
ref|XP_007324396.1|  hypothetical protein SERLADRAFT_364213           89.4    5e-16    Serpula lacrymans var. lacrymans S7.9
gb|KIW21209.1|  hypothetical protein PV08_01789                       88.2    7e-16    Exophiala spinifera
emb|CCT69021.1|  related to dehydrogenases and related proteins       87.8    8e-16    Fusarium fujikuroi IMI 58289
ref|XP_007674297.1|  hypothetical protein BAUCODRAFT_22896            88.2    9e-16    Baudoinia panamericana UAMH 10762
ref|XP_006962588.1|  predicted protein                                87.8    1e-15    Trichoderma reesei QM6a
ref|XP_001227364.1|  hypothetical protein CHGG_09437                  89.7    1e-15    Chaetomium globosum CBS 148.51
ref|XP_003660926.1|  oxidoreductase-like protein                      87.8    1e-15    Thermothelomyces thermophila ATCC 42464
gb|ERS96910.1|  hypothetical protein HMPREF1624_06237                 87.8    1e-15    Sporothrix schenckii ATCC 58251
ref|XP_007911759.1|  putative oxidoreductase nad-binding rossmann...  87.4    2e-15    Phaeoacremonium minimum UCRPA7
gb|KIM99483.1|  hypothetical protein OIDMADRAFT_89802                 86.7    2e-15    Oidiodendron maius Zn
ref|XP_012048661.1|  NAD-binding Rossmann fold oxidoreductase         87.0    3e-15    Cryptococcus neoformans var. grubii H99
gb|KIL66602.1|  hypothetical protein M378DRAFT_74962                  86.7    4e-15    Amanita muscaria Koide BX008
gb|KIW33724.1|  hypothetical protein PV07_00552                       85.9    4e-15    Cladophialophora immunda
gb|EMT70613.1|  hypothetical protein FOC4_g10009079                   85.5    5e-15    Fusarium oxysporum f. sp. cubense race 4
gb|ENH74564.1|  hypothetical protein FOC1_g10009984                   85.5    5e-15    Fusarium oxysporum f. sp. cubense race 1
gb|EJU01365.1|  NADP-binding protein                                  86.3    5e-15    Dacryopinax primogenitus
gb|KFA50043.1|  hypothetical protein S40293_06825                     85.9    5e-15    Stachybotrys chartarum IBT 40293
ref|XP_002567221.1|  Pc21g01510                                       85.5    6e-15    Penicillium rubens Wisconsin 54-1255
gb|KEY68231.1|  hypothetical protein S7711_04765                      85.9    6e-15    Stachybotrys chartarum IBT 7711
gb|KFX45295.1|  Uncharacterized protein GQ26_0241310                  85.5    7e-15    Talaromyces marneffei PM1
gb|KFA62356.1|  hypothetical protein S40285_08590                     85.5    8e-15    Stachybotrys chlorohalonata IBT 40285
gb|EHK44528.1|  hypothetical protein TRIATDRAFT_300680                85.5    8e-15    Trichoderma atroviride IMI 206040
ref|XP_007810860.1|  oxidoreductase family, NAD-binding Rossmann ...  85.5    8e-15    Metarhizium acridum CQMa 102
ref|XP_009550993.1|  hypothetical protein HETIRDRAFT_441859           85.5    8e-15    Heterobasidion irregulare TC 32-1
gb|KFA81971.1|  hypothetical protein S40288_04398                     85.5    8e-15    Stachybotrys chartarum IBT 40288
gb|KIW39301.1|  hypothetical protein PV06_09085                       85.1    8e-15    Exophiala oligosperma
ref|XP_001538347.1|  predicted protein                                85.1    9e-15    Histoplasma capsulatum NAm1
gb|KIN06467.1|  hypothetical protein OIDMADRAFT_155638                85.1    9e-15    Oidiodendron maius Zn
gb|KIO22409.1|  hypothetical protein M407DRAFT_245182                 85.1    1e-14    Tulasnella calospora MUT 4182
ref|XP_007824029.2|  oxidoreductase                                   84.7    1e-14    Metarhizium robertsii ARSEF 23
gb|KIW64306.1|  hypothetical protein PV04_09250                       84.7    1e-14    Phialophora americana
ref|XP_008730183.1|  hypothetical protein G647_07648                  84.7    1e-14    Cladophialophora carrionii CBS 160.54
gb|KIN02849.1|  hypothetical protein OIDMADRAFT_40668                 84.7    1e-14    Oidiodendron maius Zn
ref|XP_002150922.1|  oxidoreductase, putative                         84.3    2e-14    Talaromyces marneffei ATCC 18224
gb|KFX97097.1|  hypothetical protein V490_02972                       84.3    2e-14    Pseudogymnoascus sp. VKM F-3557
ref|XP_008716792.1|  hypothetical protein HMPREF1541_04224            84.0    2e-14    Cyphellophora europaea CBS 101466
gb|KID95177.1|  oxidoreductase family, NAD-binding Rossmann fold ...  83.6    3e-14    Metarhizium majus ARSEF 297
ref|XP_007722030.1|  hypothetical protein A1O1_02932                  83.6    3e-14    Capronia coronata CBS 617.96
ref|XP_007760853.1|  hypothetical protein A1O7_08673                  83.6    3e-14    Cladophialophora yegresii CBS 114405
ref|XP_003007531.1|  NAD-binding Rossmann fold oxidoreductase fam...  83.2    4e-14    Verticillium alfalfae VaMs.102
gb|KFY59684.1|  hypothetical protein V497_04131                       83.6    4e-14    Pseudogymnoascus sp. VKM F-4516 (FW-969)
ref|XP_007870707.1|  NAD P-binding protein                            83.6    4e-14    Gloeophyllum trabeum ATCC 11539
ref|XP_007769882.1|  NAD(P)-binding protein                           83.6    5e-14    
gb|KIW64066.1|  hypothetical protein PV04_09025                       83.2    5e-14    
ref|XP_007740232.1|  hypothetical protein A1O5_01425                  82.8    5e-14    
gb|KFY03608.1|  hypothetical protein O988_01367                       83.2    5e-14    
dbj|GAM37326.1|  oxidoreductase                                       82.8    7e-14    
gb|KIJ64897.1|  hypothetical protein HYDPIDRAFT_181650                82.8    8e-14    
ref|XP_001216107.1|  predicted protein                                83.2    1e-13    
gb|KIW86052.1|  hypothetical protein Z517_01446                       81.6    1e-13    
gb|KFY00135.1|  hypothetical protein O988_03504                       81.6    1e-13    
gb|KJZ72495.1|  hypothetical protein HIM_08164                        81.6    2e-13    
ref|XP_009656154.1|  NAD-binding Rossmann fold oxidoreductase fam...  82.0    3e-13    
ref|XP_007794424.1|  putative oxidoreductase nad-binding rossmann...  80.5    3e-13    
gb|KJK76118.1|  hypothetical protein H634G_08524                      80.9    3e-13    
gb|EMD36780.1|  hypothetical protein CERSUDRAFT_155077                80.9    4e-13    
gb|KIW03136.1|  hypothetical protein PV09_05778                       80.1    4e-13    
dbj|GAM42631.1|  oxidoreductase                                       80.1    4e-13    
ref|XP_003715071.1|  NAD-binding Rossmann fold oxidoreductase         79.7    6e-13    
gb|KIP10807.1|  hypothetical protein PHLGIDRAFT_22069                 80.1    6e-13    
gb|KIX08304.1|  hypothetical protein Z518_02960                       79.3    7e-13    
gb|KKA27333.1|  hypothetical protein TD95_002301                      80.1    7e-13    
gb|KIL66581.1|  hypothetical protein M378DRAFT_123742                 79.7    8e-13    
gb|KIW42674.1|  hypothetical protein PV06_06200                       79.0    1e-12    
ref|XP_003650189.1|  hypothetical protein THITE_123357                79.0    1e-12    
gb|KIK67859.1|  hypothetical protein GYMLUDRAFT_36656                 79.3    1e-12    
ref|XP_007733422.1|  hypothetical protein A1O3_05105                  78.6    1e-12    
gb|EFX03707.1|  nuclear migration protein                             79.7    2e-12    
gb|KFY46177.1|  hypothetical protein V495_02629                       77.0    4e-12    
ref|XP_006969500.1|  predicted protein                                76.6    6e-12    
ref|XP_001800467.1|  hypothetical protein SNOG_10185                  76.6    6e-12    
gb|KIV87570.1|  hypothetical protein PV11_03107                       76.6    6e-12    
ref|XP_003047008.1|  hypothetical protein NECHADRAFT_95358            76.6    6e-12    
gb|KID84577.1|  oxidoreductase family, NAD-binding Rossmann fold ...  77.0    7e-12    
gb|KDQ56757.1|  hypothetical protein JAAARDRAFT_70456                 77.0    7e-12    
gb|KIW60300.1|  hypothetical protein PV05_00529                       76.3    9e-12    
gb|KIW87520.1|  hypothetical protein Z519_11843                       75.9    9e-12    
gb|KEZ38713.1|  Oxidoreductase                                        76.3    1e-11    
ref|XP_007267326.1|  NAD-binding protein                              76.3    1e-11    
gb|KDQ32487.1|  hypothetical protein PLEOSDRAFT_1091124               75.9    1e-11    
gb|KEF53140.1|  hypothetical protein A1O9_11048                       75.1    2e-11    
gb|KIM80656.1|  hypothetical protein PILCRDRAFT_822384                75.5    2e-11    
ref|XP_009230177.1|  NAD-binding Rossmann fold oxidoreductase         75.5    2e-11    
ref|XP_003045013.1|  hypothetical protein NECHADRAFT_43861            74.7    2e-11    
ref|XP_003031463.1|  hypothetical protein SCHCODRAFT_77296            75.5    2e-11    
ref|XP_007379545.1|  oxidoreductase family protein                    75.5    3e-11    
gb|EPT01940.1|  hypothetical protein FOMPIDRAFT_1041084               75.1    3e-11    
gb|EMS23348.1|  NAD dependent oxidoreductase                          74.3    5e-11    
emb|CEJ83936.1|  hypothetical protein VHEMI03305                      73.9    5e-11    
gb|KIJ10684.1|  hypothetical protein PAXINDRAFT_172088                73.9    6e-11    
ref|WP_014856858.1|  oxidoreductase domain-containing protein         73.6    6e-11    
gb|EGN93485.1|  hypothetical protein SERLA73DRAFT_189645              73.9    7e-11    
gb|KIK34237.1|  hypothetical protein CY34DRAFT_26897                  73.6    9e-11    
gb|KFX44107.1|  Uncharacterized protein GQ26_0300340                  70.5    1e-10    
ref|XP_007769867.1|  NAD(P)-binding protein                           72.8    1e-10    
ref|XP_007727310.1|  hypothetical protein A1O1_08258                  72.4    2e-10    
ref|XP_007394970.1|  hypothetical protein PHACADRAFT_254723           72.4    2e-10    
ref|XP_009654382.1|  NAD-binding Rossmann fold oxidoreductase fam...  72.0    2e-10    
gb|KDR66469.1|  hypothetical protein GALMADRAFT_259259                71.6    3e-10    
gb|KFX44108.1|  Uncharacterized protein GQ26_0300340                  70.5    4e-10    
emb|CCL99375.1|  predicted protein                                    71.2    5e-10    
gb|KFX46381.1|  Uncharacterized protein GQ26_0191180                  70.1    6e-10    
gb|KIW18212.1|  hypothetical protein PV08_02500                       70.1    9e-10    
ref|XP_008597824.1|  oxidoreductase family protein                    70.5    9e-10    
gb|KDQ61926.1|  hypothetical protein JAAARDRAFT_190638                70.5    1e-09    
gb|KIR46111.1|  NAD-binding Rossmann fold oxidoreductase              70.1    1e-09    
gb|KII91478.1|  hypothetical protein PLICRDRAFT_156577                70.1    1e-09    
gb|KJA21352.1|  hypothetical protein HYPSUDRAFT_42224                 70.1    1e-09    
gb|EYE96563.1|  oxidoreductase family, NAD-binding Rossmann fold ...  69.7    1e-09    
gb|KIJ28562.1|  hypothetical protein M422DRAFT_189558                 69.3    2e-09    
gb|KIY71507.1|  NAD(P)-binding protein                                69.7    2e-09    
gb|KIR51601.1|  NAD-binding Rossmann fold oxidoreductase              69.7    2e-09    
gb|KIR84978.1|  NAD-binding Rossmann fold oxidoreductase              69.3    2e-09    
ref|XP_003194439.1|  hypothetical protein CGB_E5470C                  69.3    2e-09    
gb|EJT52097.1|  hypothetical protein A1Q1_06635                       69.3    2e-09    
ref|XP_002554199.1|  KLTH0E16522p                                     68.6    3e-09    
ref|XP_007303479.1|  NAD-P-binding protein                            68.9    3e-09    
gb|EKD02419.1|  hypothetical protein A1Q2_03311                       68.9    3e-09    
emb|CEP60003.1|  LALA0S01e00804g1_1                                   67.8    5e-09    
ref|XP_002956633.1|  hypothetical protein VOLCADRAFT_119466           67.8    8e-09    
gb|KIJ64973.1|  hypothetical protein HYDPIDRAFT_111692                67.0    1e-08    
gb|KIR99656.1|  NAD-binding Rossmann fold oxidoreductase              67.0    1e-08    
gb|KGB79428.1|  hypothetical protein CNBG_5266                        67.0    1e-08    
gb|KIR28998.1|  NAD-binding Rossmann fold oxidoreductase              67.0    1e-08    
ref|XP_571074.1|  hypothetical protein                                66.6    1e-08    
ref|XP_003004419.1|  NAD-binding Rossmann fold oxidoreductase fam...  66.2    2e-08    
ref|XP_007324516.1|  hypothetical protein SERLADRAFT_480526           66.6    2e-08    
gb|KDN46554.1|  hypothetical protein RSAG8_04207                      67.0    2e-08    
ref|XP_012049956.1|  NAD-binding Rossmann fold oxidoreductase         66.2    2e-08    
ref|WP_041844546.1|  oxidoreductase                                   65.5    2e-08    
ref|XP_001824691.2|  oxidoreductase                                   65.5    3e-08    
ref|YP_001244202.1|  oxidoreductase domain-containing protein         65.1    4e-08    
gb|KIM36263.1|  hypothetical protein M413DRAFT_449312                 65.1    5e-08    
ref|XP_001840594.2|  oxidoreductase family protein                    64.3    8e-08    
ref|WP_038051523.1|  oxidoreductase                                   63.9    1e-07    
ref|XP_007848044.1|  nad-binding rossmann fold oxidoreductase         63.9    1e-07    
ref|WP_011011672.1|  oxidoreductase                                   63.2    2e-07    
gb|KGQ09050.1|  hypothetical protein BBAD15_g5618                     60.8    2e-07    
gb|KDE06246.1|  hypothetical protein MVLG_03405                       63.2    2e-07    
ref|WP_020265263.1|  hypothetical protein                             62.0    4e-07    
ref|WP_011177324.1|  dehydrogenase                                    61.2    6e-07    
ref|XP_001211482.1|  conserved hypothetical protein                   59.7    6e-07    
ref|XP_003678562.1|  hypothetical protein TDEL_0A00190                61.2    8e-07    
ref|WP_038066570.1|  oxidoreductase                                   60.8    9e-07    
gb|ACM22551.1|  Oxidoreductase domain protein                         60.8    9e-07    
emb|CEL59024.1|  putative protein YMR315W OS=Saccharomyces cerevi...  60.8    1e-06    
ref|XP_003674473.1|  hypothetical protein NCAS_0B00110                60.5    1e-06    
ref|WP_011249602.1|  oxidoreductase                                   60.5    1e-06    
ref|WP_038033444.1|  MULTISPECIES: oxidoreductase                     60.5    1e-06    
ref|WP_004102818.1|  oxidoreductase                                   60.1    1e-06    
emb|CCO30564.1|  hypothetical protein BN14_04594                      60.5    2e-06    
gb|EGA72491.1|  hypothetical protein AWRI796_5152                     59.7    2e-06    
emb|CDO93391.1|  unnamed protein product                              58.5    5e-06    
ref|WP_008193664.1|  MULTISPECIES: oxidoreductase                     58.5    6e-06    
ref|WP_012310640.1|  oxidoreductase                                   58.2    6e-06    
ref|WP_010865093.1|  oxidoreductase                                   58.2    6e-06    
ref|WP_004083048.1|  oxidoreductase                                   58.2    6e-06    
ref|XP_011103102.1|  YMR315W                                          58.2    8e-06    
ref|XP_004182195.1|  hypothetical protein TBLA_0I00110                57.8    9e-06    
ref|XP_005716388.1|  unnamed protein product                          57.8    1e-05    
emb|CAE84407.1|  hypothetical protein                                 57.4    1e-05    
ref|NP_014046.1|  hypothetical protein YMR315W                        57.4    1e-05    
ref|WP_033191335.1|  oxidoreductase                                   57.4    1e-05    
ref|XP_453042.1|  hypothetical protein                                57.4    1e-05    
gb|AJS95761.1|  hypothetical protein H823_YJM1447M00470               57.0    2e-05    
gb|EGA73622.1|  YMR315W-like protein                                  57.0    2e-05    
gb|AJS80533.1|  hypothetical protein H788_YJM1248M00474               57.0    2e-05    
gb|AJS70048.1|  hypothetical protein H765_YJM627M00474                57.0    2e-05    
gb|EDN64256.1|  conserved protein                                     56.6    2e-05    
gb|AJS80962.1|  hypothetical protein H789_YJM1250M00464               56.6    2e-05    
ref|WP_012896260.1|  oxidoreductase                                   56.6    2e-05    
ref|XP_003954874.1|  hypothetical protein KAFR_0A03040                56.6    2e-05    
gb|AJP41010.1|  hypothetical protein F842_YJM1078M00474               56.6    2e-05    
dbj|GAA25767.1|  K7_Ymr315wp                                          56.6    2e-05    
ref|XP_002495816.1|  ZYRO0C03674p                                     56.2    3e-05    
pdb|1ZH8|A  Chain A, Crystal Structure Of Oxidoreductase (tm0312)...  55.8    3e-05    
ref|WP_036225443.1|  hypothetical protein                             55.8    4e-05    
ref|WP_029683343.1|  oxidoreductase                                   55.8    4e-05    
ref|XP_007006712.1|  hypothetical protein TREMEDRAFT_33975            55.5    6e-05    
emb|CCK71422.1|  hypothetical protein KNAG_0G03650                    55.1    7e-05    
ref|XP_449954.1|  hypothetical protein                                54.7    8e-05    
gb|EGA60881.1|  YMR315W-like protein                                  54.7    9e-05    
ref|XP_004338924.1|  oxidoreductase family protein                    54.7    1e-04    
gb|EHN00704.1|  YMR315W-like protein                                  54.3    1e-04    
gb|AEY99225.1|  FAGR403Wp                                             54.3    1e-04    
ref|WP_036936424.1|  hypothetical protein                             53.9    1e-04    
ref|NP_987069.1|  AGR403Wp                                            53.9    1e-04    
gb|EJT44973.1|  YMR315W-like protein                                  53.9    2e-04    
gb|AJS63054.1|  hypothetical protein H749_YJM195M00474                53.9    2e-04    
gb|AJS83136.1|  hypothetical protein H794_YJM1311M00474               53.9    2e-04    
dbj|BAO40034.1|  uncharacterized protein YMR315W                      53.5    2e-04    
emb|CAJ75716.1|  predicted dehydrogenases and related proteins        53.1    3e-04    
ref|WP_035064499.1|  dehydrogenase                                    53.1    3e-04    
emb|CAJ75722.1|  predicted dehydrogenases and related proteins        53.1    3e-04    
ref|WP_029956047.1|  hypothetical protein                             52.8    3e-04    
ref|WP_036623282.1|  dehydrogenase                                    53.1    3e-04    
ref|WP_015075613.1|  hypothetical protein                             53.1    3e-04    
ref|WP_010053192.1|  dehydrogenase                                    52.8    4e-04    
ref|XP_003644579.1|  hypothetical protein Ecym_2002                   52.8    4e-04    
ref|WP_010916648.1|  dehydrogenase                                    52.4    4e-04    
ref|XP_011276250.1|  Inositol 2-dehydrogenase/D-chiro-inositol 3-...  52.4    5e-04    
ref|WP_021794418.1|  hypothetical protein                             52.0    6e-04    
gb|EGA57295.1|  YMR315W-like protein                                  51.6    8e-04    
gb|EIF45784.1|  ymr315w-like protein                                  51.6    8e-04    
emb|CDK28400.1|  unnamed protein product                              51.6    8e-04    
gb|AGO10762.1|  AaceriAGR403Wp                                        51.6    8e-04    



>ref|XP_004228627.1| PREDICTED: uncharacterized oxidoreductase C26H5.09c [Solanum 
lycopersicum]
Length=359

 Score =   506 bits (1303),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 282/358 (79%), Positives = 322/358 (90%), Gaps = 1/358 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +QLPQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EES RSAVE+A+ HFPNVECK
Sbjct  2     AQLPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESVRSAVEIAQKHFPNVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG AGLEEIIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPAA  + EAE AL H
Sbjct  62    WGDAGLEEIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPAAPTVDEAEKALTH  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNSLST +TQ+PIWAVAENYRFEPAF E K++I+EIG+MMN+QVI+EG+MNSSNPYF+SS
Sbjct  122   YNSLSTTLTQQPIWAVAENYRFEPAFIEGKRLISEIGEMMNIQVIVEGAMNSSNPYFASS  181

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRR F GGFILDMGVH+VAGLRML+GCE+ S+S+M SHVDKTLPPPDNIS++FQLENGCS
Sbjct  182   WRRQFVGGFILDMGVHFVAGLRMLIGCEIASLSSMNSHVDKTLPPPDNISSMFQLENGCS  241

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS+SPK++WRVVGLNG L+V+RGNKDGKHGYSVSL+M DGQ KSFFYPF GV 
Sbjct  242   GVFVMVVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGYSVSLHMADGQSKSFFYPFSGVT  301

Query  368   EELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             +ELKTFLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKKF
Sbjct  302   DELKTFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKKF  359



>ref|XP_009773348.1| PREDICTED: uncharacterized protein LOC104223588 [Nicotiana sylvestris]
Length=361

 Score =   503 bits (1295),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 286/361 (79%), Positives = 323/361 (89%), Gaps = 1/361 (0%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1     MAQSQVPQIAILGAGIFVKTQYIPRLAEIPHLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG AGLE+IIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPAAA + EAE A
Sbjct  61    ECKWGDAGLEDIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPAAATVDEAETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L HYNSLS  +T +P+WAVAENYRFEPAF E +K+I+EIG+MMN+QVI+EGSMN+SNPYF
Sbjct  121   LTHYNSLSATLTHQPLWAVAENYRFEPAFIEGRKLISEIGEMMNIQVIVEGSMNNSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRR F GGFILDMGVH+VAGLRMLVGCE+ S+SAM SHVDKTLPPPDNIS++FQLEN
Sbjct  181   SSSWRRQFVGGFILDMGVHFVAGLRMLVGCEIASLSAMNSHVDKTLPPPDNISSMFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSS+SPKI+WRVVGLNG L+VERGNKDGKHGYS+ L+M DGQ KSFFYPF 
Sbjct  241   GCSGVFVMVVSSKSPKIIWRVVGLNGVLQVERGNKDGKHGYSIHLHMADGQSKSFFYPFS  300

Query  377   GVQEELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             GV +ELKTFLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKK
Sbjct  301   GVTDELKTFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKK  360

Query  200   F  198
             F
Sbjct  361   F  361



>ref|XP_009588958.1| PREDICTED: uncharacterized protein YMR315W [Nicotiana tomentosiformis]
Length=361

 Score =   503 bits (1295),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 288/361 (80%), Positives = 324/361 (90%), Gaps = 1/361 (0%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA+SQ+PQIAILG+GIFVKTQYIPRLAEI  LFVL+AIWSRSEESARSAVE+AR HFP+V
Sbjct  1     MAQSQVPQIAILGAGIFVKTQYIPRLAEIPDLFVLRAIWSRSEESARSAVEIARKHFPDV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG AGLE+IIKD+SI GVAVV+AGQT V+MSL+LLK GKHVLQEKPAAA + EAE A
Sbjct  61    ECKWGDAGLEDIIKDSSITGVAVVLAGQTMVDMSLKLLKAGKHVLQEKPAAATVDEAETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L HYNSLST +T +PIWAVAENYRFEPAF E KK+I+EIG+MMN+QVI+EGSMNSSNPYF
Sbjct  121   LTHYNSLSTTLTHQPIWAVAENYRFEPAFIEGKKLISEIGEMMNIQVIVEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRR F GGFILDMGVH+VAGLRMLVGCE+ S+SA+ SHVDKTLPPPDNIS++FQLEN
Sbjct  181   SSSWRRQFDGGFILDMGVHFVAGLRMLVGCEIASLSAINSHVDKTLPPPDNISSMFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSS+SPKI+WRVVGLNG L+VERGNKDGKHGYS+ L+M DGQ KSFFYPF 
Sbjct  241   GCSGVFVMVVSSKSPKIIWRVVGLNGVLQVERGNKDGKHGYSIHLHMADGQSKSFFYPFS  300

Query  377   GVQEELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             GV +ELKTFLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKK
Sbjct  301   GVTDELKTFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKK  360

Query  200   F  198
             F
Sbjct  361   F  361



>ref|XP_006348416.1| PREDICTED: uncharacterized protein YMR315W-like [Solanum tuberosum]
Length=359

 Score =   503 bits (1294),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 281/358 (78%), Positives = 322/358 (90%), Gaps = 1/358 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +Q PQIAILG+GIFVKTQYIPRLAEIS LF+L+AIWSR+EESARSAVE+A+ HFPNVECK
Sbjct  2     AQHPQIAILGAGIFVKTQYIPRLAEISNLFILRAIWSRTEESARSAVEIAQKHFPNVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG AGLEEIIKD+SI GVAVV+AGQT V+MSLRLLK GKHVLQEKPA+A + EAE AL H
Sbjct  62    WGDAGLEEIIKDSSITGVAVVLAGQTMVDMSLRLLKAGKHVLQEKPASATVDEAEKALTH  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNSLS  +TQ+PIWAVAENYRFEPAF E K++I+EIG+MMN+Q+I+EG+MNSSNPYF+SS
Sbjct  122   YNSLSATLTQQPIWAVAENYRFEPAFIEGKRLISEIGEMMNIQIIVEGAMNSSNPYFASS  181

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRR F GGFILDMGVH+VAGLRMLVGCE+TS+S+M SHVDKTLPPPDNIS++FQLENGCS
Sbjct  182   WRRQFVGGFILDMGVHFVAGLRMLVGCEITSLSSMNSHVDKTLPPPDNISSMFQLENGCS  241

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS+SPK++WRVVGLNG L+V+RGNKDGKHGYSVSL+M DGQ KSFFYPF GV 
Sbjct  242   GVFVMVVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGYSVSLHMADGQSKSFFYPFSGVT  301

Query  368   EELKTFLSDISLANTKGGECKG-EPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             +ELK FLSD+S AN K       +PRLSF EG RD+AVL+AMLESGKR+GALVQVKKF
Sbjct  302   DELKAFLSDVSTANLKKDHSSHIDPRLSFAEGARDVAVLDAMLESGKRQGALVQVKKF  359



>ref|XP_012092787.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Jatropha 
curcas]
Length=358

 Score =   464 bits (1194),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 268/354 (76%), Positives = 306/354 (86%), Gaps = 0/354 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P +AILG+GIFV+TQY+PRLAEIS LFVLKAIWSR+EESAR AVE+AR HFP VE KWG 
Sbjct  5     PHLAILGAGIFVRTQYLPRLAEISDLFVLKAIWSRTEESAREAVEIARKHFPGVEYKWGD  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII+D SI+GVAVV+AGQ QV++SL+LLK GKHVLQEKPAAA  +E E AL  Y S
Sbjct  65    KGLDEIIQDESILGVAVVLAGQAQVDISLKLLKAGKHVLQEKPAAASASEIETALSSYKS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  N   +PIWAVAENYRFEPAF ECKK++AEIGDMM V+VI+EGSMNS+NPYFSSSWRR
Sbjct  125   IYANSPGQPIWAVAENYRFEPAFVECKKLLAEIGDMMTVEVIVEGSMNSANPYFSSSWRR  184

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRM+VGCEV SVSAMTSHVDKTLPPPDNIS++FQLENGCSGVF
Sbjct  185   NFTGGFILDMGVHFIAGLRMVVGCEVISVSAMTSHVDKTLPPPDNISSVFQLENGCSGVF  244

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKI+WRVVGL GTL+V+RG++DG+HGY VS Y  DG  KS FYPF GV EEL
Sbjct  245   VMVVSSRSPKILWRVVGLKGTLQVDRGSQDGRHGYVVSFYGADGICKSTFYPFSGVTEEL  304

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             KTF+ DIS AN KG   + EPR+SFVEG RD+AVL+AMLESG + GALVQVKKF
Sbjct  305   KTFIHDISQANLKGSSYEAEPRISFVEGARDVAVLDAMLESGMKNGALVQVKKF  358



>emb|CDP14087.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   464 bits (1194),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 275/358 (77%), Positives = 314/358 (88%), Gaps = 1/358 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +QLP IAI+G+GIFVKTQYIPRLAEIS LFVLKAIWSRSEESAR AVE+AR  FP VECK
Sbjct  2     AQLPNIAIIGAGIFVKTQYIPRLAEISNLFVLKAIWSRSEESARGAVEVARKFFPEVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+EIIKD+SIIGVAVV+AGQ QV+MSLRLLK GKHVLQEKPA A I EAE AL  
Sbjct  62    WGDGGLDEIIKDSSIIGVAVVLAGQIQVDMSLRLLKEGKHVLQEKPATASIDEAEAALSS  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y+SL T++  +P+WAVAENYRFEPAF E KK++AE+GD+M++QVIIEGSM SSNPYFSSS
Sbjct  122   YHSLRTHLPFQPVWAVAENYRFEPAFEESKKLMAEVGDVMSIQVIIEGSMTSSNPYFSSS  181

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH+VAGLRMLVGCEV+SVSA+TSHVD TLPPPDNIS+ FQLENGC+
Sbjct  182   WRRNFTGGFILDMGVHFVAGLRMLVGCEVSSVSALTSHVDLTLPPPDNISSTFQLENGCT  241

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF +VVSSRSPKI+WRVVGLNGTL++ERGN+DGKHGY V+LY+ +GQ KSFF+PF GV 
Sbjct  242   GVFVLVVSSRSPKILWRVVGLNGTLQIERGNQDGKHGYLVTLYLANGQNKSFFHPFSGVT  301

Query  368   EELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK FLS+IS A   K    + E RLSFVEG RD+AVL+AMLESGKR+GA VQVK+F
Sbjct  302   EELKAFLSEISQATLKKDSSYEVERRLSFVEGVRDVAVLDAMLESGKRQGAPVQVKRF  359



>ref|XP_002513445.1| oxidoreductase, putative [Ricinus communis]
 gb|EEF48848.1| oxidoreductase, putative [Ricinus communis]
Length=359

 Score =   462 bits (1188),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 275/361 (76%), Positives = 309/361 (86%), Gaps = 3/361 (1%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA S  PQIAILG+GIFV+TQYIPRLAEIS LFVLKA+WSRSEESA+ AVE+AR HFP V
Sbjct  1     MANS--PQIAILGAGIFVRTQYIPRLAEISNLFVLKAVWSRSEESAQGAVEIARKHFPGV  58

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG  GL+EII D SI+ VAVV+AGQTQV+MSL+LLK GKHVLQEKPAAA I+E E A
Sbjct  59    ECKWGDEGLDEIIHDHSILAVAVVLAGQTQVDMSLKLLKAGKHVLQEKPAAASISELEIA  118

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L  Y SL  N   +PIWAVAENYRFEPAF EC+K++AEIGDMM VQVI+EGSMNSSNPYF
Sbjct  119   LSSYKSLCANSPGQPIWAVAENYRFEPAFVECRKLLAEIGDMMTVQVIVEGSMNSSNPYF  178

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRNF GGFILDMGVH++AGLRMLVGCEV SVSAMTSH+DKTLPPPDNIS++F LEN
Sbjct  179   SSSWRRNFTGGFILDMGVHFIAGLRMLVGCEVISVSAMTSHMDKTLPPPDNISSVFHLEN  238

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSSRSPKI WRVVGL GTL++ERG+ DGKHGY VS+   DGQ +S FYPF 
Sbjct  239   GCSGVFVMVVSSRSPKIFWRVVGLKGTLQIERGSHDGKHGYLVSVCGTDGQSRSSFYPFS  298

Query  377   GVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             GV EELKTF+ DIS AN  KG   + EPR+SF+EG RD+A+L+AMLESG + GALVQVKK
Sbjct  299   GVTEELKTFIHDISQANLKKGSSYEVEPRISFMEGARDVAILDAMLESGTKAGALVQVKK  358

Query  200   F  198
             F
Sbjct  359   F  359



>emb|CBI16434.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   461 bits (1185),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 267/355 (75%), Positives = 305/355 (86%), Gaps = 1/355 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5     PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII D+SI GVAVV+AGQ +VEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65    DGLDEIINDSSITGVAVVLAGQMKVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRR
Sbjct  125   ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRR  184

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++FQLENGCSGVF
Sbjct  185   NFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFQLENGCSGVF  244

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVS+R+PKI WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EEL
Sbjct  245   VMVVSTRAPKIFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEEL  304

Query  359   KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             KTF+ DIS A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  305   KTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  359



>ref|XP_002285606.1| PREDICTED: uncharacterized protein LOC100245027 isoform X1 [Vitis 
vinifera]
Length=359

 Score =   460 bits (1184),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 268/355 (75%), Positives = 305/355 (86%), Gaps = 1/355 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5     PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65    DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRR
Sbjct  125   ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRR  184

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++FQLENGCSGVF
Sbjct  185   NFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFQLENGCSGVF  244

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVS+R+PKI WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EEL
Sbjct  245   VMVVSTRAPKIFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEEL  304

Query  359   KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             KTF+ DIS A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  305   KTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  359



>ref|XP_012092785.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Jatropha 
curcas]
 ref|XP_012092786.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Jatropha 
curcas]
 gb|KDP20201.1| hypothetical protein JCGZ_07921 [Jatropha curcas]
Length=359

 Score =   459 bits (1182),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 268/355 (75%), Positives = 306/355 (86%), Gaps = 1/355 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P +AILG+GIFV+TQY+PRLAEIS LFVLKAIWSR+EESAR AVE+AR HFP VE KWG 
Sbjct  5     PHLAILGAGIFVRTQYLPRLAEISDLFVLKAIWSRTEESAREAVEIARKHFPGVEYKWGD  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII+D SI+GVAVV+AGQ QV++SL+LLK GKHVLQEKPAAA  +E E AL  Y S
Sbjct  65    KGLDEIIQDESILGVAVVLAGQAQVDISLKLLKAGKHVLQEKPAAASASEIETALSSYKS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  N   +PIWAVAENYRFEPAF ECKK++AEIGDMM V+VI+EGSMNS+NPYFSSSWRR
Sbjct  125   IYANSPGQPIWAVAENYRFEPAFVECKKLLAEIGDMMTVEVIVEGSMNSANPYFSSSWRR  184

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRM+VGCEV SVSAMTSHVDKTLPPPDNIS++FQLENGCSGVF
Sbjct  185   NFTGGFILDMGVHFIAGLRMVVGCEVISVSAMTSHVDKTLPPPDNISSVFQLENGCSGVF  244

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKI+WRVVGL GTL+V+RG++DG+HGY VS Y  DG  KS FYPF GV EEL
Sbjct  245   VMVVSSRSPKILWRVVGLKGTLQVDRGSQDGRHGYVVSFYGADGICKSTFYPFSGVTEEL  304

Query  359   KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             KTF+ DIS AN  KG   + EPR+SFVEG RD+AVL+AMLESG + GALVQVKKF
Sbjct  305   KTFIHDISQANLKKGSSYEAEPRISFVEGARDVAVLDAMLESGMKNGALVQVKKF  359



>ref|XP_011025252.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Populus 
euphratica]
Length=359

 Score =   459 bits (1180),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 262/357 (73%), Positives = 305/357 (85%), Gaps = 0/357 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3     NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63    WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSS
Sbjct  123   YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCS
Sbjct  183   WRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCS  242

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVFAMVVSS+SPKI+WR+VG+NGT+E+ RGN+DG+HGY++S Y   G  KS FYPF GV 
Sbjct  243   GVFAMVVSSKSPKILWRIVGINGTVEIGRGNQDGQHGYTISFYGAGGHCKSNFYPFSGVT  302

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              ELK FL DIS AN KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  303   AELKAFLHDISQANLKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  359



>ref|XP_011025251.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Populus 
euphratica]
Length=360

 Score =   454 bits (1169),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 262/358 (73%), Positives = 305/358 (85%), Gaps = 1/358 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3     NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63    WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSS
Sbjct  123   YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCS
Sbjct  183   WRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCS  242

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVFAMVVSS+SPKI+WR+VG+NGT+E+ RGN+DG+HGY++S Y   G  KS FYPF GV 
Sbjct  243   GVFAMVVSSKSPKILWRIVGINGTVEIGRGNQDGQHGYTISFYGAGGHCKSNFYPFSGVT  302

Query  368   EELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              ELK FL DIS AN  KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  303   AELKAFLHDISQANLKKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  360



>ref|XP_006386094.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63891.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=359

 Score =   452 bits (1164),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 260/357 (73%), Positives = 303/357 (85%), Gaps = 0/357 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3     NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63    WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSS
Sbjct  123   YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCS
Sbjct  183   WRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCS  242

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVFAMVVSS++PKI+WR+VG+NGT+E+ RGN+ G+HGY +S Y   G  KS FYPF GV 
Sbjct  243   GVFAMVVSSKTPKILWRIVGINGTVEIGRGNQGGQHGYMISFYGAGGHCKSNFYPFSGVT  302

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              ELK FL DIS AN KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  303   AELKAFLHDISQANLKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  359



>ref|XP_006386095.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
 gb|ERP63892.1| hypothetical protein POPTR_0003s22050g [Populus trichocarpa]
Length=360

 Score =   448 bits (1153),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 260/358 (73%), Positives = 303/358 (85%), Gaps = 1/358 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3     NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63    WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSS
Sbjct  123   YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCS
Sbjct  183   WRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCS  242

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVFAMVVSS++PKI+WR+VG+NGT+E+ RGN+ G+HGY +S Y   G  KS FYPF GV 
Sbjct  243   GVFAMVVSSKTPKILWRIVGINGTVEIGRGNQGGQHGYMISFYGAGGHCKSNFYPFSGVT  302

Query  368   EELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              ELK FL DIS AN  KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKKF
Sbjct  303   AELKAFLHDISQANLKKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKKF  360



>ref|XP_008449757.1| PREDICTED: uncharacterized protein YMR315W [Cucumis melo]
Length=355

 Score =   444 bits (1143),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 256/357 (72%), Positives = 303/357 (85%), Gaps = 3/357 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++AR +FP VECK
Sbjct  2     AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARKYFPTVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG AGL++II+D SI+GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA  +E E AL +
Sbjct  62    WGDAGLDDIIQDNSILGVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTSELEYALSN  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNSLS N  ++P+WAVAENYRFEPA  ECK +IA++GDMM+VQVI+EGSMNSSNPYFSSS
Sbjct  122   YNSLSANFLRQPLWAVAENYRFEPALVECKNLIADVGDMMSVQVIVEGSMNSSNPYFSSS  181

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRR+F GGFILDMGVH++AGLRMLVGCEV SVSA TS+VDK+LPPPDNIS+LFQLENGCS
Sbjct  182   WRRDFAGGFILDMGVHFIAGLRMLVGCEVVSVSATTSYVDKSLPPPDNISSLFQLENGCS  241

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS     G  +  F+PF GV 
Sbjct  242   GVFVMVVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSFTDASGLNRCTFHPFSGVT  301

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELKTF+  IS    +G + K + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  302   EELKTFIHAIS---AEGSDDKADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  355



>ref|XP_011080243.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080244.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
 ref|XP_011080245.1| PREDICTED: uncharacterized protein LOC105163544 [Sesamum indicum]
Length=356

 Score =   443 bits (1139),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 264/359 (74%), Positives = 302/359 (84%), Gaps = 5/359 (1%)
 Frame = -2

Query  1271  ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC  1092
             E   PQIAI+G+GIFV+  YIPRLAEIS L VL+AIWSRSEESAR AVE A+  FPNVEC
Sbjct  2     EQTPPQIAIIGAGIFVRNTYIPRLAEISNLLVLRAIWSRSEESARGAVETAKKFFPNVEC  61

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             KWG AGLEEII+D SIIGVAVV+AGQ QV+MSLRLLK GKHVLQEKPAAA   E   A+ 
Sbjct  62    KWGEAGLEEIIQDASIIGVAVVLAGQAQVDMSLRLLKSGKHVLQEKPAAASGTELNAAIS  121

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfss  732
              Y+SL       PIWAVAENYRFEPAF E KK++AEIGD++N+ VIIEGSMNSSNPYFSS
Sbjct  122   SYSSLQP----APIWAVAENYRFEPAFVEGKKLMAEIGDVINIHVIIEGSMNSSNPYFSS  177

Query  731   SWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             SWRR+F GGFILDMGVH+++GLRMLVGCE+TSVSA+TSHVD TLP PD+IS+  QLE+G 
Sbjct  178   SWRRDFVGGFILDMGVHFISGLRMLVGCEITSVSAITSHVDTTLPAPDHISSTIQLEDGS  237

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SGVF MVVSSRSPK++WR+VGL GTL+VERG+KDGKHGY+V L+  DGQ KS+FYPF GV
Sbjct  238   SGVFVMVVSSRSPKVLWRIVGLKGTLQVERGSKDGKHGYTVVLFTADGQNKSWFYPFSGV  297

Query  371   QEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EELKTFLSDIS AN  K G  + EPR+SF+EG RD+AVL+AMLESGKR+G  VQVKKF
Sbjct  298   TEELKTFLSDISQANLKKDGSHQVEPRISFLEGARDVAVLDAMLESGKRQGVAVQVKKF  356



>ref|XP_010031848.1| PREDICTED: uncharacterized protein YMR315W [Eucalyptus grandis]
 gb|KCW51232.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=359

 Score =   443 bits (1139),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 254/354 (72%), Positives = 296/354 (84%), Gaps = 1/354 (0%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
             QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6     QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
             GL+EII+D SI  VAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L
Sbjct  66    GLDEIIRDDSIPAVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRAL  125

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN  717
               +   KPIWAVAENYRFEPAF ECKK++A+IGDMMNVQVI+EGSMNSSNPYFSSSWRRN
Sbjct  126   CASSPSKPIWAVAENYRFEPAFVECKKLLADIGDMMNVQVIVEGSMNSSNPYFSSSWRRN  185

Query  716   FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  537
             F GGFILDMGVH++AGLRMLVGCE+TSVSA T+HVD TLPPPDN+S+ FQLENGCSGVF 
Sbjct  186   FAGGFILDMGVHFIAGLRMLVGCEITSVSATTTHVDLTLPPPDNLSSSFQLENGCSGVFV  245

Query  536   MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  357
             M+VSS+SPKI WRVVGL GTL++ERGN+DG+HGY  +LY  +GQ KS FY F GV +ELK
Sbjct  246   MIVSSKSPKIFWRVVGLKGTLQLERGNQDGRHGYLATLYDANGQSKSTFYSFSGVTDELK  305

Query  356   TFLSDIS-LANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              F++D+S +   K    + EPR SF+EG RD+AVLEAMLESG + G LV V+KF
Sbjct  306   AFINDVSNMTLKKESGYEAEPRCSFLEGARDVAVLEAMLESGYKHGELVSVRKF  359



>gb|ABK96297.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   443 bits (1139),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 260/361 (72%), Positives = 303/361 (84%), Gaps = 4/361 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +QLPQI++LG+GIFVKTQYIPRLAEIS LFVLK+IWSRSEESAR AVE+A+ HFP VECK
Sbjct  3     NQLPQISVLGAGIFVKTQYIPRLAEISHLFVLKSIWSRSEESAREAVEVAKEHFPGVECK  62

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+EII+D SI+GVAVV+A Q QV+MSL+LLK GKHVLQEKPAA+ I+E E +L  
Sbjct  63    WGDKGLDEIIQDESILGVAVVLAAQYQVDMSLKLLKAGKHVLQEKPAASSISEIETSLSS  122

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+  N    PIWAVAENYRFEPA  E KK++A+IG MM+VQ+IIE SMNS+NPYFSSS
Sbjct  123   YKSICANSPGYPIWAVAENYRFEPALVESKKLLADIGKMMSVQLIIEASMNSANPYFSSS  182

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRN+ GGFILDMGVH++AGLRMLVGCEVTSVSAMTSHVD TLPPPDNIS++F LENGCS
Sbjct  183   WRRNYTGGFILDMGVHFIAGLRMLVGCEVTSVSAMTSHVDTTLPPPDNISSVFHLENGCS  242

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGY---SVSLYMGDGQIKSFFYPFC  378
             GVFAMVVSS++PKI+WR+VG+NGT+E+ RGN+ G+HGY    +S Y   G  KS FYPF 
Sbjct  243   GVFAMVVSSKTPKILWRIVGINGTVEIGRGNQGGQHGYMPWQISFYGAGGHCKSNFYPFS  302

Query  377   GVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             GV  ELK FL DIS AN  KG   + EPRLSF+EG RD+AVL+AMLESG + GALVQVKK
Sbjct  303   GVTAELKAFLHDISQANLKKGSSYEVEPRLSFIEGARDVAVLDAMLESGNKNGALVQVKK  362

Query  200   F  198
             F
Sbjct  363   F  363



>ref|XP_008243595.1| PREDICTED: uncharacterized protein YMR315W [Prunus mume]
Length=360

 Score =   441 bits (1135),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 258/357 (72%), Positives = 303/357 (85%), Gaps = 1/357 (0%)
 Frame = -2

Query  1265  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW  1086
             ++PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3     EVPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQEHFPGVECKW  62

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             G  GL+EII+D+SI+GVAVV+AGQ QV+ SLRLLK GKHVLQEKPAAA  +E E AL  Y
Sbjct  63    GDKGLQEIIEDSSILGVAVVLAGQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSY  122

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
              S+  N+  KPIWAVAENYRFEPAF E KK++ +IGD+M++QVI+EGSMNSSNPYFSSSW
Sbjct  123   RSIFANIPDKPIWAVAENYRFEPAFVEGKKLVNDIGDVMSIQVIVEGSMNSSNPYFSSSW  182

Query  725   RRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             RRNF GGFILDMGVH+VAGLRML GCE+ SVSA+TSHVDKTLP PDN+S+LFQLENGCSG
Sbjct  183   RRNFTGGFILDMGVHFVAGLRMLAGCELVSVSAITSHVDKTLPAPDNVSSLFQLENGCSG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  366
             VF MVVSSRSPKIVWR VGL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV E
Sbjct  243   VFVMVVSSRSPKIVWRFVGLKGTLQIERGNQDGRHGYLVLFYGSDGQSKSSFYQFSGVDE  302

Query  365   ELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             E K F++DIS AN  KG   + EPR+SF+EG RD+AVLEAMLESG ++GA V VKK+
Sbjct  303   EFKAFINDISQANLRKGNGYEAEPRMSFLEGARDVAVLEAMLESGGKQGAPVHVKKY  359



>ref|XP_006494722.1| PREDICTED: uncharacterized protein YMR315W-like [Citrus sinensis]
 gb|KDO64912.1| hypothetical protein CISIN_1g018445mg [Citrus sinensis]
Length=355

 Score =   441 bits (1134),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 265/354 (75%), Positives = 301/354 (85%), Gaps = 1/354 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3     PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GKHV+QEKPAAA I+E ENAL  YNS
Sbjct  63    NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKHVIQEKPAAANISEIENALSRYNS  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRR
Sbjct  123   ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRR  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRM+ GCEV SVSA+TSH+DKTLPPPDNIS+ FQLENGCSGVF
Sbjct  183   NFTGGFILDMGVHFIAGLRMITGCEVVSVSAITSHIDKTLPPPDNISSNFQLENGCSGVF  242

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKI WRVVG+ GTL+VERGN+DG+HGY V+ Y  DGQ KS FYPF GV EEL
Sbjct  243   VMVVSSRSPKIFWRVVGMKGTLQVERGNQDGRHGYLVTQYGADGQSKSMFYPFSGVTEEL  302

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F+ DIS A  KG     EPR SF+EG RD+A+LEAMLESG ++GALV VKKF
Sbjct  303   KAFIHDISEAK-KGINHVPEPRSSFLEGARDVALLEAMLESGSKQGALVHVKKF  355



>ref|XP_009364727.1| PREDICTED: uncharacterized protein LOC103954617 [Pyrus x bretschneideri]
Length=357

 Score =   439 bits (1130),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 260/355 (73%), Positives = 296/355 (83%), Gaps = 1/355 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3     PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLEEII D+SI+GVAVV+AGQ QV+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S
Sbjct  63    KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKS  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR
Sbjct  123   IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRR  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             +F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF
Sbjct  183   DFTGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVF  242

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV EE 
Sbjct  243   VMVVSSRSPKIVWRFSGLKGTLQIERGNQDGRHGYVVLFYGSDGQSKSSFYQFSGVDEEF  302

Query  359   KTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             + F  DIS A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  303   RAFFYDISQATLKKGTSYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  357



>ref|XP_009364714.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
 ref|XP_009364715.1| PREDICTED: uncharacterized protein LOC103954601 [Pyrus x bretschneideri]
Length=357

 Score =   439 bits (1130),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 260/355 (73%), Positives = 295/355 (83%), Gaps = 1/355 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3     PQIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLEEII D+SI+GVAVV+AGQ QV+ SLR+LKGGKHVLQEKPAAA  +E E AL  Y S
Sbjct  63    KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKGGKHVLQEKPAAASTSELETALSSYKS  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  N   KPIWAVAENYRFEP F E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR
Sbjct  123   IVDNAPDKPIWAVAENYRFEPTFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRR  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             +F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF
Sbjct  183   DFTGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVF  242

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV EE 
Sbjct  243   VMVVSSRSPKIVWRFSGLKGTLQIERGNQDGRHGYVVLFYGSDGQSKSSFYQFSGVDEEF  302

Query  359   KTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F  DIS A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  303   KAFFDDISQATLKKGTIYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  357



>ref|XP_006445974.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59214.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=355

 Score =   438 bits (1127),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 264/354 (75%), Positives = 300/354 (85%), Gaps = 1/354 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3     PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63    NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRR
Sbjct  123   ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRR  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRM+ GCEV SVSA+TSH+DKTLPPPDNIS+ FQLENGCSGVF
Sbjct  183   NFTGGFILDMGVHFIAGLRMITGCEVVSVSAITSHIDKTLPPPDNISSNFQLENGCSGVF  242

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKI WRVVG+ GTL+VERGN+DG+HGY V+ Y  DGQ KS FYPF GV EEL
Sbjct  243   VMVVSSRSPKIFWRVVGMKGTLQVERGNQDGRHGYLVTQYGADGQSKSMFYPFSGVTEEL  302

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F+ DIS A  KG     EPR SF+EG RD+A+LEAMLESG ++GALV VKKF
Sbjct  303   KAFIHDISEAK-KGINHVPEPRSSFLEGARDVALLEAMLESGSKQGALVHVKKF  355



>ref|XP_011461910.1| PREDICTED: uncharacterized protein YMR315W [Fragaria vesca subsp. 
vesca]
Length=359

 Score =   436 bits (1122),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 263/361 (73%), Positives = 298/361 (83%), Gaps = 3/361 (1%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MAE+  PQIAI G+G FVKTQYIPRLAEIS L  LKAIWSRSEESAR AVE+AR HFP V
Sbjct  1     MAEA--PQIAICGAGTFVKTQYIPRLAEISNLVNLKAIWSRSEESARGAVEIARKHFPGV  58

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG  GLEEII D+SI+GVAVV+AGQ QV+ SL+LL+ GK+VLQEKPAAA  +E E A
Sbjct  59    ECKWGDQGLEEIIADSSILGVAVVLAGQAQVDFSLKLLRAGKNVLQEKPAAATTSELEIA  118

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L  Y S+  N   KPIWA+AENYRFEPAF E KK++ EIGD+M++QVI+EGSMNSSNPYF
Sbjct  119   LSSYKSIVANTPNKPIWAIAENYRFEPAFVEGKKLMTEIGDVMSIQVIVEGSMNSSNPYF  178

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRNF GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLPPPDNIS+LFQLEN
Sbjct  179   SSSWRRNFNGGFILDMGVHFMAGLRMLAGCEIVSVSATTSHVDKTLPPPDNISSLFQLEN  238

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSG+F MVVSSRSPKIVWR VGL GTLEVERGN+DG+HGY V  Y  DGQ K+ FYPF 
Sbjct  239   GCSGIFVMVVSSRSPKIVWRFVGLKGTLEVERGNQDGRHGYVVIFYSADGQRKTSFYPFS  298

Query  377   GVQEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             GV EE   F++DI  A   KG   + EPR+SF+EG RD+AVLEAMLESG ++GA V VKK
Sbjct  299   GVTEEFIAFINDIKQATLKKGAGYEAEPRMSFLEGARDVAVLEAMLESGGKQGAPVLVKK  358

Query  200   F  198
             F
Sbjct  359   F  359



>ref|XP_009145584.1| PREDICTED: uncharacterized protein YMR315W [Brassica rapa]
Length=355

 Score =   435 bits (1118),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 263/360 (73%), Positives = 300/360 (83%), Gaps = 5/360 (1%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1     MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG  GL EII+D+SI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61    ECKWGDEGLNEIIQDSSILGVAVVIAGQTQVEMSLKMLKVGKHVLQEKPAAASIGEIETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             +  Y ++ST+   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYF
Sbjct  121   MTSYKNISTDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDMMNVQLIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLEN
Sbjct  181   SSSWRRNLDGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF 
Sbjct  241   GCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATVYGEGGTSRTIFYPFS  300

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F +DIS     G   + EPRLS+VEG RD+AVLEAMLESG R GA++ VKKF
Sbjct  301   GVTEELKAFFNDIS-----GASKEQEPRLSYVEGARDVAVLEAMLESGARNGAVIPVKKF  355



>ref|XP_003543553.1| PREDICTED: uncharacterized protein YMR315W [Glycine max]
 gb|KHN30111.1| Hypothetical protein glysoja_010489 [Glycine soja]
Length=360

 Score =   434 bits (1116),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 301/361 (83%), Gaps = 2/361 (1%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1     MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             E KWG  G ++II D SI  VAVV+AGQ QV++SLRLLK GKHVLQEKPAA+C +E E A
Sbjct  61    ETKWGDNGFDDIIHDGSIDAVAVVLAGQNQVDISLRLLKAGKHVLQEKPAASCTSELEAA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L  Y S+S++   + IW+VAENYRFEP   ECKK+IA IG MM+VQVIIEGSMNSSNPYF
Sbjct  121   LSSYKSISSDAPGQLIWSVAENYRFEPGLVECKKLIAGIGKMMSVQVIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD TLPPPDNIS++F LEN
Sbjct  181   SSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLTLPPPDNISSVFHLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSSRSPK +WRVVGLNGTL+VERG + G+HGY VS Y  DGQ KS F+PF 
Sbjct  241   GCSGVFVMVVSSRSPKTLWRVVGLNGTLQVERGFQ-GQHGYLVSFYGTDGQNKSSFFPFS  299

Query  377   GVQEELKTFLSDIS-LANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             GV EELK F++D+S +   K  +   EPRLS+VEG RD+AVLEAMLESG R+G LV++KK
Sbjct  300   GVTEELKAFINDVSEITLKKRNQFVTEPRLSYVEGARDVAVLEAMLESGARQGELVRLKK  359

Query  200   F  198
             F
Sbjct  360   F  360



>gb|KFK39395.1| hypothetical protein AALP_AA3G239500 [Arabis alpina]
Length=356

 Score =   434 bits (1115),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 261/357 (73%), Positives = 298/357 (83%), Gaps = 5/357 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             S  P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESAR AVE+AR HFP V+CK
Sbjct  5     SSPPGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESARGAVEIARKHFPEVKCK  64

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL EII+D+SI+GVAVVVAG +QVEMSLR+LK GKHVLQEKPAAA I+E E A+  
Sbjct  65    WGDEGLNEIIQDSSIVGVAVVVAGHSQVEMSLRMLKAGKHVLQEKPAAASISEIETAMSS  124

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y ++S + T+ PIWAVAENYRFEPAF E KK+I EIGDMMNVQ+IIEGSMNSSNPYFSSS
Sbjct  125   YKNISADSTRCPIWAVAENYRFEPAFVELKKLIGEIGDMMNVQLIIEGSMNSSNPYFSSS  184

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRN  GGFILDMGVHY+AGLRMLVGCE+TSVSA TSHVDKTLP PDNI++ FQLENGCS
Sbjct  185   WRRNLGGGFILDMGVHYIAGLRMLVGCEITSVSATTSHVDKTLPAPDNITSNFQLENGCS  244

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPFCGV 
Sbjct  245   GVFVMVVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATVYEEGGTSRTIFYPFCGVT  304

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG R  A+V V KF
Sbjct  305   EELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGARNRAVVPVAKF  356



>ref|XP_008358862.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
 ref|XP_008358863.1| PREDICTED: uncharacterized protein YMR315W-like isoform X1 [Malus 
domestica]
Length=357

 Score =   433 bits (1114),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 256/355 (72%), Positives = 294/355 (83%), Gaps = 1/355 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3     PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLEEII D+SI+GVAVV+AGQ QV+ SLR+LK GKHVLQEKPAAA  +E E AL  Y S
Sbjct  63    KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKAGKHVLQEKPAAASTSELETALSSYKS  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR
Sbjct  123   IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRR  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             +F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF
Sbjct  183   DFAGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVF  242

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ  S FY F GV EE 
Sbjct  243   VMVVSSRSPKIVWRFSGLKGTLQIERGNQDGQHGYVVLFYGSDGQSTSSFYQFSGVDEEF  302

Query  359   KTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             + F +DI+ A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  303   RAFFNDITQATLKKGTSYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  357



>ref|XP_011653574.1| PREDICTED: uncharacterized protein LOC101204258 [Cucumis sativus]
Length=355

 Score =   432 bits (1111),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 251/357 (70%), Positives = 300/357 (84%), Gaps = 3/357 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2     AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQEKPAAA  +E E AL +
Sbjct  62    WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQEKPAAASTSELEYALSN  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y SLS N +++ +WAVAENYRFEPAF ECK +IA++GDMM+VQVI+EGSMNSSNPYFSSS
Sbjct  122   YKSLSANFSRQRLWAVAENYRFEPAFVECKNLIADVGDMMSVQVIVEGSMNSSNPYFSSS  181

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WR     GFILDMG+H++AGLRMLVGCEV  VSA TS+VDK+LPPPDNIS+LFQLENGCS
Sbjct  182   WRXXXXXGFILDMGIHFIAGLRMLVGCEVVLVSATTSYVDKSLPPPDNISSLFQLENGCS  241

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS+SPKI WRVVGL GTL++ERGN+DGKHGY VS     G  +  FYPF GV 
Sbjct  242   GVFVMVVSSKSPKIFWRVVGLKGTLQIERGNQDGKHGYLVSFTDASGLNRCTFYPFSGVT  301

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELKTF+  IS    +G + K + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  302   EELKTFIHAIS---AEGSDDKADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  355



>ref|XP_010257400.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010257401.1| PREDICTED: uncharacterized protein LOC104597515 isoform X3 [Nelumbo 
nucifera]
Length=359

 Score =   431 bits (1107),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 252/358 (70%), Positives = 302/358 (84%), Gaps = 1/358 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  2     TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQEKPAAA ++EA++AL  
Sbjct  62    WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSC  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EGSMNSSNPYFSSS
Sbjct  122   YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSS  181

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD TLPPPDNI +LFQLENGCS
Sbjct  182   WRRNFTGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTTLPPPDNICSLFQLENGCS  241

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF M VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS Y  DG+ +S FYPF GV 
Sbjct  242   GVFVMAVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSFYTADGRCESSFYPFSGVN  301

Query  368   EELKTFLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  +  K  G  + EPR SF+EG RD+AVLEAMLESG ++GA V VK+F
Sbjct  302   EELKAFVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAMLESGMKQGAQVTVKRF  359



>ref|XP_006406349.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
 gb|ESQ47802.1| hypothetical protein EUTSA_v10021019mg [Eutrema salsugineum]
Length=356

 Score =   431 bits (1107),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 258/360 (72%), Positives = 296/360 (82%), Gaps = 4/360 (1%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             M     P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1     MTNPSPPAIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEVARKHFPEV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             +CKWG  GL EII+D+SI+GVAVVVAGQ QVEMSL++LK GKHVLQEKPAAA I+E E A
Sbjct  61    KCKWGDEGLNEIIQDSSIVGVAVVVAGQNQVEMSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             +  Y ++  +   +PIWAVAENYRFEPAF E KK++AE GDMMNVQ+IIEGSMNSSNPYF
Sbjct  121   ISSYRNIPADSPSRPIWAVAENYRFEPAFVELKKLVAETGDMMNVQLIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLEN
Sbjct  181   SSSWRRNLGGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSSRSPKI+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF 
Sbjct  241   GCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATIYGEGGTSRTIFYPFS  300

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F SDIS    +  + + EPRLS+VEG  D+AVLEAMLESG R GA+V V KF
Sbjct  301   GVTEELKAFFSDIS----ETSKNEQEPRLSYVEGAHDVAVLEAMLESGARNGAVVPVTKF  356



>ref|XP_010257398.1| PREDICTED: uncharacterized protein LOC104597515 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 252/358 (70%), Positives = 302/358 (84%), Gaps = 1/358 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25    TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQEKPAAA ++EA++AL  
Sbjct  85    WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQEKPAAASVSEAKSALSC  144

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EGSMNSSNPYFSSS
Sbjct  145   YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSS  204

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD TLPPPDNI +LFQLENGCS
Sbjct  205   WRRNFTGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTTLPPPDNICSLFQLENGCS  264

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF M VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS Y  DG+ +S FYPF GV 
Sbjct  265   GVFVMAVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSFYTADGRCESSFYPFSGVN  324

Query  368   EELKTFLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  +  K  G  + EPR SF+EG RD+AVLEAMLESG ++GA V VK+F
Sbjct  325   EELKAFVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAMLESGMKQGAQVTVKRF  382



>ref|XP_008358864.1| PREDICTED: uncharacterized protein YMR315W-like isoform X2 [Malus 
domestica]
Length=351

 Score =   428 bits (1101),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 247/355 (70%), Positives = 284/355 (80%), Gaps = 7/355 (2%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P IAILG+G FVKTQYIPRL+EIS L VLKAIWSR+EESARSAVE+AR HFP VECKWG 
Sbjct  3     PHIAILGAGTFVKTQYIPRLSEISNLLVLKAIWSRTEESARSAVEIARKHFPGVECKWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLEEII D+SI+GVAVV+AGQ QV+ SLR+LK GKHVLQ              L  Y S
Sbjct  63    KGLEEIIADSSILGVAVVLAGQAQVDFSLRMLKAGKHVLQATSELETA------LSSYKS  116

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  N   KPIWAVAENYRFEPAF E +K++ E+GD+M++QVI+EGSMNSSNPYFSSSWRR
Sbjct  117   IVDNAPDKPIWAVAENYRFEPAFVEGRKLMTEVGDVMSIQVIVEGSMNSSNPYFSSSWRR  176

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             +F GGFILDMGVH++AGLRML GCE+ SVSA TSHVDKTLP PD+IS+LFQLENGCSGVF
Sbjct  177   DFAGGFILDMGVHFIAGLRMLAGCELVSVSATTSHVDKTLPAPDSISSLFQLENGCSGVF  236

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKIVWR  GL GTL++ERGN+DG+HGY V  Y  DGQ  S FY F GV EE 
Sbjct  237   VMVVSSRSPKIVWRFSGLKGTLQIERGNQDGQHGYVVLFYGSDGQSTSSFYQFSGVDEEF  296

Query  359   KTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             + F +DI+ A  K G   + EPR+SF+EG RD+AVLEAMLESG ++GA VQVKKF
Sbjct  297   RAFFNDITQATLKKGTSYEAEPRMSFLEGARDVAVLEAMLESGTKQGAPVQVKKF  351



>ref|XP_007150403.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
 gb|ESW22397.1| hypothetical protein PHAVU_005G150400g [Phaseolus vulgaris]
Length=383

 Score =   429 bits (1104),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 258/359 (72%), Positives = 300/359 (84%), Gaps = 4/359 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +++PQIAILG+GIFVK+QYIPRL+EIS LF LKAIWSRS+ESA +AVE+AR HFP VECK
Sbjct  27    TKVPQIAILGAGIFVKSQYIPRLSEISHLFHLKAIWSRSQESATAAVEVARKHFPGVECK  86

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GLE+II+D SI  VAVV+A Q QV++SLR+LK GKHVLQEKPAA+C +E E AL  
Sbjct  87    WGDCGLEDIIQDGSIDAVAVVLAVQNQVDISLRVLKAGKHVLQEKPAASCTSELETALSS  146

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+S +   + IW+VAENYRFE    ECKK+I  IG MM+VQVIIEGSMNSSNPYFSS+
Sbjct  147   YRSISADAPSQLIWSVAENYRFESGLLECKKLIGGIGKMMSVQVIIEGSMNSSNPYFSSN  206

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRR F GGFI+DMGVHY+AGLRMLVGCEV SVSAMTSHVD TLPPPDNIS++F LENGCS
Sbjct  207   WRRKFTGGFIVDMGVHYIAGLRMLVGCEVVSVSAMTSHVDLTLPPPDNISSVFHLENGCS  266

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSSR+PK +WRVVGLNGTL+VERG + G+HGY VSLY  DGQ +S F+PF GV 
Sbjct  267   GVFVMVVSSRTPKTLWRVVGLNGTLQVERGFQ-GEHGYLVSLYGADGQNQSSFFPFGGVT  325

Query  368   EELKTFLSDISLANT--KGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F++D+S  NT  KG +   EPRLSFVEG RD+AVLEAMLESG ++G LVQVKKF
Sbjct  326   EELKAFINDVS-ENTLKKGSQFVPEPRLSFVEGARDVAVLEAMLESGAKQGELVQVKKF  383



>ref|XP_010091995.1| Uncharacterized protein L484_007981 [Morus notabilis]
 gb|EXB48401.1| Uncharacterized protein L484_007981 [Morus notabilis]
Length=352

 Score =   427 bits (1098),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 257/357 (72%), Positives = 291/357 (82%), Gaps = 6/357 (2%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             ++ PQIAI+G+GIFV+TQYIPRL+EIS L  LKAIWSRSEESAR AVE+A+  FP VECK
Sbjct  2     AKAPQIAIVGAGIFVRTQYIPRLSEISDLVSLKAIWSRSEESARGAVEIAQKFFPGVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  G +EI++D SI+GVAVV+AGQ QV+ SLRLLK GKHVLQ              L  
Sbjct  62    WGDKGFDEIVQDNSILGVAVVLAGQAQVDFSLRLLKAGKHVLQATSELEAA------LAG  115

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNS+S N+  KPIWAVAENYRFEPAF E KK++AE+GDMM+VQVIIEGSMNSSNPYFSSS
Sbjct  116   YNSISVNVPSKPIWAVAENYRFEPAFVESKKLVAEVGDMMSVQVIIEGSMNSSNPYFSSS  175

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH+VAG+RMLVG EV SVSA TSHVDKTLPPPDNIS+LFQLENGCS
Sbjct  176   WRRNFSGGFILDMGVHFVAGMRMLVGSEVVSVSAATSHVDKTLPPPDNISSLFQLENGCS  235

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF +VVSS SPKI+WRVVGL GTL+VERG  DG+HGY VS Y  DGQ KS FY F GV 
Sbjct  236   GVFVVVVSSSSPKILWRVVGLKGTLQVERGKHDGQHGYLVSFYGADGQSKSTFYRFSGVT  295

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EE K+F+ DIS A+ KGG    EPR+SFVEG RD+AVLEAMLESG ++GA V VKKF
Sbjct  296   EEFKSFIHDISQASVKGGVHVAEPRMSFVEGARDVAVLEAMLESGAKQGAPVHVKKF  352



>ref|XP_006298014.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
 gb|EOA30912.1| hypothetical protein CARUB_v10014059mg [Capsella rubella]
Length=355

 Score =   426 bits (1095),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 255/354 (72%), Positives = 296/354 (84%), Gaps = 4/354 (1%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6     PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL EI++D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A++ Y  
Sbjct  66    EGLNEIMEDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIEAAMLSYRI  125

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +S +   +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEGSMNSSNPYFSSSWRR
Sbjct  126   ISADTPCRPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYFSSSWRR  185

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             N  GGFILDMGVHY+AGLRMLVGCEV SVSA TSHVDKTLP PDNI++ FQLENGCSGVF
Sbjct  186   NLSGGFILDMGVHYIAGLRMLVGCEVASVSASTSHVDKTLPGPDNITSNFQLENGCSGVF  245

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EEL
Sbjct  246   VMVVSSRSPKILWRVVGLKGTVQLERGVEGGRHGYMTTIYGEGGTTRTIFYPFSGVTEEL  305

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F +DIS  + K    + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  306   KAFFNDISDTSKK----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVPKF  355



>ref|XP_010488066.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=355

 Score =   426 bits (1095),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 255/360 (71%), Positives = 296/360 (82%), Gaps = 5/360 (1%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             M     P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V
Sbjct  1     MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             +CKWG  GL EII D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A
Sbjct  61    KCKWGDEGLNEIIADSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             +  Y ++S +   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYF
Sbjct  121   MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLVVEIGDMMNVQLIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRN  GGFILDMGVH++AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLEN
Sbjct  181   SSSWRRNLSGGFILDMGVHFIAGLRMLVGCEVTSVSAATSHVDKTLPGPDNITSNFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++Y G G  ++ FYPF 
Sbjct  241   GCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVEGGRHGYMATIYGGGGTSRTIFYPFS  300

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  301   GVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVTKF  355



>gb|KJB66097.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=357

 Score =   426 bits (1094),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 264/357 (74%), Positives = 300/357 (84%), Gaps = 1/357 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2     ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62    WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSS
Sbjct  122   YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  180

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCS
Sbjct  181   WRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCS  240

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV 
Sbjct  241   GVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVH  300

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  AN KG   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  301   EELKIFIHDIVQANLKGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  357



>ref|XP_010544236.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Tarenaya 
hassleriana]
Length=355

 Score =   425 bits (1093),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 248/354 (70%), Positives = 297/354 (84%), Gaps = 4/354 (1%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6     PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII+D SI+GV VV+AGQ QVEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66    EGLDEIIRDNSIVGVGVVLAGQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKN  125

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +ST      IWAVAENYRFEPAF E KK++ EIG MMNVQ+I+EGSMNSSNPYFSSSWRR
Sbjct  126   ISTGSPSPSIWAVAENYRFEPAFVELKKLVGEIGTMMNVQLIVEGSMNSSNPYFSSSWRR  185

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             N  GGFILDMGVHY+AGLRMLVGCEVTSVSA T+HVD +LP PDNI++ FQLENGCSGVF
Sbjct  186   NLGGGFILDMGVHYIAGLRMLVGCEVTSVSATTTHVDTSLPAPDNITSNFQLENGCSGVF  245

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSS+SPKI+WRVVGL GT+++ERG ++G+HGY  ++Y   G+ ++ FYPF GV EEL
Sbjct  246   VMVVSSKSPKILWRVVGLKGTVQLERGMQEGRHGYLATVYSDRGETRTIFYPFSGVTEEL  305

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F  D+S A+      +GEPRLS++EG RD+AVLEAMLESG ++GALV VK+F
Sbjct  306   KAFFHDVSQASA----SEGEPRLSYLEGARDVAVLEAMLESGAKDGALVPVKRF  355



>ref|XP_010257399.1| PREDICTED: uncharacterized protein LOC104597515 isoform X2 [Nelumbo 
nucifera]
Length=376

 Score =   426 bits (1095),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 244/358 (68%), Positives = 290/358 (81%), Gaps = 7/358 (2%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             +Q P IA+LG+GIFV+TQYIPRL EI+   V+K+IWSR+E+SAR+AVELAR  FPN+ECK
Sbjct  25    TQQPHIAVLGAGIFVRTQYIPRLREIADTVVVKSIWSRTEKSARAAVELAREFFPNIECK  84

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL+ II+D+S+ GVAVV+AGQTQV++SLRLL+ GKHVLQ    A         L  
Sbjct  85    WGDEGLDAIIQDSSLHGVAVVLAGQTQVDISLRLLRAGKHVLQAVSEAKSA------LSC  138

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNSL  N  ++P+WAVAENYRFEPAF ECKK++ +IG+MM VQVI+EGSMNSSNPYFSSS
Sbjct  139   YNSLCANYPRQPLWAVAENYRFEPAFVECKKLMNDIGEMMCVQVIVEGSMNSSNPYFSSS  198

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRM+VGCEVT+VSA+TSHVD TLPPPDNI +LFQLENGCS
Sbjct  199   WRRNFTGGFILDMGVHFIAGLRMIVGCEVTTVSAITSHVDTTLPPPDNICSLFQLENGCS  258

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF M VS+RSPKI W VVG  GTL++ERGNKDG HGYSVS Y  DG+ +S FYPF GV 
Sbjct  259   GVFVMAVSTRSPKIFWHVVGSRGTLQIERGNKDGLHGYSVSFYTADGRCESSFYPFSGVN  318

Query  368   EELKTFLSDISLANTK-GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  +  K  G  + EPR SF+EG RD+AVLEAMLESG ++GA V VK+F
Sbjct  319   EELKAFVHDIGQSLFKEDGNXEAEPRSSFIEGARDVAVLEAMLESGMKQGAQVTVKRF  376



>ref|XP_010544235.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Tarenaya 
hassleriana]
Length=356

 Score =   425 bits (1092),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 248/354 (70%), Positives = 297/354 (84%), Gaps = 3/354 (1%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P +AILG+GIFV+TQYIPRLAEIS LFVL+AIWSR+EESA+ AVE+AR HFP+VECKWG 
Sbjct  6     PGLAILGAGIFVRTQYIPRLAEISDLFVLRAIWSRTEESAKGAVEIARKHFPDVECKWGE  65

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII+D SI+GV VV+AGQ QVEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66    EGLDEIIRDNSIVGVGVVLAGQIQVEMSLKMLKAGKHVLQEKPAAASISEIETAISSYKN  125

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +ST      IWAVAENYRFEPAF E KK++ EIG MMNVQ+I+EGSMNSSNPYFSSSWRR
Sbjct  126   ISTGSPSPSIWAVAENYRFEPAFVELKKLVGEIGTMMNVQLIVEGSMNSSNPYFSSSWRR  185

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             N  GGFILDMGVHY+AGLRMLVGCEVTSVSA T+HVD +LP PDNI++ FQLENGCSGVF
Sbjct  186   NLGGGFILDMGVHYIAGLRMLVGCEVTSVSATTTHVDTSLPAPDNITSNFQLENGCSGVF  245

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSS+SPKI+WRVVGL GT+++ERG ++G+HGY  ++Y   G+ ++ FYPF GV EEL
Sbjct  246   VMVVSSKSPKILWRVVGLKGTVQLERGMQEGRHGYLATVYSDRGETRTIFYPFSGVTEEL  305

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F  D+S A+      +GEPRLS++EG RD+AVLEAMLESG ++GALV VK+F
Sbjct  306   KAFFHDVSQASAS---QEGEPRLSYLEGARDVAVLEAMLESGAKDGALVPVKRF  356



>gb|AFK46300.1| unknown [Lotus japonicus]
Length=359

 Score =   424 bits (1090),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 253/359 (70%), Positives = 300/359 (84%), Gaps = 2/359 (1%)
 Frame = -2

Query  1271  ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC  1092
             E++ P+IAILG+G FVK+QY+PRL+EIS LF+LKAIWSR++ESARSAVE+A  +F  VEC
Sbjct  2     ETKRPEIAILGAGTFVKSQYLPRLSEISHLFILKAIWSRTQESARSAVEIAHRNFAGVEC  61

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             KWG  GL++II D SI  VAVV+AGQ QVE+SLR+LK GKH+LQEKPAA+CI+E E AL 
Sbjct  62    KWGDDGLDDIIHDGSITAVAVVLAGQNQVEISLRMLKAGKHILQEKPAASCISELETALS  121

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfss  732
             +Y S+  +  ++ +W+VAENYRFEPA  ECKK+IA+IG MM+VQVIIEGSMNSSNPYFSS
Sbjct  122   NYKSICADAPRQLVWSVAENYRFEPALVECKKLIADIGKMMSVQVIIEGSMNSSNPYFSS  181

Query  731   SWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             SWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD TLPPPDNIS++F LENGC
Sbjct  182   SWRRNFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLTLPPPDNISSVFHLENGC  241

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SGVF MVVSSR+PKI+WRVVGLNGTL++ERG + G+HGY VS Y  DGQ KS F+PF GV
Sbjct  242   SGVFVMVVSSRTPKILWRVVGLNGTLQIERGFQ-GQHGYLVSSYGADGQCKSSFFPFSGV  300

Query  371   QEELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EELK F +D+  +N  KG     E RLSFVEG RD+AVLEAMLESG R+G LV VK F
Sbjct  301   TEELKAFFNDVFESNPEKGNNFVAEQRLSFVEGARDVAVLEAMLESGARQGELVHVKNF  359



>ref|XP_010509356.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1-like [Camelina sativa]
Length=354

 Score =   422 bits (1086),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 253/354 (71%), Positives = 295/354 (83%), Gaps = 5/354 (1%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP+V+CKWG 
Sbjct  6     PGIAILGAGIFVKTQYIPRLAEISDLLVLKAIWSRTEESAKGAVEIARKHFPDVKCKWGD  65

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL EII+D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A+  Y  
Sbjct  66    EGLNEIIEDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRE  125

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +S +   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYFSSSWRR
Sbjct  126   ISADSPCRPIWAVAENYRFEPAFVELKKLMVEIGDMMNVQLIIEGSMNSSNPYFSSSWRR  185

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             N  GGFILDMGVH++AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLENGCSGVF
Sbjct  186   NLSGGFILDMGVHFIAGLRMLVGCEVTSVSAATSHVDKTLPGPDNITSNFQLENGCSGVF  245

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF GV EEL
Sbjct  246   VMVVSSRSPKILWRVVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFSGVTEEL  305

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG++ GA+V V KF
Sbjct  306   KAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGEKNGAVVTVTKF  354



>gb|KJB66099.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 264/358 (74%), Positives = 300/358 (84%), Gaps = 2/358 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2     ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62    WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSS
Sbjct  122   YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  180

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCS
Sbjct  181   WRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCS  240

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV 
Sbjct  241   GVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVH  300

Query  368   EELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  301   EELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  358



>ref|NP_188715.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAM12966.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15398.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76423.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 253/360 (70%), Positives = 295/360 (82%), Gaps = 5/360 (1%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1     MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             +CKWG  GL EII+D+SI+GVAVVVA +T VE+SL++LK GKHVLQEKPAAA I+E E A
Sbjct  61    KCKWGDEGLNEIIQDSSIVGVAVVVAAETMVELSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             +  Y ++S +   +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEGSMNSSNPYF
Sbjct  121   MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA T+HVDKTLP PDNI++ FQLEN
Sbjct  181   SSSWRRNLSGGFILDMGVHYIAGLRMLVGCEVTSVSATTTHVDKTLPGPDNITSNFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MVVSSRSPKI+WR+VGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF 
Sbjct  241   GCSGVFVMVVSSRSPKILWRIVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFS  300

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  301   GVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVNKF  355



>gb|KJB66096.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=352

 Score =   416 bits (1068),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 256/358 (72%), Positives = 292/358 (82%), Gaps = 8/358 (2%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2     ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+Q  P           L  
Sbjct  62    WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQGIPEIETA------LAS  115

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSS
Sbjct  116   YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  174

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCS
Sbjct  175   WRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCS  234

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV 
Sbjct  235   GVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVH  294

Query  368   EELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  295   EELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  352



>ref|XP_002883268.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59527.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=360

 Score =   415 bits (1067),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 254/360 (71%), Positives = 293/360 (81%), Gaps = 11/360 (3%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P IAILG+GIFVKTQYIPRLAEIS L VLKAIWSR+EESA+ AVE+AR HFP V+CKWG 
Sbjct  6     PGIAILGAGIFVKTQYIPRLAEISDLVVLKAIWSRTEESAKGAVEIARKHFPEVKCKWGD  65

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL EII+D+SI+GVAVVVA +T VEMSL++LK GKHVLQEKPAAA I+E E A+  Y +
Sbjct  66    DGLNEIIQDSSIVGVAVVVAAETMVEMSLKMLKAGKHVLQEKPAAASISEIETAMSSYRN  125

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +S +   +PIWAVAENYRFEPAF E KK+IAE GDMMNVQ+IIEGSMNSSNPYFSSSWRR
Sbjct  126   ISADSPCRPIWAVAENYRFEPAFVELKKLIAETGDMMNVQLIIEGSMNSSNPYFSSSWRR  185

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             N  GGFILDMGVHY+AGLRMLVGCEV SVSA TSHVDKTLP PDNI++ FQLENGCSGVF
Sbjct  186   NLSGGFILDMGVHYIAGLRMLVGCEVASVSATTSHVDKTLPGPDNITSNFQLENGCSGVF  245

Query  539   AMVVSSRSPK------IVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
              MVVSSRSPK      I+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF 
Sbjct  246   VMVVSSRSPKACSKTWILWRVVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPFS  305

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V KF
Sbjct  306   GVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVTKF  360



>gb|KJB66095.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=358

 Score =   415 bits (1067),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 262/358 (73%), Positives = 298/358 (83%), Gaps = 2/358 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2     ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62    WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSSS
Sbjct  122   YKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  180

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF   FILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCS
Sbjct  181   WRRNFEVCFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCS  240

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV 
Sbjct  241   GVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVH  300

Query  368   EELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  301   EELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  358



>gb|KJB66098.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=356

 Score =   415 bits (1066),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 263/358 (73%), Positives = 299/358 (84%), Gaps = 4/358 (1%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSEES+R AVE+A+ HFP VECK
Sbjct  2     ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEESSRRAVEIAKQHFPGVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK GKHV+QEKPAA  I E E AL  
Sbjct  62    WGDQGLNDIMQDSSLIGTAVVLAGQVQVDISLKLLKAGKHVIQEKPAATSIPEIETALAS  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y S+STN  Q PIWAVAENYRFEPAF E  K++A +GDMMNVQVIIEGSMNSSNPYFSSS
Sbjct  122   YKSVSTNPGQ-PIWAVAENYRFEPAFVE--KLVAGVGDMMNVQVIIEGSMNSSNPYFSSS  178

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGCS
Sbjct  179   WRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGCS  238

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFCGV 
Sbjct  239   GVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFCGVH  298

Query  368   EELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  299   EELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  356



>ref|XP_007014899.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
 gb|EOY32518.1| Oxidoreductase, putative isoform 1 [Theobroma cacao]
Length=358

 Score =   415 bits (1066),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 263/355 (74%), Positives = 297/355 (84%), Gaps = 2/355 (1%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5     PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL +II+D SI+GVAVV+AGQ QV+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S
Sbjct  65    QGLNDIIQDASILGVAVVLAGQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             + +N  Q PIWAVAENYRFEPAF E KK+IA+IGDMMNVQ+IIEGSMNSSNPYFSSSWRR
Sbjct  125   ICSNPGQ-PIWAVAENYRFEPAFVESKKLIADIGDMMNVQIIIEGSMNSSNPYFSSSWRR  183

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH D TLPPPD IS+ FQLENGCSGVF
Sbjct  184   NFEGGFILDMGVHFIAGLRMMVGCEVTSVSAITSHRDTTLPPPDIISSNFQLENGCSGVF  243

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              +VVSS SPK++WRVVGL GT++VERG ++G+HGY VSLY  DGQ KS FYPFCGV EEL
Sbjct  244   VLVVSSSSPKVIWRVVGLKGTVQVERGKQEGRHGYLVSLYSADGQCKSTFYPFCGVHEEL  303

Query  359   KTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F+ DI  A  K G   + EPR SFVEG RD+AVLEAMLESG + GALV VKK 
Sbjct  304   KAFIHDILQATVKEGSGYEAEPRSSFVEGARDVAVLEAMLESGNKGGALVHVKKL  358



>ref|XP_010913917.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913918.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913919.1| PREDICTED: uncharacterized protein LOC105039462 isoform X1 [Elaeis 
guineensis]
Length=364

 Score =   415 bits (1066),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 242/357 (68%), Positives = 291/357 (82%), Gaps = 2/357 (1%)
 Frame = -2

Query  1262  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8     LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
              +GLE+II+D+SI GV VV+AGQ QV++SL++LK GKHV+QEKPAA   +EA+ AL  Y 
Sbjct  68    DSGLEDIIQDSSIKGVVVVLAGQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYK  127

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             SL  +   +PIWAVAENYRFEPAF E +K+I EIGDMMN+QVI+EGSMNSSNPYFSSSWR
Sbjct  128   SLCDHFRSQPIWAVAENYRFEPAFVEARKLINEIGDMMNIQVIVEGSMNSSNPYFSSSWR  187

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             R F GGFILDMGVH++AGLRM+VGCE+T+VSA+  HVD  LPPPDN+ ALFQLENGC+GV
Sbjct  188   RKFIGGFILDMGVHFIAGLRMIVGCEITTVSAIARHVDMALPPPDNLCALFQLENGCAGV  247

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
             F M VSS SPKI WRV G NGTL++ERG+ +G+HGY V LY  DG  +  F+PF GV EE
Sbjct  248   FVMAVSSTSPKIYWRVDGSNGTLQIERGSDNGQHGYMVLLYKADGHCQRTFHPFSGVNEE  307

Query  362   LKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             LK F+ DI+ A TK G    K EPR S+VEG RD+AVLEAML+S ++EGA V VKKF
Sbjct  308   LKAFVHDITQATTKEGVAGQKAEPRSSYVEGARDVAVLEAMLDSSRKEGAQVHVKKF  364



>emb|CDY19604.1| BnaA05g20120D [Brassica napus]
Length=347

 Score =   412 bits (1060),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 254/360 (71%), Positives = 292/360 (81%), Gaps = 13/360 (4%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA +  P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1     MANASPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG  GL EII+D+SI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61    ECKWGDEGLNEIIQDSSILGVAVVIAGQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             +  Y ++S++   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYF
Sbjct  121   MTSYKNISSDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDMMNVQLIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLEN
Sbjct  181   SSSWRRNLDGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF M        I+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF 
Sbjct  241   GCSGVFVM--------ILWRVVGLKGTVQLERGVQDGRHGYMATVYGEGGTSRTIFYPFS  292

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F +DIS     G   + EPRLS+VEG RD+AVLEAMLESG R GA++ VKKF
Sbjct  293   GVTEELKAFFNDIS-----GASKEQEPRLSYVEGARDVAVLEAMLESGARNGAVIPVKKF  347



>emb|CDY06381.1| BnaC05g31490D [Brassica napus]
Length=348

 Score =   411 bits (1057),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 256/360 (71%), Positives = 291/360 (81%), Gaps = 12/360 (3%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA    P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSRSEESA+ AVE+AR HFP V
Sbjct  1     MANPSPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG  GL EII+DTSI+GVAVV+AGQTQVEMSL++LK GKHVLQEKPAAA I E E A
Sbjct  61    ECKWGDEGLNEIIQDTSILGVAVVIAGQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             +  Y ++ST+   +PIWAVAENYRFEPAF E KK++ EIGD+MNVQ+IIEGSMNSSNPYF
Sbjct  121   MTSYKNISTDSPCRPIWAVAENYRFEPAFVELKKLVEEIGDIMNVQLIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             SSSWRRN  GGFILDMGVHY+AGLRMLVGCEVTSVSA TSHVDKTLP PDNI++ FQLEN
Sbjct  181   SSSWRRNLDGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GCSGVF MV       I+WRVVGL GT+++ERG +DG+HGY  ++Y   G  ++ FYPF 
Sbjct  241   GCSGVFVMV-------ILWRVVGLKGTVQLERGVQDGRHGYMATVYGEGGTSRTIFYPFS  293

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F  DIS     G   + EPRLS+VEG RD+AVLEAMLESG R GA++ VKKF
Sbjct  294   GVTEELKAFFRDIS-----GTSKEQEPRLSYVEGARDVAVLEAMLESGARNGAVIPVKKF  348



>ref|XP_004486934.1| PREDICTED: uncharacterized protein YMR315W-like [Cicer arietinum]
Length=361

 Score =   411 bits (1056),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 252/363 (69%), Positives = 295/363 (81%), Gaps = 5/363 (1%)
 Frame = -2

Query  1277  MAESQ-LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPN  1101
             MA  Q  PQIAILG+G FVK+QY+PRL+EIS LF LKAIWSR+EESA +AVE+A  HF  
Sbjct  1     MATKQGTPQIAILGAGTFVKSQYLPRLSEISNLFHLKAIWSRTEESATAAVEIANKHFSG  60

Query  1100  VECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaen  921
             V  KWG  GL +II+D SI  VA+V+AGQ QV++SL+LLK GKHVLQEKPAA+C +E E 
Sbjct  61    VHSKWGDNGLHDIIQDPSISAVAIVLAGQNQVDISLKLLKAGKHVLQEKPAASCTSELET  120

Query  920   ALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpy  741
             AL +Y  +S +   + IW+VAENYRFEPA  E KK+IA IG MM+VQVIIEGSMNSSNPY
Sbjct  121   ALSNYKLISADAPGQVIWSVAENYRFEPALVEGKKLIAGIGKMMSVQVIIEGSMNSSNPY  180

Query  740   fssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             FSSSWRRNF GGFILDMGVH++AGLRMLVGCEV SVSAMTSHVD TLPPPDN+S++F LE
Sbjct  181   FSSSWRRNFTGGFILDMGVHFIAGLRMLVGCEVVSVSAMTSHVDLTLPPPDNLSSVFHLE  240

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
             NGCSGVF MVVSSRSPKI+WRVVG+NGTL++ERG + G+HGY VSLY  +G+ KS FYPF
Sbjct  241   NGCSGVFVMVVSSRSPKILWRVVGMNGTLQIERGFQ-GQHGYLVSLYDANGESKSSFYPF  299

Query  380   CGVQEELKTFLSDISLANT--KGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  207
              GV EELK F +D+S  NT  K  +   E RLS+VEG RD+A+LEAMLESG R+G LV V
Sbjct  300   SGVTEELKAFFNDVS-ENTLKKDSQFVAEHRLSYVEGARDVAILEAMLESGSRKGELVHV  358

Query  206   KKF  198
             KKF
Sbjct  359   KKF  361



>ref|XP_009385566.1| PREDICTED: glucose-fructose oxidoreductase domain-containing 
protein 1 [Musa acuminata subsp. malaccensis]
Length=364

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 234/364 (64%), Positives = 290/364 (80%), Gaps = 2/364 (1%)
 Frame = -2

Query  1283  LPMAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFP  1104
             +  +++  PQIAI+G+GIFV+TQYIPRL EI+   ++K+IWSR+EESA++A ELA++  P
Sbjct  1     MAASDAAPPQIAIIGAGIFVRTQYIPRLREIADHLIIKSIWSRTEESAKAAAELAQDFAP  60

Query  1103  NVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeae  924
             N+ECKWG +GLEEII+D+SI  VAVV+A Q QVE+SLR+LK GKHV+QEKPAA  ++EAE
Sbjct  61    NIECKWGDSGLEEIIQDSSITAVAVVLAAQVQVEISLRMLKAGKHVIQEKPAAGTVSEAE  120

Query  923   nALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnp  744
              A+  YNS   N   +P+WA+AENYRFEPAF E +K++ +IGDMM+VQVIIEGSMNSSNP
Sbjct  121   TAISCYNSFCNNFPHQPVWALAENYRFEPAFVESRKLLNDIGDMMHVQVIIEGSMNSSNP  180

Query  743   yfssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQL  564
             YFSSSWRRN+FGGFILDMGVH+VAGLRM+VGCE+++VSA+  HVD  LPPPDNI ALFQL
Sbjct  181   YFSSSWRRNYFGGFILDMGVHFVAGLRMMVGCEISTVSAIARHVDMALPPPDNICALFQL  240

Query  563   ENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP  384
             ENGC+GVF M V+S SPKI WR+ G  GTL++ERG   G+HGYSV  Y   G  +  FYP
Sbjct  241   ENGCAGVFVMAVNSISPKIYWRIDGSKGTLQIERGTDSGRHGYSVLFYTAGGHCQRTFYP  300

Query  383   FCGVQEELKTFLSDISLANTKGG--ECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  210
             FCGV EELK+F+ DIS AN K G    + EPR  + EG RD+AVLEAMLES  ++GA V 
Sbjct  301   FCGVNEELKSFIHDISQANRKDGMTSHEPEPRSLYKEGARDVAVLEAMLESSAKQGAAVH  360

Query  209   VKKF  198
             VKK 
Sbjct  361   VKKL  364



>ref|XP_002459955.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
 gb|EER96476.1| hypothetical protein SORBIDRAFT_02g018670 [Sorghum bicolor]
Length=364

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 238/357 (67%), Positives = 290/357 (81%), Gaps = 1/357 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++ECK
Sbjct  9     AELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIECK  68

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG  GLEEI+ D+SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL  
Sbjct  69    WGDVGLEEIMGDSSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSI  128

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             YNS       KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEGSMNSSNPYF+S+
Sbjct  129   YNSFPNQFPHKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFNST  188

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD TLPPPDNI +LFQLENGC+
Sbjct  189   WRRNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMTLPPPDNICSLFQLENGCA  248

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF   V+SRSPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV 
Sbjct  249   GVFVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVN  308

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELKTF+ D+ LA  K G+ K EPR S+VEG RD+AVLEAMLES  ++GA VQVK+F
Sbjct  309   EELKTFVHDM-LAADKDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGAPVQVKRF  364



>ref|XP_004956459.1| PREDICTED: uncharacterized protein YMR315W-like [Setaria italica]
Length=365

 Score =   407 bits (1047),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 238/355 (67%), Positives = 288/355 (81%), Gaps = 1/355 (0%)
 Frame = -2

Query  1262  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P +ECKWG
Sbjct  11    LPRIAVVGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPEIECKWG  70

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
              AGLEEI+ D+SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL  YN
Sbjct  71    DAGLEEIMGDSSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSIYN  130

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             S       KPIWA+ ENYRFEPAF E  K+I +IGDMMN+QVIIEGSMNSSNPYF+SSWR
Sbjct  131   SFPNQFPYKPIWALGENYRFEPAFVESSKLIKDIGDMMNIQVIIEGSMNSSNPYFNSSWR  190

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             RNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD +LPPPDNI +LFQLENGC+GV
Sbjct  191   RNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMSLPPPDNICSLFQLENGCAGV  250

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
             F   V+SRSPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV EE
Sbjct  251   FVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVNEE  310

Query  362   LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             LKTF+ D+ LA +K G+ K EPR S+VEG RD+AVLEAMLES  ++G  VQVK+F
Sbjct  311   LKTFVQDM-LAASKDGDHKAEPRSSYVEGARDVAVLEAMLESSVKQGTPVQVKRF  364



>ref|XP_008787293.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787294.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787295.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787297.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787298.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787299.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
 ref|XP_008787300.1| PREDICTED: uncharacterized protein LOC103705381 [Phoenix dactylifera]
Length=364

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 238/357 (67%), Positives = 291/357 (82%), Gaps = 2/357 (1%)
 Frame = -2

Query  1262  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             LPQIA++G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8     LPQIAVIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPKVECKWG  67

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
              +GLE+II+D+SI GVAVV+AGQ QV++SL+LL+ GKHV+QEKPAA    EA+ AL  Y 
Sbjct  68    DSGLEDIIQDSSIKGVAVVLAGQVQVDISLKLLRMGKHVIQEKPAAESTIEADTALSCYK  127

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             SL  +   +PIWAVAENYRFEPAF E +K++ EIGDM+N+QVI+EGSMNSSNPYFSSSWR
Sbjct  128   SLCDHFPSQPIWAVAENYRFEPAFVEARKLVNEIGDMINIQVIVEGSMNSSNPYFSSSWR  187

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             R F GGFILDMGVH++AGLRM+VGCE+T+VSA+  HVD  LPPPDN+ ALFQ+ENGC+GV
Sbjct  188   RKFAGGFILDMGVHFIAGLRMIVGCEITTVSAIARHVDMALPPPDNLCALFQVENGCAGV  247

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
             F MVVSS SPKI WRV G NGTL++ERG+ +G+HGY V LY  DG  +  F+PF GV EE
Sbjct  248   FVMVVSSASPKIYWRVDGSNGTLQIERGSDNGQHGYMVLLYKADGHCQRTFHPFSGVNEE  307

Query  362   LKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             LK F+ DI+ A +K G    K EPR S+VEG RD+AVLEAMLES +++GA V VK F
Sbjct  308   LKAFVQDITQATSKEGVAGQKAEPRSSYVEGARDVAVLEAMLESSRKQGAQVHVKNF  364



>gb|KHG07862.1| Uncharacterized protein F383_13730 [Gossypium arboreum]
Length=353

 Score =   405 bits (1042),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 250/359 (70%), Positives = 288/359 (80%), Gaps = 9/359 (3%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesars-avelaRNHFPNVEC  1092
             + LPQIA+LG+GIFVKTQYIPRLAEIS LF LK IWSRSE+ +   AVE+A+ HFP VEC
Sbjct  2     ATLPQIAVLGAGIFVKTQYIPRLAEISHLFCLKYIWSRSEKESSRGAVEIAKQHFPGVEC  61

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             KWG  GL +I++D+S+IG AVV+AGQ QV++SL+LLK  KHV+Q  P           L 
Sbjct  62    KWGDQGLNDIVQDSSLIGTAVVLAGQVQVDISLKLLKAAKHVIQGIPEIETA------LA  115

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfss  732
              Y S+ TN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYFSS
Sbjct  116   SYKSVCTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYFSS  174

Query  731   SWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             SWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LENGC
Sbjct  175   SWRRNFEGGFILDMGVHFIAGLRMMVGCEVTSVSAITSHIDRTLPPPDIISSNFKLENGC  234

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SGVF MVVSS SPKI+WRVVG  G+++VERG  DGKHGY VSLY  DGQ KS F+PFCGV
Sbjct  235   SGVFVMVVSSSSPKIIWRVVGSKGSVQVERGKVDGKHGYLVSLYSADGQSKSTFHPFCGV  294

Query  371   QEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  295   HEELKFFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKKF  353



>ref|XP_010651283.1| PREDICTED: uncharacterized protein LOC100245027 isoform X2 [Vitis 
vinifera]
Length=322

 Score =   403 bits (1036),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 246/354 (69%), Positives = 281/354 (79%), Gaps = 36/354 (10%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5     PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65    DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRR
Sbjct  125   ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRR  184

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++FQLENGCSGVF
Sbjct  185   NFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFQLENGCSGVF  244

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVS+R+PKI WRVVGL GTL++ERGNK+G HGY                         
Sbjct  245   VMVVSTRAPKIFWRVVGLKGTLQLERGNKEGSHGYQ------------------------  280

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
                         KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  281   ------------KGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  322



>ref|XP_003577920.1| PREDICTED: uncharacterized protein LOC100827110 [Brachypodium 
distachyon]
Length=360

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 236/358 (66%), Positives = 286/358 (80%), Gaps = 1/358 (0%)
 Frame = -2

Query  1271  ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC  1092
             E  LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSRS+ESA +AVELAR+  P++EC
Sbjct  4     EGDLPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRSQESAEAAVELARDFVPDIEC  63

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             KWG  GLEEI+ D SI+GVAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL 
Sbjct  64    KWGDVGLEEIMGDRSIMGVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAEAALS  123

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfss  732
              YNS       KPIWA+AENYRFEPAF E  K++++IGDMMN+QVI+EGSMNSSNPYF+S
Sbjct  124   IYNSFPKQFPYKPIWALAENYRFEPAFVESNKLMSDIGDMMNIQVIVEGSMNSSNPYFNS  183

Query  731   SWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             SWRRNF GGF+LDMGVH++AGLRMLVG EV +VS+++ HVD  LPPPDNI +LFQLENGC
Sbjct  184   SWRRNFVGGFVLDMGVHFIAGLRMLVGSEVATVSSISRHVDTALPPPDNICSLFQLENGC  243

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             +GVF   V+SRSPKI+WRV G  GT+++ERG   GKHGY V     +GQ +  FYPFCGV
Sbjct  244   AGVFVFAVNSRSPKILWRVDGTKGTVQIERGIDSGKHGYQVLFSHENGQCQKTFYPFCGV  303

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EELK F+ DI L  +K  + K EPR S+VEG RD+AVLEAMLES  ++GALVQVKK 
Sbjct  304   NEELKAFVHDI-LQASKDVDHKAEPRSSYVEGVRDVAVLEAMLESSTKQGALVQVKKL  360



>ref|NP_001149836.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
 gb|ACG36942.1| NAD-dependent dyhydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 235/357 (66%), Positives = 289/357 (81%), Gaps = 1/357 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             ++LP+IA++G+GIF +TQYIPRL EI+ L VLKAIWSR++ESA++A ELAR+  P++ECK
Sbjct  9     AELPRIAVIGAGIFARTQYIPRLREIAHLVVLKAIWSRTQESAKAAAELARDFAPDIECK  68

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG AGLEEI+ D+SI+GVA+V+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL  
Sbjct  69    WGDAGLEEIMGDSSIMGVAIVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSI  128

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y+S       KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEGSMNSSNPYF+S+
Sbjct  129   YHSFQNLFPHKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFNST  188

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD  LPPPDNI +LFQLENGC+
Sbjct  189   WRRNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMALPPPDNICSLFQLENGCA  248

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF   V+SRSPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV 
Sbjct  249   GVFVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVN  308

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELKTF+ D+ L   K G+ K EPR S+VEG RD+AVLEAMLES  ++GA VQVK+F
Sbjct  309   EELKTFVHDM-LEAGKDGDHKAEPRGSYVEGARDVAVLEAMLESSAKQGAPVQVKRF  364



>ref|XP_007205433.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
 gb|EMJ06632.1| hypothetical protein PRUPE_ppa007778mg [Prunus persica]
Length=356

 Score =   403 bits (1035),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 243/357 (68%), Positives = 291/357 (82%), Gaps = 5/357 (1%)
 Frame = -2

Query  1265  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW  1086
             + PQIAILG+G F++TQYIPRLAEIS+L +LK+IWSR+EESAR AVE+A+ HFP VECKW
Sbjct  3     EAPQIAILGAGTFMRTQYIPRLAEISKLLLLKSIWSRTEESARGAVEIAQKHFPGVECKW  62

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             G  GL+EII+D+SI+GVAVV+AGQ QV+ SLRLLK GKHVLQEKPAAA  +E E AL  Y
Sbjct  63    GDKGLQEIIEDSSILGVAVVLAGQAQVDFSLRLLKAGKHVLQEKPAAASTSELETALSSY  122

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
              S+  N+  KPIWAVAENYRFEPAF E KK++ +IGD+M++QV++EGSMNSSNPYFSSSW
Sbjct  123   RSIFANIPDKPIWAVAENYRFEPAFVEGKKLVNDIGDVMSIQVLVEGSMNSSNPYFSSSW  182

Query  725   RRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             RRNF     + M ++    L+ L GCE+ SVSA+TSHVDKTLP PDN+S+LFQLENGCSG
Sbjct  183   RRNF----TVRMNLNMSCSLQQLAGCELVSVSAITSHVDKTLPAPDNVSSLFQLENGCSG  238

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  366
             VF MVVSSRSPKIVWR VGL GTL++ERGN+DG+HGY V  Y  DGQ KS FY F GV E
Sbjct  239   VFVMVVSSRSPKIVWRFVGLKGTLQIERGNQDGRHGYLVLFYGSDGQSKSSFYQFSGVDE  298

Query  365   ELKTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             E K F++DIS AN  KG   + EPR+SF+EG RD+AVLEAMLESG ++GA V VKK+
Sbjct  299   EFKAFINDISQANLRKGTGYEAEPRMSFLEGARDVAVLEAMLESGGKQGAPVHVKKY  355



>ref|XP_006660493.1| PREDICTED: uncharacterized protein YMR315W-like [Oryza brachyantha]
Length=359

 Score =   400 bits (1029),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 285/360 (79%), Gaps = 1/360 (0%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA   LP+IA+LG+G F +TQYIPRL EI+ L +L+AIWSR++ESA +A ELAR+  P +
Sbjct  1     MAADGLPRIAVLGAGTFARTQYIPRLREIAHLVLLRAIWSRTQESAEAAAELARDFAPEI  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             EC+WG AGL EI++D SI  VAVV+AGQ QVE+SL++LK GKHV+QEKPA+    EAE A
Sbjct  61    ECRWGDAGLAEIMEDASISAVAVVLAGQVQVELSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L  YNS       +PIWA+AENYRFEPAF E +K++ +IGDMMN+QVI+EGSMNSSNPYF
Sbjct  121   LSVYNSFPNQPPYRPIWALAENYRFEPAFVESRKLMNDIGDMMNIQVIVEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +SSWRRNF GGFILDMGVH++AGLRMLVG E+ +VS+++ HVDK LPPPDNI +LFQLEN
Sbjct  181   NSSWRRNFVGGFILDMGVHFIAGLRMLVGSEIATVSSISRHVDKALPPPDNICSLFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GC+GVF   ++SRSPKI+WRV G  GT+++ERG   GKHGY V  +  + Q ++ FYPFC
Sbjct  241   GCAGVFVFAINSRSPKILWRVDGTKGTVQIERGIAGGKHGYQVLFFSENAQCQTTFYPFC  300

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F+ DI   N K G+ K EPR S+VEG RD+AVLEAML+S  ++GA VQVKKF
Sbjct  301   GVNEELKAFVHDIVQTN-KDGDHKAEPRSSYVEGARDVAVLEAMLKSSAKQGATVQVKKF  359



>ref|XP_010673578.1| PREDICTED: uncharacterized protein YMR315W isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=360

 Score =   400 bits (1029),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 242/353 (69%), Positives = 287/353 (81%), Gaps = 3/353 (1%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
             QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  11    QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  70

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
             G++EIIKD+S++GVAVV+AGQ QV+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +
Sbjct  71    GIDEIIKDSSVVGVAVVLAGQIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLV  130

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN  717
               + + KPIWAVAENYRFEP F E +K++ EIGDMM+VQVI+EGS+NSSNPYFSSSWRRN
Sbjct  131   CPSNSSKPIWAVAENYRFEPGFIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYFSSSWRRN  190

Query  716   FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  537
             F GGFILDMGVH +A LRMLVGCE+ SVSA+T+HVD TLPPPDNIS+ +QLENGC G+F 
Sbjct  191   FNGGFILDMGVHMIAALRMLVGCEMKSVSALTTHVDTTLPPPDNISSTYQLENGCPGIFV  250

Query  536   MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  357
             M VS+RSPK  WRVVGL GT+++ERGN DG+HGY VS +  DGQ  S F+PF GV EELK
Sbjct  251   MAVSTRSPKTFWRVVGLKGTVQIERGNIDGRHGYLVSKFNVDGQCTSSFHPFSGVTEELK  310

Query  356   TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             TFL DIS A+      K + RLS+VEG RD+AVLEAMLESG + GA+V VK+F
Sbjct  311   TFLHDISEASNNH---KPDRRLSYVEGARDVAVLEAMLESGMKGGAVVPVKRF  360



>ref|XP_010673579.1| PREDICTED: uncharacterized protein YMR315W isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=355

 Score =   400 bits (1029),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 242/353 (69%), Positives = 287/353 (81%), Gaps = 3/353 (1%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
             QI I+G+G FVK QYIPRL+EIS L  ++ IWSRSEESARSAVELA   FP VECKWG  
Sbjct  6     QITIIGAGTFVKNQYIPRLSEISHLVSIRYIWSRSEESARSAVELASKSFPEVECKWGDV  65

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
             G++EIIKD+S++GVAVV+AGQ QV+M+LRLLK GKHV+QEKPAAA   EAE AL  Y+ +
Sbjct  66    GIDEIIKDSSVVGVAVVLAGQIQVDMALRLLKAGKHVIQEKPAAASNEEAELALSSYDLV  125

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN  717
               + + KPIWAVAENYRFEP F E +K++ EIGDMM+VQVI+EGS+NSSNPYFSSSWRRN
Sbjct  126   CPSNSSKPIWAVAENYRFEPGFIEGRKLVEEIGDMMSVQVIVEGSVNSSNPYFSSSWRRN  185

Query  716   FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  537
             F GGFILDMGVH +A LRMLVGCE+ SVSA+T+HVD TLPPPDNIS+ +QLENGC G+F 
Sbjct  186   FNGGFILDMGVHMIAALRMLVGCEMKSVSALTTHVDTTLPPPDNISSTYQLENGCPGIFV  245

Query  536   MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELK  357
             M VS+RSPK  WRVVGL GT+++ERGN DG+HGY VS +  DGQ  S F+PF GV EELK
Sbjct  246   MAVSTRSPKTFWRVVGLKGTVQIERGNIDGRHGYLVSKFNVDGQCTSSFHPFSGVTEELK  305

Query  356   TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             TFL DIS A+      K + RLS+VEG RD+AVLEAMLESG + GA+V VK+F
Sbjct  306   TFLHDISEASNNH---KPDRRLSYVEGARDVAVLEAMLESGMKGGAVVPVKRF  355



>ref|XP_008668038.1| PREDICTED: NAD-dependent dyhydrogenase, Gfo/Idh/MocA family isoform 
X1 [Zea mays]
 tpg|DAA39396.1| TPA: NAD-dependent dihydrogenase, Gfo/Idh/MocA family [Zea mays]
Length=364

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 233/357 (65%), Positives = 288/357 (81%), Gaps = 1/357 (0%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             ++LP+IA++G+GIF +TQYIPRL EI+ L VLK+IWSR++ESA++A ELAR+  P++ECK
Sbjct  9     AELPRIAVIGAGIFARTQYIPRLREIAHLVVLKSIWSRTQESAKAAAELARDFAPDIECK  68

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG AGLEEI+ D+SI+GVA+V+AGQ QVE+SL++LK GKHV+QEKPA+    EAE AL  
Sbjct  69    WGDAGLEEIMGDSSIMGVAIVLAGQVQVELSLKMLKAGKHVIQEKPASGSTTEAETALSI  128

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y+S       KPIWAV ENYRFEPAF E  K+I +IGDMM++QVIIEGSMNSSNPYF+S+
Sbjct  129   YHSFQNLFPHKPIWAVGENYRFEPAFIESSKLINDIGDMMHIQVIIEGSMNSSNPYFNST  188

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             WRRNF GGFILDMGVH++AGLRMLVG E+TSVS+++ HVD  LPPPDNI +LFQLENGC+
Sbjct  189   WRRNFVGGFILDMGVHFIAGLRMLVGSEITSVSSISRHVDMALPPPDNICSLFQLENGCA  248

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GVF   V+SRSPKI+WRV G  GT++VERG   GKHGY V     +GQ +  FYPFCGV 
Sbjct  249   GVFVFAVNSRSPKILWRVDGTKGTIQVERGVDSGKHGYQVLFSGENGQCQKTFYPFCGVN  308

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EELKTF+ D+ L   K G+ K  PR S+VEG RD+AVLEAMLES  ++GA VQVK+F
Sbjct  309   EELKTFVHDM-LEAGKDGDHKAAPRGSYVEGARDVAVLEAMLESSAKQGAPVQVKRF  364



>ref|NP_001062764.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAD26513.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24678.1| Os09g0280300 [Oryza sativa Japonica Group]
 dbj|BAG93408.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84244.1| hypothetical protein OsI_30682 [Oryza sativa Indica Group]
Length=359

 Score =   399 bits (1025),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 229/360 (64%), Positives = 286/360 (79%), Gaps = 1/360 (0%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1     MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             + +WG AGLEEI+ D SI  VAVV+AGQ QV++SL++LK GKHV+QEKPA+    EAE A
Sbjct  61    QPRWGDAGLEEIMGDASISAVAVVLAGQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L  YNS       KPIWA+AENYRFEPAF E +K++++IGDMMN+QVI+EGSMNSSNPYF
Sbjct  121   LSVYNSFPNQFPYKPIWALAENYRFEPAFVESRKLMSDIGDMMNIQVIVEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +SSWRRNF GGFILDMGVH++AGLRM+VG E+ +VS+++ HVDK LPPPDNI +LFQLEN
Sbjct  181   NSSWRRNFVGGFILDMGVHFIAGLRMMVGSEIATVSSISRHVDKALPPPDNICSLFQLEN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             GC+GVF   V+SR+PKI+WRV G  GT+++ERG   GKHGY V     +GQ ++ FYPFC
Sbjct  241   GCAGVFVFAVNSRTPKILWRVDGTRGTVQIERGIASGKHGYQVLFTNENGQCQTTFYPFC  300

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             GV EELK F+ DI  AN K G+ K EPR S+VEG RD+AVLEAMLES  ++G +VQVKKF
Sbjct  301   GVNEELKAFVHDIVQAN-KDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGTMVQVKKF  359



>emb|CAN75498.1| hypothetical protein VITISV_020272 [Vitis vinifera]
Length=364

 Score =   397 bits (1021),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 233/352 (66%), Positives = 267/352 (76%), Gaps = 29/352 (8%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5     PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII D+SI GVAVV       EMSLRLLK GKHVLQ    A         L HYNS
Sbjct  65    DGLDEIINDSSITGVAVV-------EMSLRLLKAGKHVLQAISEAETA------LSHYNS  111

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRR
Sbjct  112   ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRR  171

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRMLVGCE+ SVSA+TSHVD  LPPPDNIS++F L        
Sbjct  172   NFTGGFILDMGVHFIAGLRMLVGCEIASVSAITSHVDTMLPPPDNISSVFPL--------  223

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
                      +I WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EEL
Sbjct  224   -------YLQIFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEEL  276

Query  359   KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  207
             KTF+ DIS A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+Q 
Sbjct  277   KTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQA  328



>ref|XP_003597479.1| Oxidoreductase, putative [Medicago truncatula]
 gb|AES67730.1| oxidoreductase family, NAD-binding rossmann fold protein [Medicago 
truncatula]
Length=356

 Score =   397 bits (1020),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 243/354 (69%), Positives = 290/354 (82%), Gaps = 3/354 (1%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFP-NVECKWGG  1080
             QIAILG+G FVK QY+PRL+EIS LF LK+IWSR+++SA +AVE+A   F  NVE K+G 
Sbjct  5     QIAILGAGTFVKHQYLPRLSEISHLFNLKSIWSRTQDSANAAVEIANKLFGGNVESKFGD  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL +II+D+SI  V VV+AGQ QV++SL+LLK GKHVLQEKPAA+ I E E AL +Y S
Sbjct  65    NGLNDIIQDSSITAVLVVLAGQYQVDISLKLLKAGKHVLQEKPAASGINELETALSNYKS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +S +   + IW+VAENYRFEPA  E KK+IA++G MM+VQVIIEGSMNSSNPYFSSSWRR
Sbjct  125   ISADAPGQIIWSVAENYRFEPALVEGKKLIADLGKMMSVQVIIEGSMNSSNPYFSSSWRR  184

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRMLVGCEV SVSAMTSHVD TLPPPDNIS++F LENGCSGVF
Sbjct  185   NFTGGFILDMGVHFIAGLRMLVGCEVVSVSAMTSHVDFTLPPPDNISSVFHLENGCSGVF  244

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              MVVSSRSPKI+WRVVG+NGTL++ERG + G+HGY +SLY   G+ KS F+PF GV EEL
Sbjct  245   VMVVSSRSPKILWRVVGMNGTLQIERGFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEEL  303

Query  359   KTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F +D+S    K G  + E RLSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  304   KAFFNDVSENTLKKG-SQPEHRLSFVEGARDVALLEAMLESGSKKGELVHVKKF  356



>gb|EMT01460.1| hypothetical protein F775_26364 [Aegilops tauschii]
Length=355

 Score =   392 bits (1007),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 227/355 (64%), Positives = 274/355 (77%), Gaps = 7/355 (2%)
 Frame = -2

Query  1262  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             LP+IA++G+GIF +TQYIPRL EIS L VLKAIWSR++ESA +A ELAR+  P +ECKWG
Sbjct  8     LPRIAVVGAGIFARTQYIPRLREISHLVVLKAIWSRTQESAEAAAELARDFAPGIECKWG  67

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
              AGLEEI+ D SI+GVAVV+AGQ QVE+SL++LK GKHV+Q    A         L  YN
Sbjct  68    DAGLEEIMGDPSILGVAVVLAGQVQVELSLKMLKAGKHVIQASTEAETA------LSVYN  121

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             S    +  KPIWAV ENYRFEPAF E  K++ +IGDMMN+QVI+EGSMNSSNPYF+SSWR
Sbjct  122   SFPNKLPCKPIWAVGENYRFEPAFVESSKLMDDIGDMMNIQVIVEGSMNSSNPYFNSSWR  181

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             RNF GGFILDMGVH++AGLRMLVG EV +VS+++ HVD  LPPPDNI +LFQLENGC+GV
Sbjct  182   RNFVGGFILDMGVHFIAGLRMLVGSEVATVSSISRHVDTDLPPPDNICSLFQLENGCAGV  241

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
                 V SRSPKI+WRV G  GT+++ERG   GKHGY V      G+ +  FYPFCGV EE
Sbjct  242   LVFAVKSRSPKILWRVDGTKGTVQIERGVDGGKHGYQVLFSNESGECQKTFYPFCGVHEE  301

Query  362   LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             LK F+ D+  A +K G+ K EPR S+VEG RD+AVLEAMLES  ++GA+VQVKKF
Sbjct  302   LKAFVHDMVQA-SKDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGAMVQVKKF  355



>ref|XP_011090402.1| PREDICTED: uncharacterized protein YMR315W-like [Sesamum indicum]
Length=358

 Score =   391 bits (1005),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 229/355 (65%), Positives = 285/355 (80%), Gaps = 1/355 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIAILG+GIFVKT+YIPRL+EI  LFVLKAIWSR+EESAR AV++A+  FP VECKWG 
Sbjct  4     PQIAILGAGIFVKTEYIPRLSEIPDLFVLKAIWSRTEESARGAVDIAKKFFPRVECKWGD  63

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
             AGL EII+D SI+ V VV+A Q QV++SL+LL+ GKHVLQEKPAA+ I E + AL  YNS
Sbjct  64    AGLNEIIQDASIVAVLVVLAAQFQVDLSLKLLRSGKHVLQEKPAASSINEVKTALSSYNS  123

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             LST++ ++PIWA+AENYRFEPA  E KK++ +IGD++N Q+++E  MNSSNPYFSSSWR 
Sbjct  124   LSTSLPRQPIWAIAENYRFEPAILEGKKLMPDIGDLVNFQILVEAPMNSSNPYFSSSWRH  183

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GG+ILDMGVH+VA LRML GCEVTSVSAMTSHVD TLPPPD++S++ QLENG  GV 
Sbjct  184   NFTGGYILDMGVHFVAVLRMLAGCEVTSVSAMTSHVDTTLPPPDSMSSIIQLENGRCGVL  243

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
                +  ++ KI  R VG+ GTL+++  N++GK GYSVSL+  DGQ K+ +YPF GV EEL
Sbjct  244   VASLPGKTLKIFHRFVGVKGTLQIDVENREGKFGYSVSLFTADGQTKNSYYPFRGVTEEL  303

Query  359   KTFLSDISLANTKGG-ECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             KTF + +SLA  K     + EPRLS +EG RD+AV+EA+LESG ++GALVQV KF
Sbjct  304   KTFFNVVSLATEKKDLTFRAEPRLSVIEGARDVAVIEAILESGNKQGALVQVNKF  358



>gb|EYU18011.1| hypothetical protein MIMGU_mgv1a008840mg [Erythranthe guttata]
Length=360

 Score =   389 bits (1000),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 229/357 (64%), Positives = 290/357 (81%), Gaps = 3/357 (1%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P+IAILG+GIFV+T+YIPRL+EISQLF LKAIWSR+EESA+ AVE+A+  FP VECKWG 
Sbjct  4     PKIAILGAGIFVRTEYIPRLSEISQLFSLKAIWSRTEESAKGAVEIAKEFFPEVECKWGD  63

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+++I+D+SI  V VV+A Q QV++SLR+LK GKHVLQEKPAAA I + E AL  YNS
Sbjct  64    DGLDDVIEDSSIDAVLVVLAAQFQVDLSLRILKSGKHVLQEKPAAASITKVETALSSYNS  123

Query  899   L-STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             L ST +  KPIWAVAENYRFEPAF E KK++ +IG+M+N Q+I+E  MNSS+PYFSSSWR
Sbjct  124   LTSTGLPSKPIWAVAENYRFEPAFLEGKKLMGDIGEMVNFQIIVEVPMNSSSPYFSSSWR  183

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
              +F GG+ILDMGVH++A LRM+ GCE+TSVSAMTS+VD TLPPPD++S+L QLENG SGV
Sbjct  184   HSFAGGYILDMGVHFIAALRMMAGCEITSVSAMTSNVDTTLPPPDSMSSLIQLENGRSGV  243

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP-FCGVQE  366
                VVS+++ K+ WRVVGLNGT +++  +++GK GY V+L+  DGQ KS FYP F GV E
Sbjct  244   LVTVVSAKTLKLFWRVVGLNGTFQIDVESREGKFGYLVTLFTADGQTKSNFYPGFSGVTE  303

Query  365   ELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             ELK F SD++ A+ K     + E R+SF+EG RD+AV++AMLESG ++GALV VKKF
Sbjct  304   ELKIFFSDVTQASLKKESIFEAEARMSFIEGARDLAVMDAMLESGNKQGALVHVKKF  360



>ref|XP_011625442.1| PREDICTED: uncharacterized protein LOC18439853 [Amborella trichopoda]
 ref|XP_011625444.1| PREDICTED: uncharacterized protein LOC18439853 [Amborella trichopoda]
Length=364

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 228/359 (64%), Positives = 284/359 (79%), Gaps = 1/359 (0%)
 Frame = -2

Query  1271  ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC  1092
             E  LP IA+LG GIFV++QYIPRL EISQ  VL+ IWSRSEESA++A ELA    PNVE 
Sbjct  6     EKMLPHIALLGGGIFVRSQYIPRLKEISQTVVLRVIWSRSEESAKAAAELAHEFSPNVEY  65

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             KWG AGL +II+D+SI GV +V+  Q QV++SLR+L+ GKHVLQEKPAA+ ++EAENA++
Sbjct  66    KWGDAGLNDIIQDSSIHGVLIVLTAQVQVDISLRMLRAGKHVLQEKPAASSLSEAENAML  125

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfss  732
              Y+SL  N   +PIWAVAENYRFEPAF E +++  E+GDMM+VQVI+E SMNSSNPYFSS
Sbjct  126   FYHSLHANFPHRPIWAVAENYRFEPAFVESQRLAKEVGDMMSVQVIVESSMNSSNPYFSS  185

Query  731   SWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             SWRRNF GGFILDMGVH+VAGLRM+VG EVTS+SA++ HVD +LPPPDN+ A+FQLENGC
Sbjct  186   SWRRNFAGGFILDMGVHFVAGLRMIVGYEVTSISAISRHVDTSLPPPDNVCAVFQLENGC  245

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
              GV  + VS+RSPKI WRVVG  G++E ERG ++G+HGY+V+        +  FYPFCGV
Sbjct  246   GGVLVLSVSTRSPKISWRVVGSKGSVETERGIRNGQHGYTVTYSPAGEPPQCSFYPFCGV  305

Query  371   QEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EELK F+ DIS AN K GE  + +PR +++EG RD+A++EAMLESG + G L  VKK 
Sbjct  306   NEELKAFVQDISQANLKDGEAYEPDPRGTYLEGARDVALVEAMLESGLKNGELFHVKKL  364



>gb|ERN11653.1| hypothetical protein AMTR_s00022p00213490 [Amborella trichopoda]
Length=368

 Score =   388 bits (997),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 228/359 (64%), Positives = 284/359 (79%), Gaps = 1/359 (0%)
 Frame = -2

Query  1271  ESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC  1092
             E  LP IA+LG GIFV++QYIPRL EISQ  VL+ IWSRSEESA++A ELA    PNVE 
Sbjct  10    EKMLPHIALLGGGIFVRSQYIPRLKEISQTVVLRVIWSRSEESAKAAAELAHEFSPNVEY  69

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             KWG AGL +II+D+SI GV +V+  Q QV++SLR+L+ GKHVLQEKPAA+ ++EAENA++
Sbjct  70    KWGDAGLNDIIQDSSIHGVLIVLTAQVQVDISLRMLRAGKHVLQEKPAASSLSEAENAML  129

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfss  732
              Y+SL  N   +PIWAVAENYRFEPAF E +++  E+GDMM+VQVI+E SMNSSNPYFSS
Sbjct  130   FYHSLHANFPHRPIWAVAENYRFEPAFVESQRLAKEVGDMMSVQVIVESSMNSSNPYFSS  189

Query  731   SWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             SWRRNF GGFILDMGVH+VAGLRM+VG EVTS+SA++ HVD +LPPPDN+ A+FQLENGC
Sbjct  190   SWRRNFAGGFILDMGVHFVAGLRMIVGYEVTSISAISRHVDTSLPPPDNVCAVFQLENGC  249

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
              GV  + VS+RSPKI WRVVG  G++E ERG ++G+HGY+V+        +  FYPFCGV
Sbjct  250   GGVLVLSVSTRSPKISWRVVGSKGSVETERGIRNGQHGYTVTYSPAGEPPQCSFYPFCGV  309

Query  371   QEELKTFLSDISLANTKGGEC-KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EELK F+ DIS AN K GE  + +PR +++EG RD+A++EAMLESG + G L  VKK 
Sbjct  310   NEELKAFVQDISQANLKDGEAYEPDPRGTYLEGARDVALVEAMLESGLKNGELFHVKKL  368



>gb|EEE69341.1| hypothetical protein OsJ_28659 [Oryza sativa Japonica Group]
Length=364

 Score =   382 bits (980),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 225/365 (62%), Positives = 283/365 (78%), Gaps = 6/365 (2%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA   LP+IA++G+GIF +TQYIPRL EI+ L +LK IWSR++ESA +A ELAR+  P +
Sbjct  1     MAGDGLPRIAVVGAGIFARTQYIPRLREIAHLVLLKTIWSRTKESAEAAAELARDFAPEI  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             + +WG AGLEEI+ D SI  VAVV+AGQ QV++SL++LK GKHV+QEKPA+    EAE A
Sbjct  61    QPRWGDAGLEEIMGDASISAVAVVLAGQVQVDLSLKMLKAGKHVIQEKPASGSTMEAETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L  YNS       KPIWA+AENYRFEPAF E +K++++IGDMMN+QVI+EGSMNSSNPYF
Sbjct  121   LSVYNSFPNQFPYKPIWALAENYRFEPAFVESRKLMSDIGDMMNIQVIVEGSMNSSNPYF  180

Query  737   ssSWRRNF-----FGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISAL  573
             +SS  + F      GGFILDMGVH++AGLRM+VG E+ +VS+++ HVDK LPPPDNI +L
Sbjct  181   NSSLEKKFCGKNQVGGFILDMGVHFIAGLRMMVGSEIATVSSISRHVDKALPPPDNICSL  240

Query  572   FQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF  393
             FQLENGC+GVF   V+SR+PKI+WRV G  GT+++ERG   GKHGY V     +GQ ++ 
Sbjct  241   FQLENGCAGVFVFAVNSRTPKILWRVDGTRGTVQIERGIASGKHGYQVLFTNENGQCQTT  300

Query  392   FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  213
             FYPFCGV EELK F+ DI  AN K G+ K EPR S+VEG RD+AVLEAMLES  ++G +V
Sbjct  301   FYPFCGVNEELKAFVHDIVQAN-KDGDHKAEPRSSYVEGARDVAVLEAMLESSAKQGTMV  359

Query  212   QVKKF  198
             QVKKF
Sbjct  360   QVKKF  364



>ref|XP_010913920.1| PREDICTED: uncharacterized protein LOC105039462 isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   372 bits (954),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 227/357 (64%), Positives = 275/357 (77%), Gaps = 19/357 (5%)
 Frame = -2

Query  1262  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             LPQIAI+G+GIFV+TQYIPRL EI+   ++KAIWSRSEESA++AVELAR+  P VECKWG
Sbjct  8     LPQIAIIGAGIFVRTQYIPRLREIADHVIIKAIWSRSEESAKAAVELARDFAPQVECKWG  67

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
              +GLE+II+D+SI GV VV+AGQ QV++SL++LK GKHV+QEKPAA   +EA+ AL  Y 
Sbjct  68    DSGLEDIIQDSSIKGVVVVLAGQVQVDISLKMLKMGKHVIQEKPAAESTSEADTALSRYK  127

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             SL  +   +PIWAVAENYRFEPAF E +K+I EIGDMMN+QVI+EGSMNSSNPYFSSSWR
Sbjct  128   SLCDHFRSQPIWAVAENYRFEPAFVEARKLINEIGDMMNIQVIVEGSMNSSNPYFSSSWR  187

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             R F                 ++VGCE+T+VSA+  HVD  LPPPDN+ ALFQLENGC+GV
Sbjct  188   RKF-----------------IIVGCEITTVSAIARHVDMALPPPDNLCALFQLENGCAGV  230

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
             F M VSS SPKI WRV G NGTL++ERG+ +G+HGY V LY  DG  +  F+PF GV EE
Sbjct  231   FVMAVSSTSPKIYWRVDGSNGTLQIERGSDNGQHGYMVLLYKADGHCQRTFHPFSGVNEE  290

Query  362   LKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             LK F+ DI+ A TK G    K EPR S+VEG RD+AVLEAML+S ++EGA V VKKF
Sbjct  291   LKAFVHDITQATTKEGVAGQKAEPRSSYVEGARDVAVLEAMLDSSRKEGAQVHVKKF  347



>ref|XP_007014900.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
 gb|EOY32519.1| Oxidoreductase, putative isoform 2 [Theobroma cacao]
Length=344

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 280/358 (78%), Gaps = 22/358 (6%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIA+LG+GIFVKTQYIPRLAEIS L  LK IWSR++ESAR AVELA+ HFP VECKWG 
Sbjct  5     PQIAVLGAGIFVKTQYIPRLAEISHLLCLKYIWSRTQESARGAVELAKQHFPGVECKWGD  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL +II+D SI+GVAVV+AGQ QV+MSL+LLKGGKHV+QEKPAAA   E E AL  Y S
Sbjct  65    QGLNDIIQDASILGVAVVLAGQAQVDMSLKLLKGGKHVIQEKPAAASTTETETALSSYKS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             + +N  Q PIWAVAENYRFEPAF E KK+IA+IGDMMNVQ+IIEGSMNSSNPYFSSSWRR
Sbjct  125   ICSNPGQ-PIWAVAENYRFEPAFVESKKLIADIGDMMNVQIIIEGSMNSSNPYFSSSWRR  183

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF                  +VGCEVTSVSA+TSH D TLPPPD IS+ FQLENGCSGVF
Sbjct  184   NF-----------------EMVGCEVTSVSAITSHRDTTLPPPDIISSNFQLENGCSGVF  226

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
              +VVSS SPK++WRVVGL GT++VERG ++G+HGY VSLY  DGQ KS FYPFCGV EEL
Sbjct  227   VLVVSSSSPKVIWRVVGLKGTVQVERGKQEGRHGYLVSLYSADGQCKSTFYPFCGVHEEL  286

Query  359   KTFLSDISLANTK----GGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             K F+ DI  A  K    G   + EPR SFVEG RD+AVLEAMLESG + GALV VKK 
Sbjct  287   KAFIHDILQATVKVRSDGSGYEAEPRSSFVEGARDVAVLEAMLESGNKGGALVHVKKL  344



>gb|EPS68382.1| hypothetical protein M569_06387, partial [Genlisea aurea]
Length=340

 Score =   358 bits (918),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 224/355 (63%), Positives = 277/355 (78%), Gaps = 21/355 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
             +AI+G+GIFV++ YIPRLAEI +  FVL+AIWSRSE+SA+SA  +A+  FP VECKWG A
Sbjct  4     VAIVGAGIFVRSTYIPRLAEIGNNSFVLRAIWSRSEDSAKSAHAIAKPFFPGVECKWGEA  63

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
             GL++I+ D SI  V VV+AGQ QV+MSLRLL  GKHVLQEKPAAA + E + A+  Y SL
Sbjct  64    GLDDIVGDASIAAVMVVIAGQAQVDMSLRLLSAGKHVLQEKPAAASVNELQKAISGYQSL  123

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN  717
              +     PIWAVAENYRFEPAF E +K++ EIG+++N  VI+EGSMNSSNPYFSSSWRRN
Sbjct  124   PS----APIWAVAENYRFEPAFVEGRKLMTEIGNVVNFHVIVEGSMNSSNPYFSSSWRRN  179

Query  716   FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  537
             F GGFILDMG+              TSVSA TSHVD T+PPPD++S+  QL+NG SGVF 
Sbjct  180   FDGGFILDMGI--------------TSVSAFTSHVDTTVPPPDHLSSTVQLDNGTSGVFV  225

Query  536   MVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGD-GQIKSFFYPFCGVQEEL  360
             MVVSSRSPK++WR+VGLNGTL+VERG KDGKHGY+V+L+  D  Q K++FYPF GV  EL
Sbjct  226   MVVSSRSPKVLWRIVGLNGTLQVERGTKDGKHGYTVALFTADPSQNKNWFYPFSGVTLEL  285

Query  359   KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             + FLSD+S+A+  K G+ + E RLSF+EG RD+AVL+AMLESG+R  + VQV KF
Sbjct  286   EAFLSDVSMASLNKEGDHQVEKRLSFLEGARDVAVLDAMLESGRRGSSPVQVGKF  340



>ref|XP_010651284.1| PREDICTED: uncharacterized protein LOC100245027 isoform X3 [Vitis 
vinifera]
Length=309

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 228/355 (64%), Positives = 259/355 (73%), Gaps = 51/355 (14%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             PQIA+LG GIFV+TQYIPRLAEIS LFVLKAIWSRS+ESA   VELAR +FP+VECKWG 
Sbjct  5     PQIAVLGGGIFVRTQYIPRLAEISHLFVLKAIWSRSQESANITVELARKNFPDVECKWGE  64

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GL+EII D+SI GVAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA I+EAE AL HYNS
Sbjct  65    DGLDEIINDSSITGVAVVLAGQFQVEMSLRLLKAGKHVLQEKPAAASISEAETALSHYNS  124

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  ++  +PIWAVAENYRFEPAF ECKK++ EIGDMM++QVI+EGSMNSSNPYFSSSWRR
Sbjct  125   ICASIPGQPIWAVAENYRFEPAFVECKKLMEEIGDMMSIQVIVEGSMNSSNPYFSSSWRR  184

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRM                                        
Sbjct  185   NFTGGFILDMGVHFIAGLRM----------------------------------------  204

Query  539   AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
                       I WRVVGL GTL++ERGNK+G HGY  S +  DGQ KS FYPF GV EEL
Sbjct  205   ----------IFWRVVGLKGTLQLERGNKEGSHGYQFSFHGADGQCKSSFYPFSGVTEEL  254

Query  359   KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             KTF+ DIS A   KG   + E RLSFVEG RD+A+L+AMLESG R+GAL+QVKKF
Sbjct  255   KTFIHDISQATLKKGSSYEAETRLSFVEGARDVAILDAMLESGMRQGALIQVKKF  309



>gb|KJB66094.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=288

 Score =   340 bits (873),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 200/270 (74%), Positives = 224/270 (83%), Gaps = 2/270 (1%)
 Frame = -2

Query  1004  EMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTE  825
             ++SL+LLK GKHV+QEKPAA  I E E AL  Y S+STN  Q PIWAVAENYRFEPAF E
Sbjct  20    DISLKLLKAGKHVIQEKPAATSIPEIETALASYKSVSTNPGQ-PIWAVAENYRFEPAFVE  78

Query  824   CKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRNFFGGFILDMGVHYVAGLRMLVGCE  645
              KK++A +GDMMNVQVIIEGSMNSSNPYFSSSWRRNF GGFILDMGVH++AGLRM+VGCE
Sbjct  79    SKKLVAGVGDMMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCE  138

Query  644   VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVE  465
             VTSVSA+TSH+D+TLPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VE
Sbjct  139   VTSVSAITSHIDRTLPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVE  198

Query  464   RGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLS  288
             RG  DGKHGY VSLY  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR S
Sbjct  199   RGKVDGKHGYLVSLYSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSS  258

Query  287   FVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             FVEG RD+AVLEAMLESG + G LV VKKF
Sbjct  259   FVEGARDVAVLEAMLESGSKGGTLVNVKKF  288



>gb|KJB66101.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=259

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 181/241 (75%), Positives = 201/241 (83%), Gaps = 2/241 (1%)
 Frame = -2

Query  917  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
            L  Y S+STN  Q PIWAVAENYRFEPAF E KK++A +GDMMNVQVIIEGSMNSSNPYF
Sbjct  20   LASYKSVSTNPGQ-PIWAVAENYRFEPAFVESKKLVAGVGDMMNVQVIIEGSMNSSNPYF  78

Query  737  ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
            SSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH+D+TLPPPD IS+ F+LEN
Sbjct  79   SSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSHIDRTLPPPDIISSNFKLEN  138

Query  557  GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
            GCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY VSLY  DGQ KS F+PFC
Sbjct  139  GCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGYLVSLYSADGQCKSTFHPFC  198

Query  377  GVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
            GV EELK F+ DI  AN K G   + EPR SFVEG RD+AVLEAMLESG + G LV VKK
Sbjct  199  GVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAVLEAMLESGSKGGTLVNVKK  258

Query  200  F  198
            F
Sbjct  259  F  259



>ref|XP_010466287.1| PREDICTED: uncharacterized protein LOC104746495 [Camelina sativa]
Length=235

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 194/240 (81%), Gaps = 5/240 (2%)
 Frame = -2

Query  917  LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
            +  Y  +S +   +PIWAVAENYRFEPAF E KK++ EIGDMMNVQ+IIEGSMNSSNPYF
Sbjct  1    MSSYREISADSPSRPIWAVAENYRFEPAFVELKKLMVEIGDMMNVQLIIEGSMNSSNPYF  60

Query  737  ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
            SSSWRRN  GGFILDMGVH++AGLRMLVGCEVT VSA TSHVDKTLP PDNI++ FQLEN
Sbjct  61   SSSWRRNLSGGFILDMGVHFIAGLRMLVGCEVTLVSAATSHVDKTLPGPDNITSNFQLEN  120

Query  557  GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
            GCSGVF MVVSSRSPKI+WRVVGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF 
Sbjct  121  GCSGVFVMVVSSRSPKILWRVVGLKGTIQLERGVEGGRHGYLATIYGEGGTSRTIFYPFS  180

Query  377  GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
            GV EELK F +DIS  N+K    + EPRLS+VEG RD+AVLEAMLESG + GA+V V K 
Sbjct  181  GVTEELKAFFNDIS-ENSK----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVTKL  235



>gb|KCW51233.1| hypothetical protein EUGRSUZ_J00813 [Eucalyptus grandis]
Length=270

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 218/249 (88%), Gaps = 0/249 (0%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
             QIAILG+GIFV+TQYIPRLAEISQL ++K+IWSR++ESA  AVE+AR HFP VECKWG  
Sbjct  6     QIAILGAGIFVRTQYIPRLAEISQLVLVKSIWSRTQESATGAVEIARKHFPEVECKWGDE  65

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
             GL+EII+D SI  VAVV+AGQ QVEMSLRLLK GKHVLQEKPAAA   + E AL  Y +L
Sbjct  66    GLDEIIRDDSIPAVAVVLAGQAQVEMSLRLLKAGKHVLQEKPAAASTTDIEMALSRYRAL  125

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN  717
               +   KPIWAVAENYRFEPAF ECKK++A+IGDMMNVQVI+EGSMNSSNPYFSSSWRRN
Sbjct  126   CASSPSKPIWAVAENYRFEPAFVECKKLLADIGDMMNVQVIVEGSMNSSNPYFSSSWRRN  185

Query  716   FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFA  537
             F GGFILDMGVH++AGLRMLVGCE+TSVSA T+HVD TLPPPDN+S+ FQLENGCSGVF 
Sbjct  186   FAGGFILDMGVHFIAGLRMLVGCEITSVSATTTHVDLTLPPPDNLSSSFQLENGCSGVFV  245

Query  536   MVVSSRSPK  510
             M+VSS+SPK
Sbjct  246   MIVSSKSPK  254



>ref|XP_006445973.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59213.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=268

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 195/250 (78%), Positives = 220/250 (88%), Gaps = 0/250 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3     PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63    NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRR
Sbjct  123   ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRR  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
             NF GGFILDMGVH++AGLRM+ GCEV SVSA+TSH+DKTLPPPDNIS+ FQLENGCSGVF
Sbjct  183   NFTGGFILDMGVHFIAGLRMITGCEVVSVSAITSHIDKTLPPPDNISSNFQLENGCSGVF  242

Query  539   AMVVSSRSPK  510
              MVVSSRSPK
Sbjct  243   VMVVSSRSPK  252



>ref|XP_001762266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73058.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 247/350 (71%), Gaps = 4/350 (1%)
 Frame = -2

Query  1262  LPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             +P +A+LGSGIF  +QYIP+L E+  +  L  IWSRSE+ A+ A++LA+++ PN E KWG
Sbjct  5     IPGLALLGSGIFASSQYIPKLGELGGIVSLNTIWSRSEDGAKKALQLAKSYAPNAEAKWG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
               GLE I++D SI  VAVV+  Q Q+E+ LR L+ GKHV+QEKP    +A+  +A   Y 
Sbjct  65    QEGLESILQDKSIHAVAVVLPAQHQLEIVLRALEAGKHVIQEKPVGPSVADVRSAWSAYQ  124

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             +L+ N T+ PIWAVAENYRFEPA  +  K + E+G +M VQV+IE  MNSS+PYFSSSWR
Sbjct  125   ALAKNDTKLPIWAVAENYRFEPALIQAGKFVKELGQIMGVQVLIEAPMNSSSPYFSSSWR  184

Query  722   R--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             R  NF GGF+LD GVH++AGLRM++GCEV SVSA  SHVD TLPPPDN+SAL QL+NG +
Sbjct  185   REANFKGGFMLDGGVHFIAGLRMIMGCEVDSVSATVSHVDLTLPPPDNLSALIQLQNGTA  244

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GV  +  S++S K++WRVVG  GT+EV+R  ++G+HGY  +     G+I+  F PF GV 
Sbjct  245   GVVYICYSAKSRKMIWRVVGSLGTVEVDRTVQNGQHGYKTTYQPAKGEIQEVFCPFAGVY  304

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  219
             EEL+ F  D++     G E   + R S +E  RD+AV+EAM  S   +GA
Sbjct  305   EELRAFSEDVARCGQSGEEA--DKRSSVLEAMRDVAVIEAMFHSSDSKGA  352



>ref|XP_001754780.1| predicted protein [Physcomitrella patens]
 gb|EDQ80234.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 179/358 (50%), Positives = 236/358 (66%), Gaps = 23/358 (6%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P +A+LGSGIF  +QY+P+L E+S++  L+ IWSRSE+ A+ A+  AR++ PNVE KWG 
Sbjct  6     PGLALLGSGIFASSQYLPKLGELSEVISLRVIWSRSEDGAKKALLSARSYAPNVEAKWGQ  65

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLE I++D SI  VA+V+  Q Q+E+ LR L+ GKHV+QEKP  A +A+   A   Y +
Sbjct  66    EGLEAILQDKSIQAVAIVLPAQHQLELVLRALEAGKHVIQEKPVGASVADVRKAWSTYQA  125

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             L+ N  + PIWAVAENYRFEPA  +  K   EIG +M VQV+IE  +NSS+PYFSSSWRR
Sbjct  126   LAVNDKKLPIWAVAENYRFEPALIQTGKFAKEIGQIMGVQVLIEAPINSSSPYFSSSWRR  185

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
                 GF+LD GVH++AGLRM VGCE+ SVSA  SH D+T PPPDN+SA  QL NG +GV 
Sbjct  186   ----GFMLDGGVHFIAGLRMFVGCEIASVSATVSHFDQTQPPPDNLSASIQLWNGSAGVV  241

Query  539   AMVVSSRSPKI----------VWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  390
              +  S+ + KI          +WRVVG  GT+E ER  K+G+ GY  +     G I+  F
Sbjct  242   NICYSATTRKIQLIPGLHLQMMWRVVGSLGTVEAERVVKNGQQGYKATCQNASGDIQETF  301

Query  389   YPFCGVQEELKTFLSDISLANTKGGEC--KGEPRLSFVEGTRDIAVLEAMLESGKREG  222
              PF GV EEL+ F  D+S       +C  + + R S +E  RD+AV+EAML S   +G
Sbjct  302   SPFAGVYEELQAFAEDVS-------KCVVQADRRSSVLEAMRDVAVIEAMLNSSDNKG  352



>dbj|BAB02487.1| unnamed protein product [Arabidopsis thaliana]
Length=316

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 204/361 (57%), Positives = 247/361 (68%), Gaps = 46/361 (13%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             M     P IAILG+GIFVKTQYIPRLAEIS L  LKAIWSR+EESA+ AVE+AR HFP V
Sbjct  1     MVNPSSPGIAILGAGIFVKTQYIPRLAEISDLVDLKAIWSRTEESAKGAVEIARKHFPEV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             +CKWG  GL EII+D+SI+GVAVVVA +T VE+SL++LK GKHVLQEKPAAA I+E E A
Sbjct  61    KCKWGDEGLNEIIQDSSIVGVAVVVAAETMVELSLKMLKAGKHVLQEKPAAASISEIETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             +  Y ++S +   +PIWAVAENYRFEPAF E KK+IAEIGDMMNVQ+IIEGSMNSSNPYF
Sbjct  121   MSSYRNISADSPCRPIWAVAENYRFEPAFVELKKLIAEIGDMMNVQLIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISAL-FQLE  561
             SSSWRRN                       +V S+  ++S  D          AL F L 
Sbjct  181   SSSWRRNL---------------------SDVCSI--VSSRTD----------ALGFLLW  207

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
                 G+   V       I+WR+VGL GT+++ERG + G+HGY  ++Y   G  ++ FYPF
Sbjct  208   LCLQGLQRHV-------ILWRIVGLKGTVQLERGVEGGRHGYMATIYGEGGTSRTIFYPF  260

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
              GV EELK F +DIS  +      + EPRLS+VEG RD+AVLEAMLESG + GA+V V K
Sbjct  261   SGVTEELKAFFNDISETSK-----EQEPRLSYVEGARDVAVLEAMLESGAKNGAVVPVNK  315

Query  200   F  198
             F
Sbjct  316   F  316



>gb|KJB66100.1| hypothetical protein B456_010G128200 [Gossypium raimondii]
Length=200

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = -2

Query  794  MMNVQVIIEGsmnssnpyfssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSH  615
            MMNVQVIIEGSMNSSNPYFSSSWRRNF GGFILDMGVH++AGLRM+VGCEVTSVSA+TSH
Sbjct  1    MMNVQVIIEGSMNSSNPYFSSSWRRNFEGGFILDMGVHFIAGLRMIVGCEVTSVSAITSH  60

Query  614  VDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGY  435
            +D+TLPPPD IS+ F+LENGCSGVF MVVSS SPKI+WRVVG  GT++VERG  DGKHGY
Sbjct  61   IDRTLPPPDIISSNFKLENGCSGVFVMVVSSSSPKIIWRVVGSKGTVQVERGKVDGKHGY  120

Query  434  SVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGE-CKGEPRLSFVEGTRDIAV  258
             VSLY  DGQ KS F+PFCGV EELK F+ DI  AN K G   + EPR SFVEG RD+AV
Sbjct  121  LVSLYSADGQCKSTFHPFCGVHEELKIFIHDIVQANLKQGNGYEAEPRSSFVEGARDVAV  180

Query  257  LEAMLESGKREGALVQVKKF  198
            LEAMLESG + G LV VKKF
Sbjct  181  LEAMLESGSKGGTLVNVKKF  200



>gb|AFK42402.1| unknown [Lotus japonicus]
Length=177

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -2

Query  719  NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVF  540
            +F GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD TLPPPDNIS++F LENGCSGVF
Sbjct  4    HFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLTLPPPDNISSVFHLENGCSGVF  63

Query  539  AMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEEL  360
             MVVSSRSPKI+WRVVGLNGTL +ERG + G+HGY VS Y   GQ KS F+PF GV EEL
Sbjct  64   VMVVSSRSPKILWRVVGLNGTLHIERGFQ-GQHGYLVSSYGAVGQCKSSFFPFSGVTEEL  122

Query  359  KTFLSDISLAN-TKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
            K FL+D+S +N  KG     E RLSFVEG RD+AVLEAMLESG R+G LV VK F
Sbjct  123  KAFLNDVSESNPEKGNNFVAEQRLSFVEGARDVAVLEAMLESGARQGELVHVKNF  177



>ref|XP_002969664.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
 gb|EFJ28788.1| hypothetical protein SELMODRAFT_92921 [Selaginella moellendorffii]
Length=348

 Score =   258 bits (658),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 165/362 (46%), Positives = 225/362 (62%), Gaps = 26/362 (7%)
 Frame = -2

Query  1265  QLPQIAILGSGIFVKTQYIPRLAEISQLF-VLKAIWsrseesarsavelaRNHFPNVECK  1089
              +P +AILG+GIF  +QY+P L++ S    +LKAIWSRS+++A +A  L    FP+V  K
Sbjct  3     SVPGVAILGAGIFTTSQYLPILSKQSSTAPILKAIWSRSKDAAENAASLVAKFFPDVVAK  62

Query  1088  WGGAGLEEIIKDtsiigva----vvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaen  921
             WG  GL +I++D+SI  VA      V       +SLR LK GKHVLQ             
Sbjct  63    WGEDGLIQILEDSSIHAVAIVLPAQVQVFKLYSISLRALKSGKHVLQALSDVRD------  116

Query  920   ALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpy  741
              ++ Y+S     +Q P+WAVAENYRFEP   E  +++  IGDMM+ +VI+E  MNSSNPY
Sbjct  117   -VLSYHS--GMGSQAPVWAVAENYRFEPGLIEAARLVKSIGDMMSFEVIVELPMNSSNPY  173

Query  740   fssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             +SS+WRR+  GGF+LD GVH+VAGLR++ GCEVT VSA+  HVD  LP PDN+SAL    
Sbjct  174   YSSAWRRD--GGFVLDGGVHFVAGLRLITGCEVTQVSAIARHVDPLLPSPDNVSAL----  227

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
                  ++A   S   PK+ WRV+G  GT+E  R  KDG HGY V+ Y   G + S F+PF
Sbjct  228   -----LYAYSWSFYYPKVSWRVLGSKGTVEAVRDQKDGSHGYLVTFYPLGGTVLSKFFPF  282

Query  380   CGVQEELKTFLSDISLANTKGGECK-GEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
              GV+ ELK F+ D+S    +G   +  + R + +E   D+AV+EAML+S   +G  V V 
Sbjct  283   SGVENELKAFVGDVSQIVYEGKTAEDADKRSNVIEAYHDVAVIEAMLKSSNNKGFPVHVD  342

Query  203   KF  198
             ++
Sbjct  343   RY  344



>gb|ACU17312.1| unknown [Glycine max]
Length=225

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 191/225 (85%), Gaps = 0/225 (0%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MA  QLPQIAILG+GIFVKTQY+PRL+EIS LF+LK+IWSR++ESA +AV++AR HFP V
Sbjct  1     MATKQLPQIAILGAGIFVKTQYLPRLSEISHLFILKSIWSRTQESATAAVDIARKHFPQV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             E KWG  G ++II D SI  VAVV+AGQ QV++SLRLLK GKHVLQEKPAA+C +E E A
Sbjct  61    ETKWGDNGFDDIIHDGSIDAVAVVLAGQNQVDISLRLLKAGKHVLQEKPAASCTSELEAA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             L  Y S+S++   + IW+VAENYRFEP   ECKK+IA IG MM+VQVIIEGSMNSSNPYF
Sbjct  121   LSSYKSISSDAPGQLIWSVAENYRFEPGLVECKKLIAGIGKMMSVQVIIEGSMNSSNPYF  180

Query  737   ssSWRRNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKT  603
             SSSWRRNF GGFILDMGVH++AGLRMLVGCE+ SVSAMTSHVD T
Sbjct  181   SSSWRRNFTGGFILDMGVHFIAGLRMLVGCEIVSVSAMTSHVDLT  225



>ref|XP_002973220.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
 gb|EFJ25594.1| hypothetical protein SELMODRAFT_413759 [Selaginella moellendorffii]
Length=349

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 228/342 (67%), Gaps = 11/342 (3%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3     PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQAKWG  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
               GL++I+ D +I+GVA+V+  Q Q E  ++ LK GKHV+QEKP A    +A++    Y 
Sbjct  63    QQGLDDILNDDTILGVAIVLQPQVQGEFVMQALKAGKHVIQEKPIAPSTQQAQSLTSFYE  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             SL T    +P+WA+AENYRFE A  E  K++ +IG M+ V+V +E  MN S P FSS WR
Sbjct  123   SLGT---MRPVWAIAENYRFERALVEAHKLVKDIGHMVAVEVTVESPMNISRPSFSSIWR  179

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             R   GG++LD  VH +AGLR++ G EV SVSA+  HVD+ LPPPDN+SALF+LENGC+G 
Sbjct  180   RELKGGYVLDGAVHQIAGLRVITGSEVKSVSAICRHVDEALPPPDNVSALFELENGCAGT  239

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
               +  S  + K+ W++VG  GT+EV++  +DG+ G+ VS     G+  S FYP CGV+EE
Sbjct  240   LMISFSCTTKKMSWKIVGTKGTVEVDQDTQDGQPGFMVSHATSVGK-NSSFYPCCGVEEE  298

Query  362   LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  237
             L++F+ D+S    +GGE   + R S  E   D+AV+EA+L S
Sbjct  299   LRSFIHDLS----QGGE--ADKRSSPGEAFIDVAVIEAILNS  334



>ref|XP_002976631.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
 gb|EFJ22300.1| hypothetical protein SELMODRAFT_416506 [Selaginella moellendorffii]
Length=341

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 224/342 (65%), Gaps = 11/342 (3%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             P +A++G G F + QY P  + +++ +  LKA+WSRS+ESA  +V L ++  P V+ KWG
Sbjct  3     PSLALIGVGNFAQKQYFPLFSTKLTDVVSLKALWSRSQESAERSVSLIKDCVPGVQPKWG  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
               GL++I+ D +I+ VA+V+  Q Q E  ++ LK GKHV+QEKP A    +A+     Y 
Sbjct  63    QQGLDDILSDDTILAVAIVLQPQVQGEFVMQALKAGKHVIQEKPIAPSTQQAQGLTSFYE  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             SL T    +P+WA+AENYRFE A  E  K+  +IG M+ V+V +E  MN S   FSS WR
Sbjct  123   SLGT---MRPVWAIAENYRFERALVEAHKLAKDIGHMVAVEVTVESPMNISRSSFSSIWR  179

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             R   GG++LD  VH +AGLR++ G EV SVSA+  HVD+ LPPPDN+SALF+LENGC+G 
Sbjct  180   RELKGGYVLDGAVHQIAGLRVITGSEVKSVSAICRHVDEALPPPDNVSALFELENGCAGT  239

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
               +  S  + K+ W++VG  GT+EV++  +DG+ G+ VS     G+  S FYP CGV+EE
Sbjct  240   LMISFSCTTKKMSWKIVGTKGTVEVDQDTQDGQPGFMVSHATSVGK-NSIFYPCCGVEEE  298

Query  362   LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  237
             L++F+ D+S    +GGE   + R S  E   D+AV+EA+L S
Sbjct  299   LRSFIHDLS----QGGE--ADKRSSPGEAFIDVAVIEAILNS  334



>ref|XP_002981277.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
 gb|EFJ17465.1| hypothetical protein SELMODRAFT_114540 [Selaginella moellendorffii]
Length=338

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 161/364 (44%), Positives = 220/364 (60%), Gaps = 41/364 (11%)
 Frame = -2

Query  1262  LPQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelaRNHFPNVECKW  1086
             +P +AILG+GIF  +QY+P L+ + S   +LKAIWSRS+++A +A       FP+V  KW
Sbjct  4     VPGVAILGAGIFTTSQYLPILSNQSSTAPILKAIWSRSKDAAENAASSVAKFFPDVVAKW  63

Query  1085  GGAGLEEIIKDtsiigva----vvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             G  GL +I++D+SI  VA      V    +  +SLR LK GKHVLQ              
Sbjct  64    GEDGLIQILEDSSIHAVAIVLPAQVQVFKRYSISLRALKSGKHVLQALSDVRD-------  116

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf  738
             ++ Y+S     +Q P+WAVAENYRFEP   E  +++  IGDMM+ +VI+E  MNSSNPY+
Sbjct  117   VLSYHS--GMGSQAPVWAVAENYRFEPGLIEAARLVKSIGDMMSFEVIVELPMNSSNPYY  174

Query  737   ssSWRRN----FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  570
             SS+WRR+    + GGF+LD GVH+VAGLR++ GCEVT VSA+  HVD  LP PDN+SAL 
Sbjct  175   SSAWRRDVAFTWQGGFVLDGGVHFVAGLRLITGCEVTQVSAIARHVDPLLPSPDNVSAL-  233

Query  569   QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFF  390
                                  +WRV+G  GT+E  R  KDG HGY V+ Y   G + S F
Sbjct  234   ---------------------LWRVLGSKGTVEAVRDQKDGSHGYLVTFYPLGGTVLSKF  272

Query  389   YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  210
             +PF GV+ ELK F+ D+S    +  E   + R +F+E   D+AV+EAML+S   +G  V 
Sbjct  273   FPFSGVENELKAFVGDVSQIVYEVNES-ADKRSNFIEAYHDVAVIEAMLKSSNNKGFPVH  331

Query  209   VKKF  198
             V ++
Sbjct  332   VDRY  335



>gb|EYU46305.1| hypothetical protein MIMGU_mgv1a0096472mg, partial [Erythranthe 
guttata]
 gb|EYU46306.1| hypothetical protein MIMGU_mgv1a0096472mg, partial [Erythranthe 
guttata]
Length=150

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = -2

Query  644  VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVE  465
            + SVSA+TSHVD +LPPPD+IS+  QLE+G SGVF MVVSSRSPK++WR+VGL GTL+VE
Sbjct  1    IISVSAITSHVDTSLPPPDHISSTIQLEDGSSGVFVMVVSSRSPKVLWRMVGLKGTLQVE  60

Query  464  RGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLAN-TKGGECKGEPRLS  288
            RGNKDGKHGY+V L+  DGQ KS+FYPF GV EELKTFLSDIS+A   K G  + EPR+S
Sbjct  61   RGNKDGKHGYTVVLFTADGQTKSWFYPFSGVTEELKTFLSDISVATLKKDGRYEVEPRIS  120

Query  287  FVEGTRDIAVLEAMLESGKREGALVQVKKF  198
            F+EG RD+AVL+AMLESGKR+G  VQVKKF
Sbjct  121  FLEGARDVAVLDAMLESGKRKGETVQVKKF  150



>ref|XP_001776337.1| predicted protein [Physcomitrella patens]
 gb|EDQ58836.1| predicted protein [Physcomitrella patens]
Length=366

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 148/363 (41%), Positives = 214/363 (59%), Gaps = 18/363 (5%)
 Frame = -2

Query  1265  QLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW  1086
             +LP IA+LG G+F +  YIP L+ +S +  L+ +WSRSE  AR   E   +  P+VE +W
Sbjct  9     RLPAIALLGCGVFARDAYIPVLSSLSPIASLRYVWSRSEFKARQMQENVLHFAPDVEAEW  68

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             G AGLE I+    +   AV +   TQ  +  R L+ GKHVLQEKP A  +     ++  Y
Sbjct  69    GDAGLEIILSSQLVHCCAVALPILTQPAVVTRALRAGKHVLQEKPVAGSVEIGLKSMSFY  128

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
             +SL +     PIW VAENYRFEPAF +   M+  +G M++V V I+  M  SN YF   W
Sbjct  129   HSLPS---PAPIWTVAENYRFEPAFHDAAAMVKSLGTMVSVTVTIDVPMTKSNKYFGCEW  185

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             RR+    GGFILD GVH+VAGLR++ GC++  V+A+ +H D ++P PD ++ L + +NGC
Sbjct  186   RRDPALKGGFILDCGVHFVAGLRVMTGCDIKLVTAIATHRDPSVPAPDTLTTLIKFDNGC  245

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERG-NKDGKHGYSVSLY--MGDGQIKSFFYPF  381
             SG   +  ++   K  WRVV   GT+ VERG   DG+ GY + +   +GD  ++  FYP 
Sbjct  246   SGAMVISYAASVSKACWRVVCSKGTVIVERGVGDDGRFGYQLKMQPRVGDSSLQ--FYPL  303

Query  380   CGVQEELKTFLSDISLANTKGG----ECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  213
              G++ E K+F++D+  A    G      +G PR    E  +D+A++EA L SG    A +
Sbjct  304   SGLELEWKSFIADVQKAIDHTGYGSVNTRGSPR----EALKDLAIVEAALASGLHADAPM  359

Query  212   QVK  204
              +K
Sbjct  360   SIK  362



>ref|XP_002973823.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
 ref|XP_002983567.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ15468.1| hypothetical protein SELMODRAFT_422801 [Selaginella moellendorffii]
 gb|EFJ24778.1| hypothetical protein SELMODRAFT_414190 [Selaginella moellendorffii]
Length=341

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 216/342 (63%), Gaps = 11/342 (3%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLA-EISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG  1083
             P  A++G+G F K QY+P L+ ++      KAIWSRS+ESA SAV L ++  P V+ KWG
Sbjct  3     PGFALIGAGGFAKKQYLPLLSTKLMDRVSFKAIWSRSQESAESAVSLIKDRVPEVQPKWG  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
               G  +I+ D SIIGVA+V+  + Q   +++ L  GKHVLQEKP A    +A++ +  Y 
Sbjct  63    EEGFNDILMDNSIIGVAIVLEPEIQGTYAIQALTAGKHVLQEKPLAPSTQKAQSLVNLYK  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
              L  +   K +WA+ ENYRFE A  E  K++ +IG M+ V+VI+E  MN S P FSS WR
Sbjct  123   GLDND---KLVWAIGENYRFEQALAEASKLVKDIGHMVAVEVILESPMNISRPSFSSVWR  179

Query  722   RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             R   GG+I+D  VH +AGLR++ G E+ SVSA++ HVD  LP PDN+SAL +LENGC G 
Sbjct  180   RQLQGGYIMDSAVHQIAGLRLITGFEIRSVSAISRHVDNALPSPDNVSALIELENGCVGT  239

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
               +  S  + K+ W+VVG  GT+ V++  KD + G+ V+     G+  S FYP CGV+EE
Sbjct  240   LMISFSCITKKMSWKVVGTEGTIYVDQDVKDDQPGFLVTCSTSTGK-NSVFYPCCGVEEE  298

Query  362   LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  237
             L  F++DI++          + R S  E   D+AV+EA+L+S
Sbjct  299   LGAFINDITMGGVP------DKRSSPSEAYADVAVIEAILKS  334



>gb|KGN54118.1| hypothetical protein Csa_4G286420 [Cucumis sativus]
Length=160

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 123/156 (79%), Gaps = 3/156 (2%)
 Frame = -2

Query  665  RMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGL  486
            + LVGCEV  VSA TS+VDK+LPPPDNIS+LFQLENGCSGVF MVVSS+SPKI WRVVGL
Sbjct  8    KQLVGCEVVLVSATTSYVDKSLPPPDNISSLFQLENGCSGVFVMVVSSKSPKIFWRVVGL  67

Query  485  NGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECK  306
             GTL++ERGN+DGKHGY VS     G  +  FYPF GV EELKTF+  IS    +G + K
Sbjct  68   KGTLQIERGNQDGKHGYLVSFTDASGLNRCTFYPFSGVTEELKTFIHAIS---AEGSDDK  124

Query  305  GEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             + R+SF+EG RD+AVLEAMLESG + GA VQVK+F
Sbjct  125  ADDRISFIEGARDVAVLEAMLESGAKHGAPVQVKRF  160



>ref|XP_006445972.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
 gb|ESR59212.1| hypothetical protein CICLE_v10015756mg [Citrus clementina]
Length=219

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = -2

Query  1259  PQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             P+IAILG+GIFVKTQYIPRLAEIS L  LK IWSRSEESA+SA E+AR HF +VEC WG 
Sbjct  3     PRIAILGAGIFVKTQYIPRLAEISDLVSLKFIWSRSEESAKSAAEVARKHFADVECVWGD  62

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
              GLE+IIK+ SI+GVAVV+AGQ QV+ SL+LLK GK V+QEKPAAA I+E ENAL  YNS
Sbjct  63    NGLEQIIKEDSILGVAVVLAGQAQVDTSLKLLKAGKQVIQEKPAAANISEIENALSRYNS  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR  720
             +  +   +PIWAVAENYRFEPAF ECKK+IAEIGDMM+VQVI+EGSMNSSNPYFSSSWRR
Sbjct  123   ICPDPPGQPIWAVAENYRFEPAFVECKKLIAEIGDMMSVQVIVEGSMNSSNPYFSSSWRR  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEVT  639
             NF GGFILDMGVH++AGLRM++   +T
Sbjct  183   NFTGGFILDMGVHFIAGLRMVISYSLT  209



>gb|KGN54119.1| hypothetical protein Csa_4G286920 [Cucumis sativus]
Length=175

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 147/208 (71%), Gaps = 38/208 (18%)
 Frame = -2

Query  1268  SQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECK  1089
             ++LPQIAILG+G FVKTQY+PRLAEIS L ++KAIWSR+E SA+ AV++ARN+FP VECK
Sbjct  2     AKLPQIAILGAGTFVKTQYLPRLAEISDLLIVKAIWSRTEASAKGAVDIARNYFPTVECK  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
             WG AGL++II+D+SI+GVAVV+AGQ QV+MSLRLLK GKHVLQEKPAAA  +E E AL +
Sbjct  62    WGDAGLDDIIQDSSILGVAVVLAGQAQVDMSLRLLKAGKHVLQEKPAAASTSELEYALSN  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y SLS N +++ +WAVAENYRFEPAF E                                
Sbjct  122   YKSLSANFSRQRLWAVAENYRFEPAFVE--------------------------------  149

Query  728   WRRNFFGGFILDMGVHYVAGLRMLVGCE  645
                    GFILDMG+H++AGLRM+   E
Sbjct  150   ------RGFILDMGIHFIAGLRMVTAFE  171



>gb|EYU46309.1| hypothetical protein MIMGU_mgv1a0096471mg, partial [Erythranthe 
guttata]
Length=147

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 123/151 (81%), Gaps = 4/151 (3%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV  1098
             MAE + PQIAILG+GIFV+  YIPRLAEIS L VL+AIWSR++ESAR AVE+A+ +FP+V
Sbjct  1     MAEQRPPQIAILGAGIFVRNTYIPRLAEISNLLVLRAIWSRTQESARGAVEIAKQYFPDV  60

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             ECKWG AGL +II D SI+GVAVV+AGQTQV+MSLR LK GKHVLQEKPAAA + E E A
Sbjct  61    ECKWGEAGLNDIILDASIVGVAVVLAGQTQVDMSLRFLKAGKHVLQEKPAAASVNELETA  120

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTE  825
             +  YNS +      PIWAVAENYRFEPAF E
Sbjct  121   ISSYNSFNP----APIWAVAENYRFEPAFVE  147



>gb|KEQ84242.1| NAD(P)-binding protein [Aureobasidium pullulans EXF-150]
Length=346

 Score =   135 bits (339),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 112/359 (31%), Positives = 191/359 (53%), Gaps = 28/359 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA-  1077
             IA++GSGIF++  ++P +     LF L AI+SRS  SA+   +   +  P++  +  G+ 
Sbjct  5     IAVIGSGIFIQEAHLPGIKANGDLFSLNAIYSRSLASAQKLSKEVESTTPDLYAEDAGSD  64

Query  1076  -GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
                 ++++ + +  V + +    Q E   + L  GKHVL EKP A  +A A   +  Y+ 
Sbjct  65    KSYAKLLERSDVEAVVIALPILAQPEFIKKALSAGKHVLSEKPVAKDLATAHELIDWYH-  123

Query  899   LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
               TN+ T+K IWAVAEN+R+   F    + + E+GD++  ++ +   +     Y+ + WR
Sbjct  124   --TNIDTKKTIWAVAENFRYLGRFQYGAEQVKELGDILGFRLRMHAFVKPGAKYYETEWR  181

Query  722   RN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             +   + GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A  +L NG
Sbjct  182   KTPEYQGGFLLDGGVHFIAAMRQLLGQEAKMSQVAAFTAQLQPHLPPIDTINATVKLANG  241

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSFFYPF  381
              SG F++   +      + V   NGT++V         G+  ++   DG    K F    
Sbjct  242   TSGTFSVSFGTTFSGAEYIVACQNGTVDV---------GFDKTIVKKDGNESTKDFTEDK  292

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
              GV++ELK +   I+       + K  P  +  E   D+ VLEAM++SG+ +G  +++K
Sbjct  293   NGVRQELKAWGESIA-------QGKAHPLQTPEEALADLEVLEAMIKSGEADGKAIELK  344



>gb|KEQ74017.1| NAD(P)-binding protein [Aureobasidium namibiae CBS 147.97]
Length=347

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 114/357 (32%), Positives = 188/357 (53%), Gaps = 24/357 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA-  1077
             IA++GSGIFV+  ++P +     LF LKAI+SRS  SA+   +      P++  +  G+ 
Sbjct  5     IAVIGSGIFVQEAHLPGIKANKDLFSLKAIYSRSLSSAQKLSKEVETFTPDLYAEDAGSD  64

Query  1076  -GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
                 +++K + +  V + +   TQ +   + L  GKHVL EKP A  +  A   +  Y+ 
Sbjct  65    KSYADLLKRSDVEAVVIALPILTQPDFIKKALLAGKHVLSEKPVAKDLTTAHELIDWYHK  124

Query  899   LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
                N+ T+K IWAVAEN+R+   F    + + E+G+++  ++ +   +     Y+ + WR
Sbjct  125   ---NIDTKKTIWAVAENFRYLGRFQYGAERVKELGEILGFRLRMHALVQPGAKYYETEWR  181

Query  722   RN--FFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             +   + GGF+LD GVH++A +R L+G   ++T V+A T+ +   LPP D I+A  +L NG
Sbjct  182   KTPEYQGGFLLDGGVHFIAAMRQLLGQSAKMTHVAAFTAQLQPHLPPLDTINATVKLANG  241

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCG  375
              SG F++   +      + V   NGT++V       K G        D   K F     G
Sbjct  242   RSGTFSVSFGTTFSGAEYVVACQNGTVDVGFDKTIVKKG-------KDESSKDFLEDKNG  294

Query  374   VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
             V++ELK +   I     KG   K +P  S  E   D+ VLE+M++SG+ +G  +++K
Sbjct  295   VRQELKAWGESIQ----KG---KADPMQSPEEALADLEVLESMIKSGEADGKAIELK  344



>gb|KEQ61018.1| oxidoreductase-like protein family [Aureobasidium melanogenum 
CBS 110374]
Length=346

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 112/359 (31%), Positives = 191/359 (53%), Gaps = 28/359 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA-  1077
             IA++GSGIFV+  ++P +     LF LKA +SRS  SA+   +   +  P++  +  G+ 
Sbjct  5     IAVIGSGIFVQEAHLPGIKANGDLFSLKATYSRSLSSAQKLSKAVESSIPDLYAEDAGSD  64

Query  1076  -GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
                 ++++ + I  V + +    Q     + L  GKHVL EKP A  +A A   +  YN 
Sbjct  65    KSYAKLLERSDIEAVVIALPILAQPNFIKKALSAGKHVLSEKPIAKDLATAHELIDWYNK  124

Query  899   LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
                N+ T+K IWAVAE++R+   F    + + E+GD++  ++ +  S+     Y+ + WR
Sbjct  125   ---NIDTKKTIWAVAEHFRYLGRFQYGAEQVKELGDVLGFRLRMHASVGPGAKYYETEWR  181

Query  722   RN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             +   + GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A  +L NG
Sbjct  182   KKPEYQGGFLLDGGVHFIAAMRQLLGQEAKMSQVAAFTAQLQPHLPPIDTINATVKLANG  241

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP--F  381
              SG F++   +      + V    GT++V         G+  ++   DG+  S  +P   
Sbjct  242   RSGTFSVSFGTTFSGAEYVVACQKGTVDV---------GFDKTIVKKDGKESSKDFPEDK  292

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
              GV++ELK +   IS         K +P  +  E   D+ VLE+M++SG+ +G  +++K
Sbjct  293   NGVRQELKAWGESIS-------RGKADPLQTPQEALADLEVLESMIKSGEADGKAIELK  344



>gb|EFQ28397.1| oxidoreductase family protein [Colletotrichum graminicola M1.001]
Length=347

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 190/358 (53%), Gaps = 26/358 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF-PNVECKWGGA  1077
             +AI+G GIF K Q++P + E S    LKAI+SRS +SA    +LA N   P++     G 
Sbjct  6     VAIVGGGIFAKEQHLPAV-EASDQLTLKAIYSRSRKSAEDTAKLATNSASPDLYSDDSGD  64

Query  1076  G--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   E+++    I  + + +    Q E   + L  GKHVL EKP A  +A A+  + +YN
Sbjct  65    GKSFEDLLARDDIQALILALPIVNQPEYIEKALAAGKHVLAEKPIAPDVARAQKLIDYYN  124

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
              +S    +   +AVAENYRF+P +T  +  +  +G ++   V +   +     Y  ++WR
Sbjct  125   KVSAE--KGVTFAVAENYRFQPRYTAARDEVQTLGKIIGFNVRVFFYVQLGGKYIETTWR  182

Query  722   R--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENG  555
             +  ++ GGF+LD GVH+ A LR+L+G E    SV+A +    + LPP D I+A  +  +G
Sbjct  183   KKPDYQGGFLLDGGVHFAAALRLLLGKEAAADSVAAFSDLTQEHLPPIDTINAAIRTRSG  242

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF-FYPFC  378
              +G FA+ V S      ++V G  G++ +         G+ +++ + DG+ ++  F    
Sbjct  243   ATGSFAVSVGSSLSAFDFQVAGEKGSVTL--------SGHDLTVKLFDGEARTIQFEQTS  294

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
             GV+EE+K +   +          +  P  S  E   D+ +LE + +SG+++GA+ +++
Sbjct  295   GVKEEVKAWAEGLVAG-------RPNPLQSPEEALADLELLEKIFKSGEKDGAVQKLQ  345



>gb|KEQ94380.1| hypothetical protein AUEXF2481DRAFT_270651 [Aureobasidium subglaciale 
EXF-2481]
Length=346

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 110/356 (31%), Positives = 188/356 (53%), Gaps = 28/356 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA-  1077
             IA++GSGIFV+  ++P +      F LKAI+SRS  SA+   +   +  P++  +  G+ 
Sbjct  5     IAVIGSGIFVQEAHLPGIKANGDQFSLKAIYSRSLASAQKLSKEVESSTPDLYAEDAGSD  64

Query  1076  -GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
                 ++++ + +  V + +    Q +   + L  GKHVL EKP A  +  A   +  Y+ 
Sbjct  65    KSYAKLLERSDVEAVVIALPILAQPDFIKKALSAGKHVLSEKPVAKDLKTAHELINWYHE  124

Query  899   LSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
                N+ T+K IWAVAEN+R+   F    + + E+GD++  ++ +  ++     Y+ + WR
Sbjct  125   ---NIDTKKVIWAVAENFRYLGRFQYGAEQVKELGDILGFRLRMHANVKPGAKYYETEWR  181

Query  722   RN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             +   + GGF+LD GVH++A +R L+G E  ++ V+A T+ +   LPP D I+A  +L NG
Sbjct  182   KTPEYQGGFLLDGGVHFIAAMRQLLGEEARMSQVAAFTAQLQPHLPPIDTINATVKLTNG  241

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLY-MGDGQI-KSFFYPF  381
              SG F++   +      + V   +GT++V         G+  ++   GD +I K F    
Sbjct  242   RSGTFSVSFGTTFSGAEYIVACQDGTVDV---------GFDKTIVKKGDNEITKEFPEDK  292

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  213
              GV++ELK +   IS         K +P  S  E   D+ VLE+M++SG+  G  +
Sbjct  293   NGVRQELKAWGESIS-------RGKADPLQSPEEALADLEVLESMIKSGEANGKAI  341



>emb|CCF43203.1| oxidoreductase [Colletotrichum higginsianum]
Length=348

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 183/352 (52%), Gaps = 24/352 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave-laRNHFPNVECKWGGA  1077
             +AI+G GIF K Q++P + E S    LKAI+SRS +SA    + + ++  P++     G 
Sbjct  6     VAIVGGGIFAKEQHLPAV-EASDQLTLKAIYSRSHKSAEDTAKLVTKSTSPDLYSDDSGD  64

Query  1076  G--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   ++++    I  + + +    Q E   + L  GKHVL EKP AA ++ A+  + +YN
Sbjct  65    GKSFKDLLARNDIQALILALPIVNQPEYIEQALAAGKHVLAEKPIAADVSRAQKLIEYYN  124

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
              +S    Q   +AVAENYRF+P +T  +  + ++G ++   V +   +     Y  ++WR
Sbjct  125   KVSAE--QGVTFAVAENYRFQPRYTTARDEVQKLGKIIGFNVRVFFFVQLGGKYIETAWR  182

Query  722   R--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENG  555
             +  ++ GGF+LD GVH+ A LR+L+G E    SV+A +    K LPP D I+A+ +  +G
Sbjct  183   KKPDYQGGFLLDGGVHFAAALRLLLGKEAAPDSVAAFSDLTQKHLPPIDTINAIVRTRSG  242

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCG  375
              +G FA+ V S      + V G  G++ +        H  +V  + G+ +    F    G
Sbjct  243   ATGSFAVSVGSPLSAFDFHVAGEKGSVTL------SSHDLTVKPFDGEARTAQ-FEQTSG  295

Query  374   VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  219
             V+EE+K +   +          K  P  S  E   D+  LE + +SG+++GA
Sbjct  296   VKEEVKAWAEGLVAG-------KPNPLQSPEEALADLEFLEKIFKSGEQDGA  340



>gb|ENH79899.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
orbiculare MAFF 240422]
Length=349

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 113/358 (32%), Positives = 184/358 (51%), Gaps = 25/358 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF--PNVECKWGG  1080
             +AI+G GIF K Q++P +    QL  LKAI+SRS +SA     L  N    P++     G
Sbjct  6     VAIVGGGIFAKEQHLPAVQATPQL-ALKAIYSRSRKSAEDTASLVTNAAASPDLYSDDSG  64

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G   ++++    I  + + +    Q E   + L  GKHVL EKP AA +A A+  + HY
Sbjct  65    PGKSFKDLLARDDIQALILALPIVNQPEYIEQALAAGKHVLAEKPVAAHVARAQKLIQHY  124

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
             N +S        +AVAENYRF+P +T  +  + ++G ++     +   +N    Y  + W
Sbjct  125   NDISAK--NGVTFAVAENYRFQPRYTTARDEVQKLGRVIGFNARVFFFVNLGGKYIETEW  182

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLEN  558
             R+   + GGF+LD GVH+ A LR+L+G +    SVSA ++     LPP D ++A+ + ++
Sbjct  183   RKKPAYQGGFLLDGGVHFAAALRLLLGSDAAPLSVSAFSALTRDHLPPIDTVNAVVKTKS  242

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             G  G FA+ V S      ++V   NG++ V        H  +V  + G+ +    F    
Sbjct  243   GAIGSFAVSVGSTLNAFDFQVACENGSVTV------SSHELTVKPFEGEARTVR-FEETN  295

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
             GV+EE+K +   ++         K  P  S  E   D+  LE + +SG+++GAL +++
Sbjct  296   GVKEEVKAWAEALAAG-------KPNPLQSPEEALADLEFLEKIFQSGEQDGALQKLE  346



>gb|KDQ06959.1| hypothetical protein BOTBODRAFT_60302 [Botryobasidium botryosum 
FD-172 SS1]
Length=354

 Score =   120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 125/368 (34%), Positives = 189/368 (51%), Gaps = 39/368 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             IAILG+GIF K  ++P +       VL+A++SRSE SA +    A++   N++  +   G
Sbjct  7     IAILGAGIFAKEAHLPAIQAAGDKVVLRAVYSRSEGSAGTFAAFAQSTL-NIDVPFYHDG  65

Query  1082  G---AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             G     L+ ++    I  V VV+   TQ E+ ++ LK GKHVL EKP A  +A A   + 
Sbjct  66    GDPTKSLDSLLAREDIAAVIVVLPINTQPEIIVKALKAGKHVLSEKPVARDVASALKLIK  125

Query  911   HYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGsmnssn  747
              Y         KP   IW VAEN+  EP +   KK+IA  EIG +    + +   ++ S+
Sbjct  126   TYEE-----EYKPKGLIWRVAENFEVEPGYLFAKKVIADGEIGKLQYFNLSLVAFVDESS  180

Query  746   pyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISAL  573
              ++ + WR    + GGF+LD GVH+ A LR ++   +T VSA  S     L P D I+A+
Sbjct  181   KWYQTPWRTKPEYQGGFLLDGGVHFTALLRTILPSPITEVSAFASLNKAILAPHDTINAI  240

Query  572   FQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ  405
              +  +G  G+    F    S+R       + G  G +++    KDGK    V ++ GD +
Sbjct  241   LRCADGTHGIWELSFGSPSSTRGALNATSITGTEGWIQIGNTQKDGKTHIKVDVHKGD-E  299

Query  404   IKSFFYPFCGVQEELKTFLSDISLANTKGG--ECKGEPRLSFVEGTRDIAVLEAMLESGK  231
              K+   P CGV++EL+ FL  +      GG  E  GEPR       +D+A +EA L S  
Sbjct  300   TKTTVLPSCGVEKELEHFLELL------GGRDEGFGEPRSVL----KDVAFIEAALNS--  347

Query  230   REGALVQV  207
              EG L+++
Sbjct  348   -EGNLIKL  354



>ref|XP_001942427.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU47289.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=349

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 115/364 (32%), Positives = 181/364 (50%), Gaps = 35/364 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaR----NHFPNVECKW  1086
             IA++GSGIF K +++P +     L  LKAI+SRS  S                       
Sbjct  6     IALIGSGIFAKEEHLPAILAADSL-SLKAIYSRSRASVEGLASGLSEGVGKELELYSDDT  64

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G G +E++K   I GV + +    Q E   + L  GK+VL EKP A  +A A   L   
Sbjct  65    EGKGYDELLKREDIGGVVIALPILVQPEYITKALAAGKYVLAEKPIAKDVATARALL---  121

Query  905   NSLSTNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             + +STN+ +  P  ++AEN+RF   F      I  +G ++  ++ +   +  S+ YF ++
Sbjct  122   DWISTNVPSGGPTLSIAENFRFLDYFLYAAAEIKSLGRLLGFRMRVHSLVKPSSKYFETA  181

Query  728   WRRN--FFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNISALFQL  564
             WR+   + GG +LD GVH+VAG+R+++G    ++   SA T+ + + L P D + A  QL
Sbjct  182   WRKKPEYQGGLLLDGGVHFVAGIRLILGGSGVKIVKTSAFTTRLQEHLSPVDTVDATMQL  241

Query  563   ENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKS  396
              NG SG  ++   ++     +      GT+ V R      +DG+HG          ++K 
Sbjct  242   SNGASGTASISFGTQFSGSEYAFACEKGTVVVTRAKVAVKRDGEHG----------EVKE  291

Query  395   FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  216
             F     GV+ E+  +   +        E K +PR S  EG RD+ VLEAML SG++ GA 
Sbjct  292   FKDEGSGVKPEVAAWGKGLQ-------EGKMDPRQSAEEGLRDLEVLEAMLTSGEKGGAP  344

Query  215   VQVK  204
             V++K
Sbjct  345   VELK  348



>ref|XP_007603283.1| oxidoreductase [Colletotrichum fioriniae PJ7]
 gb|EXF73078.1| oxidoreductase [Colletotrichum fioriniae PJ7]
Length=348

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 108/353 (31%), Positives = 186/353 (53%), Gaps = 24/353 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave-laRNHFPNVECKWGGA  1077
             +AI+G GIF K +++P + E S    LKAI+SRS +SA+   + + ++  P++     G 
Sbjct  6     VAIVGGGIFAKEEHLPAV-EASDNLTLKAIFSRSLKSAQDTAKLVTKSASPDLYSDDAGE  64

Query  1076  G--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   ++++    I  + + +    Q +   + L  GKHVL EKP AA IA A+  + +Y 
Sbjct  65    GKSFKDLLARDDIQALILALPILNQPDYIKQALAAGKHVLAEKPIAADIARAQELIEYYK  124

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
              +S    +   +AVAENYRF+P +T  +  + ++G ++   V +   +     Y  ++WR
Sbjct  125   KVSAE--KGVTFAVAENYRFQPRYTTARDELRKLGKVIGFNVRVFFFVKLGGKYIETAWR  182

Query  722   R--NFFGGFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENG  555
             +  ++ GGF+LD GVH+ A LR+L+G +    SV+A +    + LPP D I+A+ + + G
Sbjct  183   KKPDYQGGFLLDGGVHFAAALRLLLGKDAAPASVAAFSDLTREHLPPIDTINAVVKTKQG  242

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCG  375
              +G FA+ V S      + V G NG++ +        H  +V  + G+    + F    G
Sbjct  243   ATGSFAVSVGSTLSAFDFHVAGENGSVTL------SSHDLTVKPFDGEATT-THFEQTSG  295

Query  374   VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  216
             V+EE+K +   + +A T        P  S  E   D+  LE +  SG+++GA+
Sbjct  296   VKEEVKAWAEGL-VAGTPN------PLQSAEEALADLEFLEKIFTSGEQDGAI  341



>ref|XP_011117421.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53811.1| hypothetical protein AOL_s00004g470 [Arthrobotrys oligospora 
ATCC 24927]
Length=366

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 184/356 (52%), Gaps = 32/356 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC----KW  1086
             +AILGSGIFV++Q+ P   +  +L  LKAI+SR + S  S +    N    ++       
Sbjct  6     VAILGSGIFVESQHKPACLQDPELLTLKAIYSRRKTSVESIIA---NETIPIDVYSDDSE  62

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G  L++++K + I  V + +    Q E   + L  GKHVL EKP A  +A A   +   
Sbjct  63    PGNNLDDLLKRSDIAFVIIALPIPHQPEFIKKALSAGKHVLSEKPVAKDLATANELIRWK  122

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
              + + ++    IW+VAEN+R+ PAF   ++ +  +G ++   V +   +     YF ++W
Sbjct  123   KTNAPDL----IWSVAENFRYWPAFDYAEEKVKSLGKVLAFHVEVLQLVAPGGKYFETAW  178

Query  725   RR--NFFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             R+   + GGF LD GVH+ A LR LVG  ++ S+SA T+     LPP D I +  +L++G
Sbjct  179   RKVPTYQGGFCLDAGVHFTAALRRLVGEDQIASLSAFTNLAQPHLPPIDTIMSTIKLKSG  238

Query  554   CSGVFAMVVSSRSPKIV-WRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKSFF  390
               G FAM   + + K+  W +V   GT++V  G     K  +     + + GD       
Sbjct  239   VCGTFAMSHGTPATKVFEWFIVCEQGTVKVSDGPKVVVKQLEMPEEWTEFGGDRN-----  293

Query  389   YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
               + GV++E++ F+   S+ N KG E      LS      D+ ++E M++SG++ G
Sbjct  294   -EWSGVKKEVRVFVE--SVKNGKGVEG-----LSPENALADLEMIEKMIQSGEQGG  341



>gb|KEH18356.1| NAD(P)-binding rossmann-fold protein, putative [Medicago truncatula]
Length=114

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -2

Query  488  LNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC  309
            +NGTL++ER  + G+HGY +SLY   G+ KS F+PF GV EELK F +D+S  NT   + 
Sbjct  1    MNGTLQIERRFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEELKAFFNDVS-ENTLKKDS  58

Query  308  KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
            + E  LSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  59   QPEHCLSFVEGARDVALLEAMLESGSKQGELVHVKKF  95



>ref|XP_007785079.1| hypothetical protein W97_09025 [Coniosporium apollinis CBS 100218]
 gb|EON69762.1| hypothetical protein W97_09025 [Coniosporium apollinis CBS 100218]
Length=342

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 111/359 (31%), Positives = 182/359 (51%), Gaps = 31/359 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG+F K +++P +     L  LKAI+SRS +SA+S  E   N     +    G  
Sbjct  5     VAIIGSGMFAKDEHLPAVQAAPSL-TLKAIYSRSLKSAKSLAENLSNADLYSDDSGEGKS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++  + I  V + +   TQ     + L+  KHVL EKP A  +A A   +  Y+   
Sbjct  64    YSDLLARSDIQAVIIGLPILTQPTYIRQALEASKHVLAEKPVAKDVATATELVKWYHD--  121

Query  893   TNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN  717
              N+ T K  W+VAEN+RF  +F    + + ++G ++  +  +   +     YF ++WR+ 
Sbjct  122   -NVDTSKVTWSVAENFRFMDSFLHGAEQVRQMGRVLGFRTRMHAFVKPGTKYFETAWRKT  180

Query  716   --FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
               + GGF+LD GVH++AG R+L+  E   T VSA T+ + + LPP D + A ++ ++G S
Sbjct  181   PEYQGGFLLDGGVHFIAGTRLLLQPENAPTRVSAFTARLQEHLPPVDTVDATWKTKSGVS  240

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKSFFYPF  381
             G F++   +      + +    GT+ V R      KDGK            + K F    
Sbjct  241   GTFSVSFGTTFSGSEYTLACEKGTVTVLRSMVKIVKDGKE-----------ETKEFSGEG  289

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
              GV++E+K +   I   N        +PR +  E  +D+ VLEAML+SG+  G  + +K
Sbjct  290   AGVKQEVKAWGEGIESGNQ-------DPRQTPEEALKDLEVLEAMLQSGEGNGVPIDLK  341



>gb|EMD87949.1| hypothetical protein COCHEDRAFT_1183091 [Bipolaris maydis C5]
 gb|ENI03464.1| hypothetical protein COCC4DRAFT_82671 [Bipolaris maydis ATCC 
48331]
Length=343

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 107/363 (29%), Positives = 185/363 (51%), Gaps = 37/363 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             +AI+GSGIF K +++P + + + +  LKA++SRS +SA+S           V+       
Sbjct  5     VAIIGSGIFAKEEHLPAIQD-APILSLKAVYSRSLKSAQSLS----EKLSGVDLYSDDQD  59

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   ++++K   I GV + +    Q +   + L  GKHV   +   A      ++L+ + 
Sbjct  60    GKKFDDLLKRDDIKGVVIALPIPAQPDYIKKALAAGKHVF-AEKPIAKDLSTASSLLAWT  118

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             S   N +    + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ ++WR
Sbjct  119   SNPANTSA--TYTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFPVPVGSKYYETAWR  176

Query  722   RN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +     GGF+LD GVH+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLEN
Sbjct  177   KKPEHQGGFVLDGGVHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDTLNAVLQLEN  236

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFF  390
             G SG  ++ V S      + V    G + V RG     + GK          D + K F 
Sbjct  237   GSSGTLSISVGSTDQGAEYVVACEKGVVTVSRGKVVIKRQGK----------DDEAKEFP  286

Query  389   YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  210
                 GV++E+K +    SL + K  E +     S  E  +D+ +LE+ L+SG++ G  + 
Sbjct  287   DEGNGVKQEIKAWAK--SLEDGKRNEMQ-----SPEEALKDLEILESCLKSGEQAGTPID  339

Query  209   VKK  201
             VK+
Sbjct  340   VKQ  342



>ref|XP_007713573.1| hypothetical protein COCCADRAFT_99511 [Bipolaris zeicola 26-R-13]
 gb|EUC32122.1| hypothetical protein COCCADRAFT_99511 [Bipolaris zeicola 26-R-13]
Length=343

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 106/360 (29%), Positives = 184/360 (51%), Gaps = 30/360 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             IA++GSGIF K +++P + + + +  LKA++SRS +SA+S  E              G  
Sbjct  5     IALIGSGIFAKEEHLPAIQD-APVLSLKAVYSRSLKSAQSLSEKLSG-IDLYSDDQDGKK  62

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++K   I GV + +    Q +   + L  GKHV   +   A      ++L+ + S S
Sbjct  63    FDDLLKRDDIKGVVIALPIPAQPDYIKKALAAGKHVF-AEKPIAKDLSTASSLLAWTSNS  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
              N +    + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ + WR+  
Sbjct  122   ANTS--ATYTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFPVPVGSKYYETEWRKKP  179

Query  716   -FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
                GGF+LD G+H+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLENGCS
Sbjct  180   EHQGGFVLDGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPLDTLNAVLQLENGCS  239

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPF  381
             G  ++ V +      + V    G + V RG     + G+          + Q K F    
Sbjct  240   GTLSISVGTTDKGSEYVVACEKGVVTVSRGKVVVKRQGEE---------EEQTKEFPDEG  290

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
              GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + VK+
Sbjct  291   NGVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQSGTPIDVKQ  343



>gb|KEH18355.1| NAD(P)-binding rossmann-fold protein, putative [Medicago truncatula]
Length=125

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 2/97 (2%)
 Frame = -2

Query  488  LNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGEC  309
            +NGTL++ER  + G+HGY +SLY   G+ KS F+PF GV EELK F +D+S  NT   + 
Sbjct  1    MNGTLQIERRFQ-GQHGYLISLYDAHGECKSSFFPFSGVTEELKAFFNDVS-ENTLKKDS  58

Query  308  KGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
            + E  LSFVEG RD+A+LEAMLESG ++G LV VKKF
Sbjct  59   QPEHCLSFVEGARDVALLEAMLESGSKQGELVHVKKF  95



>ref|XP_003300258.1| hypothetical protein PTT_11448 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91648.1| hypothetical protein PTT_11448 [Pyrenophora teres f. teres 0-1]
Length=342

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 180/363 (50%), Gaps = 37/363 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             IA++GSGIF K +++P + +   L  LKA++SRS +SA++          +VE       
Sbjct  5     IALIGSGIFAKEEHLPAIQDTPSL-SLKAVYSRSLKSAKALS----EKLSDVEVYSDDQD  59

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   E+++K   + GV + +    Q +   + L  GKHV   +   A        L+ + 
Sbjct  60    GNKFEDLLKKNDVKGVVIALPIPAQPDYIKKALAAGKHVF-AEKPIAKDLATAQELLSWT  118

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
               ++N +   I+AVAEN+RF  ++    + ++ +G +++ +V +   +   + Y+ + WR
Sbjct  119   QDASNTS--AIYAVAENFRFIDSYVWGSQQVSSMGRILSFRVRVALLVQPGSKYYETEWR  176

Query  722   RN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +     GGF+LD GVH+VA  R+L+   G ++T VSA T+ + + LPP D ++A  QL+N
Sbjct  177   KKPEHQGGFLLDGGVHFVAATRLLLQGGGQKITKVSAFTAQLQEYLPPVDTLNATMQLDN  236

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFF  390
             G SG  ++   +      + V    G++ V RG     +DGK            + K F 
Sbjct  237   GASGTLSISFGTTDTGSEYLVACEKGSVHVSRGKVVVTRDGKK----------AETKEFP  286

Query  389   YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  210
                 GV +E+K +   +   N    +       S  E  +D+ +LE  L+SG++ G  + 
Sbjct  287   DEGNGVNQEIKAWAKSLEEGNRNEMQ-------SPEEALKDLEILEVCLKSGEQGGKPID  339

Query  209   VKK  201
             VK+
Sbjct  340   VKQ  342



>ref|XP_003347717.1| hypothetical protein SMAC_03815 [Sordaria macrospora k-hell]
 emb|CCC11108.1| unnamed protein product [Sordaria macrospora k-hell]
Length=355

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 109/365 (30%), Positives = 176/365 (48%), Gaps = 37/365 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH---FPNVECKWG  1083
             +A+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A N    + +V    G
Sbjct  4     VALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASNPVDVYYDVPTGTG  62

Query  1082  GA--GLEEIIKDtsiigvavvvagqtqVEMSL-----RLLKGGKHVLQekpaaaciaeae  924
              A  G EE   D  +    +         ++      + LK GKHVL EKP A  +  A+
Sbjct  63    EAKVGPEEKTLDALLARTDIDAVVIALPILAQPAVIQKALKAGKHVLSEKPVAKDVEAAK  122

Query  923   nALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmnssn  747
               +  Y  L     +KP+WAV ENYR+ P+     + + E+ G +   ++ + G +   N
Sbjct  123   GLIEFYAGLEQGEKKKPLWAVGENYRYTPSLMAAAEKVKEVGGKLTTFRLNMNGWVEEEN  182

Query  746   pyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNI  582
              YF + WR+  ++ GGF+LD GVH+VAGLR+L+     +++ V   +  +++ L P D +
Sbjct  183   KYFKTEWRKVPSYQGGFLLDGGVHFVAGLRLLLSSLDQDISQVVGFSHLLEERLLPVDTV  242

Query  581   SALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGK---HGYSVSLYMGD  411
              A+     G SG  ++   ++              LEVE    +G    +   V     D
Sbjct  243   HAVALTSEGKSGTISISFGTQ----------FKSGLEVEVVTTNGSVYWNPTEVKTKTKD  292

Query  410   GQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGK  231
             G+    F    GV+EE+  F   I    T+  +    P     E  RD+ V++ +LESG+
Sbjct  293   GEKAEQFERRSGVKEEMAAFAQAIERGKTEKNQT---PE----EALRDLEVVQRLLESGE  345

Query  230   REGAL  216
              +GA+
Sbjct  346   AKGAV  350



>ref|XP_008025728.1| hypothetical protein SETTUDRAFT_135946 [Setosphaeria turcica 
Et28A]
 gb|EOA87278.1| hypothetical protein SETTUDRAFT_135946 [Setosphaeria turcica 
Et28A]
Length=346

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 101/362 (28%), Positives = 181/362 (50%), Gaps = 31/362 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             IA++GSGIF K +++P + +   L  LKA++SR+ +SA++  E   +     + +  G  
Sbjct  5     IALIGSGIFAKEEHLPAIQDTPSLH-LKAVYSRTLKSAQALAEKLSDVALYSDDQDDGKK  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              +++++   I  V + +    Q     + L  GKHVL  +   A       +L+ +   +
Sbjct  64    FDDLLQRDDIQAVVIALPILAQPTYIKQALAAGKHVL-AEKPIAHDVATAQSLLSWTCDA  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
              N +    + VAEN+RF  +FT   + +A +G ++   V +   +++ + Y+ +SWR+  
Sbjct  123   KNAS--ATYRVAENFRFLDSFTWAAQQLASLGRVLTFGVRVAAMVHAGSKYYETSWRQKP  180

Query  716   -FFGGFILDMGVHYVAGLRMLV----GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
              + GGF+LD G+H+VA  R+L+    G ++T  +A T+ +   LPP D ++A  QL+NG 
Sbjct  181   EYQGGFVLDGGIHFVAATRLLLHGAGGRKITKAAAFTAQLQPHLPPVDTLNATLQLDNGA  240

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKH-GYSVSLYMGDGQIKSFFY  387
             SG F++   +      + V    GT+ V RG     + G+        + G+G       
Sbjct  241   SGTFSVSFGTSDSASEYLVACERGTVHVSRGKVVVRRQGREDAEETREFPGEGN------  294

Query  386   PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  207
                GV+ E+K +   +         C  E + S  E   D+ VLEA L+SG + G  V+V
Sbjct  295   ---GVKSEIKAWAQSLEQG------CPNEMQ-SPQEALSDLQVLEACLKSGGQGGTPVEV  344

Query  206   KK  201
             ++
Sbjct  345   QQ  346



>gb|ERT03209.1| hypothetical protein HMPREF1624_01515 [Sporothrix schenckii ATCC 
58251]
 gb|KJR84369.1| hypothetical protein SPSK_09471 [Sporothrix schenckii 1099-18]
Length=348

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 178/364 (49%), Gaps = 35/364 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV--ECKWGG  1080
             +A+LG+GIF K +++P +     L +L         +   A    +   P V  +     
Sbjct  4     VALLGAGIFAKIEHLPAVEAAKDLNLLAVYSRSQASAEGLAALAKQETKPQVYYDSPASE  63

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
               L+ ++    I  V + +    Q ++  + L  GKHVL EKP A  ++ A + + +Y+S
Sbjct  64    NSLDALLARADIAAVIISLPILAQPDVVRKALAAGKHVLSEKPVAPDVSAARDLVAYYDS  123

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWR  723
             L      +PIW+VAEN+R+     +    I +IG  ++   ++  G +   + Y++++WR
Sbjct  124   LPA--ATRPIWSVAENFRYLRVVRDAAAKIKDIGGRLVGFHLVRNGFVLEDDKYYNTAWR  181

Query  722   RN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +   + GGF+LD GVH+VAGLR L+   G EV  V++ +S ++K LPP D+I A+     
Sbjct  182   KEPGYQGGFLLDGGVHFVAGLRFLLAAAGDEVARVASFSSLLEKRLPPVDSIHAVASTRG  241

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS------VSLYMGDGQIKS  396
             G +G  +M   +               LE+E    +G+  ++      VS+  G    K+
Sbjct  242   GVNGTISMSFGTE----------FKNVLEIEVVTTEGRVTWTWAPSSIVSVRRGQTDPKT  291

Query  395   FFY-PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  219
               Y P  GV       +S+++         + +P+ S  E  +D+A+L+A+LESG   GA
Sbjct  292   DTYEPDFGV-------VSEVAAFAASVAAGQADPQQSPQEALKDLALLQALLESGP-TGA  343

Query  218   LVQV  207
             +  V
Sbjct  344   ITNV  347



>ref|XP_001935897.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU48484.1| conserved hypothetical protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=342

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 104/363 (29%), Positives = 179/363 (49%), Gaps = 37/363 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             IA++GSGIF K +++P + +   L  LKA++SRS +SA++          +VE       
Sbjct  5     IALIGSGIFAKEEHLPAIQDTPNL-SLKAVYSRSLKSAKALS----EKLSDVELYSDDQD  59

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   E+++K   + GV + +    Q +   + L  GKHV   +   A        L+ + 
Sbjct  60    GKKFEDLLKRNDVKGVVIALPIPAQPDYIKKALAAGKHVF-AEKPIAKDLATAQELLSWT  118

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
               ++N +   I+ VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ + WR
Sbjct  119   QDASNTS--AIYTVAENFRFIDSYVWGSQQVASLGRILSFRVRVALLVQPGSKYYETEWR  176

Query  722   RN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +     GGF+LD GVH+VA  R+L+   G ++  VSA T+ + + LPP D ++A  QL N
Sbjct  177   KKPEHQGGFLLDGGVHFVAATRLLLQGGGQKINKVSAFTAQLQEYLPPVDTLNATMQLGN  236

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFF  390
             G SG  ++   +      + V    G++ V RG     +DGK          + + K F 
Sbjct  237   GASGTLSISFGTTDTGSEYLVACEKGSVHVSRGKVIVTRDGK----------EAETKEFP  286

Query  389   YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  210
                 GV +E+K +    SL   K  E +     S  E  +D+ +LE  L SG++ G  + 
Sbjct  287   DEGNGVNQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILEVCLMSGEQGGKPID  339

Query  209   VKK  201
             VK+
Sbjct  340   VKQ  342



>gb|EUN24448.1| hypothetical protein COCVIDRAFT_106168 [Bipolaris victoriae FI3]
Length=343

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 105/360 (29%), Positives = 183/360 (51%), Gaps = 30/360 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             IA++GSGIF K +++P + + + +  LKA++SRS +SA+S  E              G  
Sbjct  5     IALIGSGIFAKEEHLPAIQD-APVLSLKAVYSRSLKSAQSLSEKLSG-IDLYSDDQDGKK  62

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++K   I GV + +    Q +   + L  GKHV   +   A      ++L+ + S S
Sbjct  63    FDDLLKRDDIKGVVIALPIPAQPDYIKKALAAGKHVF-AEKPIAKDLSTASSLLAWTSNS  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
              N +    + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ + WR+  
Sbjct  122   ANTS--ATYTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFPVPVGSKYYETEWRKKP  179

Query  716   -FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
                GGF+LD G+H+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLENG S
Sbjct  180   EHQGGFVLDGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPLDTLNAVLQLENGSS  239

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFFYPF  381
             G  ++ V +      + V    G + V RG     + G+          + Q K F    
Sbjct  240   GTLSISVGTTDKGSEYVVACEKGVVTVSRGKVVVKRQGEE---------EEQTKEFPDEG  290

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
              GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + VK+
Sbjct  291   NGVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQSGTPIDVKQ  343



>gb|KEZ45810.1| Oxidoreductase-like protein [Scedosporium apiospermum]
Length=347

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 110/360 (31%), Positives = 180/360 (50%), Gaps = 34/360 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV---ECKWG  1083
             IA+LG+GIF +T+++P + E   L   KA++SRS++SA +      +  P+    +    
Sbjct  5     IALLGAGIFARTEHVPAI-EACDLLEFKAVYSRSQKSADALASSIESK-PDSYFDDPANT  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                L+ ++    I  V + +   +Q  +  + +  GKHVL EKP A   A A++ L  Y 
Sbjct  63    DKNLDALLARDDIQAVVIALPIPSQPAVIKKAITAGKHVLSEKPIAKDTATAKDLLNWYG  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSW  726
             SLS+     PIWAV EN+RF        + + EIG D++     +   +   + Y+++ W
Sbjct  123   SLSS----PPIWAVGENWRFLQTVVYAAEQLKEIGGDVVTFSFSMYKLVRDDDKYYNTEW  178

Query  725   RR--NFFGGFILDMGVHYVAGLRML---VGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             R+   + GGF+LD GVH+VAG+R     VG E+  +SA T+ +   LPP D +  L    
Sbjct  179   RKIPEYQGGFLLDGGVHFVAGIRHFLAAVGQEIKHLSAHTALIQAKLPPVDTVHGLLTTT  238

Query  560   NGCSGVFAMVVSSR-SPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG----QIKS  396
             +G SG F +   S         +V  NG + +  G        +V+   GDG    + K+
Sbjct  239   SGRSGTFIVSFGSEFKSGFTIELVTTNGAVRLTPGV------VNVTRKAGDGERVEETKT  292

Query  395   FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  216
             F +   GV+ E+  F   I+         K + R +  E  +D+ +L+A+LESG+  GA+
Sbjct  293   FEFD-SGVKAEVAAFAQSINAG-------KVDARQTASEALKDLEILQALLESGEDSGAI  344



>ref|XP_011112776.1| hypothetical protein H072_7001 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39213.1| hypothetical protein H072_7001 [Dactylellina haptotyla CBS 200.50]
Length=364

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 181/361 (50%), Gaps = 33/361 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG-GA  1077
             +AILGSGIFV++Q+ P   + S +  LKAI+SR + S  + +              G G 
Sbjct  6     VAILGSGIFVESQHKPACLQDSTILSLKAIYSRRKASVEAIIANETTPIDVYSDDSGEGM  65

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
             G+++++K   I  V + +    Q     + L  GKHVL EKP A         L   N L
Sbjct  66    GIDDLLKREDIQFVIIALPILQQPLFIKKSLLAGKHVLSEKPVAKD-------LAAANEL  118

Query  896   ---STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
                      +PIW+VAEN+R+  AF   ++ +  +G ++  +V +   +     YF ++W
Sbjct  119   IRWKKTHAPEPIWSVAENFRYWKAFEYARQQVNGLGKVLAFRVEVMQYVAPGGKYFETAW  178

Query  725   RR--NFFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             R+   + GGF LD GVHY AGLRMLVG  + +S+SA T+   + L P D I +  +L++G
Sbjct  179   RKVPEYQGGFCLDAGVHYTAGLRMLVGEDQFSSLSAFTALNQQHLVPIDTIMSTIKLKSG  238

Query  554   CSGVFAMVVSSRSPKIV-WRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFY---  387
               G FAM   + S K   + +V   GT+++  G+K       V++   D   +S  +   
Sbjct  239   VCGTFAMSHGTPSAKAFDFLIVCEEGTVKIGDGSK-------VTVKKTDMPEESVAFGGE  291

Query  386   -PFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  210
               + GV+ E+K F   ++    KG    G    S  +   D+ ++E M++SG++ G   +
Sbjct  292   DGWNGVKAEVKAFAEAVA----KG---VGNDDQSPEKAVADLELIEKMIQSGEQGGKPFE  344

Query  209   V  207
             V
Sbjct  345   V  345



>ref|XP_007686203.1| hypothetical protein COCMIDRAFT_90481 [Bipolaris oryzae ATCC 
44560]
 gb|EUC47328.1| hypothetical protein COCMIDRAFT_90481 [Bipolaris oryzae ATCC 
44560]
Length=343

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 185/363 (51%), Gaps = 36/363 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             IA++GSGIF K +++P + + + +  LKA++SRS +SA+S           V+       
Sbjct  5     IALIGSGIFAKEEHLPAIQD-APVLSLKAVYSRSLKSAQSLS----EKLSGVDLYSDDQD  59

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   ++++K   I GV + +    Q +   + L  GKHV   +   A      ++L+ + 
Sbjct  60    GKKFDDLLKRDDIKGVVIALPIPAQPDYIKKALAAGKHVF-AEKPIAKDLSTASSLLAWT  118

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
             S ++N +    + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ ++WR
Sbjct  119   SNTSNTS--ATYTVAENFRFIDSYIWASQQLASLGRLLSFRVRVMFPVAVGSKYYETAWR  176

Query  722   RN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +     GGFILD G+H+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ Q EN
Sbjct  177   KKPEHQGGFILDGGIHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDTLNAVLQAEN  236

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYMGDGQIKSFF  390
             G SG  ++ V +      + V    G + V RG     + G+    V  +  +G      
Sbjct  237   GSSGSLSISVGTTDQGSEYVVACEKGVVTVSRGKVVVKRQGEEKEEVKEFPDEGN-----  291

Query  389   YPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQ  210
                 GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + 
Sbjct  292   ----GVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQGGTPID  340

Query  209   VKK  201
             VK+
Sbjct  341   VKQ  343



>ref|XP_003840030.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
 emb|CBX96551.1| similar to oxidoreductase family [Leptosphaeria maculans JN3]
Length=342

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 181/353 (51%), Gaps = 31/353 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF K +++P + + +    LKA++SRS +SAR+  E   +     +    G  
Sbjct  5     VAIIGSGIFAKGEHLPAI-QATPTLSLKAVYSRSFKSARALTEDLSDGAIYSDDSPNGKR  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              E++++   I GV + +   TQ E   + L  GKHVL  +   A       AL+ +   +
Sbjct  64    YEDLLRRDDITGVVIALPILTQPEFIKKALAAGKHVL-AEKPIAKDVATAQALLSWTQDA  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
             +  T   ++AVAEN+R+  +F    + IA +G ++  +V +   + +   YF ++WR+  
Sbjct  123   SETT--AMYAVAENFRYLDSFLYAAREIASLGRVLTFRVRVAAYVEAGGKYFETAWRKVP  180

Query  719   NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
              + GGF+LD GVH++A +R+++   G ++  VSA T+ + K LPP D +++  +L +G S
Sbjct  181   EYQGGFLLDGGVHFIAAMRVMLQGGGEKIHGVSAFTAQLQKHLPPVDTLNSTLKLGSGAS  240

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGN----KDGKHGYSVSLYMGDGQIKSFFYPF  381
             G  ++   +      + V    G++ V RG     K+GK             +K F    
Sbjct  241   GTLSVSFGTTDKGSEYMVACEKGSVHVSRGKVTVVKEGKE-----------VVKEFGDEG  289

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
              GV++E+K +    SL   +  E +     S  E   D+ +LEA L SG+++G
Sbjct  290   NGVRQEIKAWSE--SLEKGQRNEAQ-----SPEEALSDLKILEACLRSGEQDG  335



>ref|XP_001397204.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
niger CBS 513.88]
 emb|CAK42628.1| unnamed protein product [Aspergillus niger]
Length=342

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 110/356 (31%), Positives = 177/356 (50%), Gaps = 41/356 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave-laRNHFPNVEC----K  1089
             +AI+GSGIF K +++P L+  S LF LKAI+SRS +SA + +     +   NVE      
Sbjct  7     VAIIGSGIFAKEEHLPILS-ASPLFTLKAIYSRSLKSAETLISGSKEDVVKNVELYSEDS  65

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
               G   ++++    +  V + +    Q       L+ GKHVL EKP A  ++ A   L  
Sbjct  66    ESGRQFQDLLAREDVQAVIIALPIPAQPSYIRASLQAGKHVLSEKPIAGDLSTARALLSE  125

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssS  729
             Y SL+T    KP+W VAEN+RF   F+   + + ++G +   +V +   +   + Y  + 
Sbjct  126   YQSLAT----KPLWGVAENWRFLAKFSRVAEEVRKLGAVKAFRVSVRTLIGEGSKYHQTE  181

Query  728   WRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLE  561
             WRR   + GGF+LD G+H +AGLR+++G E  + +VSAM     + L P D + A+ + +
Sbjct  182   WRRKPTYKGGFVLDGGIHAIAGLRLILGKEDAMAAVSAMMGLQREHLAPVDTVDAVVKTK  241

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G +GV ++   +   + V+      G ++++R         +V++  G+    SF  P+
Sbjct  242   TGANGVVSLSYGAAVNETVFEFSCERGVVKLDRD--------TVTVSGGE----SFEVPY  289

Query  380   --CGVQEELKTFLSDISLANTKGGECKG--EPRLSFVEGTRDIAVLEAML--ESGK  231
                GV  E+  F   I          KG  E RL   E   D+ V+E M   E GK
Sbjct  290   EGRGVNYEVAAFGESI---------LKGQLEERLRPEEAMADLEVMEGMFVSEGGK  336



>emb|CDY27562.1| BnaC01g32450D [Brassica napus]
Length=180

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -2

Query  506  VWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLAN  327
            +  +  +  ++++ERG KDG+HGY  ++Y   G  ++ FYPF GV EELK F SDIS  +
Sbjct  82   IMEICRIKRSVQLERGVKDGRHGYMATVYGEGGTSRTIFYPFSGVTEELKAFFSDISETS  141

Query  326  TKGGECKGEP-RLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
                  + EP RLS VEGTRD+AVL AMLESG R GA+V V KF
Sbjct  142  K-----EQEPRRLSCVEGTRDVAVLGAMLESGARNGAVVPVAKF  180



>dbj|GAA91490.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
kawachii IFO 4308]
Length=344

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 177/358 (49%), Gaps = 43/358 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH---FPNVEC---  1092
             +AI+GSGIF K +++P L   S LF LKAI+SRS +SA S +  ++       NVE    
Sbjct  7     VAIIGSGIFAKEEHLPILT-TSPLFTLKAIYSRSLKSAESLISGSKGDDVVMKNVELYSE  65

Query  1091  -KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenAL  915
                 G   ++++    +  V + +    Q       L+ GKHVL EKP A  ++ A   L
Sbjct  66    DSEAGRRFQDLLAREDVRAVVIALPIPAQPSYIRAALQAGKHVLSEKPIAVDLSTARALL  125

Query  914   MHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfs  735
               Y +L T    KP+W VAEN+RF   FT   + + ++G +   +V +   +   + Y  
Sbjct  126   SEYQALET----KPLWGVAENWRFLAKFTRVAEEVRKLGSVKAFRVGVRTLIGEGSKYHQ  181

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQ  567
             + WRR   + GGF+LD GVH +AGLR+++G E  + +VSAM     + L P D + A+ +
Sbjct  182   TEWRRKPTYKGGFVLDGGVHAIAGLRLILGKEDAMAAVSAMMGLQREHLAPVDTLDAVVK  241

Query  566   LENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFY  387
              ++G +GV ++   +   + V+      G ++++R         +V++  G+    SF  
Sbjct  242   TKSGANGVVSLSYGAAVNETVFEFSCERGVVKLDRD--------TVTVSGGE----SFEV  289

Query  386   PF--CGVQEELKTFLSDISLANTKGGECKG--EPRLSFVEGTRDIAVLEAML--ESGK  231
             P+   GV  E+  F   I          KG  E RL   E   D+ V+E M   E GK
Sbjct  290   PYEGRGVNYEVAAFGESI---------LKGQLEERLRPEEALADLEVMEGMFVSEGGK  338



>gb|KFZ16228.1| hypothetical protein V501_02319 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=350

 Score =   102 bits (255),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 106/356 (30%), Positives = 174/356 (49%), Gaps = 26/356 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + L  LKAI+SRS  +A +   +A+           G  
Sbjct  5     VAIIGSGIFATEQHLPAV-ESTPLLKLKAIFSRSLVAATTLATVAKGDVDTYADDNNGKD  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q       L  GKHVL EKP A  I  AE  +  Y ++ 
Sbjct  64    YAALLARSDITAVIIALPINVQPMYIEAALAAGKHVLSEKPIANDIEAAEKLIHFYTAMK  123

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                T K  WAVAEN+RF   F   ++ I ++G ++  ++ +   + +   YF + WR+  
Sbjct  124   EKGT-KATWAVAENFRFLAPFRFARQEIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKIP  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             ++ GGF+LD GVH+ AG R+L+G      S+SA T+ +   LPP D +++++Q   G SG
Sbjct  183   SYQGGFLLDGGVHFTAGTRLLLGSLNRPVSLSAYTALIQPHLPPIDTVNSIWQTAKGISG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG---DGQI--KSFFYPF  381
                +   +      + +   +G++ V R         +VS++ G   DG +  +      
Sbjct  243   TVQISFGTSLSGDEYTIACYDGSVSVSRD--------TVSVHTGEEKDGNVTKRVLLSSG  294

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  213
              GV+ E++ +   I          K  P  S  E   D+ +LEAM++SG+ EG  V
Sbjct  295   SGVKAEVQAWAEGIEAG-------KENPLQSPAEALADLELLEAMIKSGEGEGVKV  343



>gb|EQB57311.1| hypothetical protein CGLO_02580 [Colletotrichum gloeosporioides 
Cg-14]
Length=349

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 105/351 (30%), Positives = 179/351 (51%), Gaps = 27/351 (8%)
 Frame = -2

Query  1229  FVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH--FPNVECKWGGAG--LEEI  1062
             F K Q++P + E S    LKAI+SRS +SA+    LA+     P++     GAG   E++
Sbjct  14    FAKEQHLPAV-EASDQLELKAIYSRSLKSAQDTASLAKKSGAAPDLYSDDSGAGKSFEDL  72

Query  1061  IKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNMT  882
             +    I  V + +    Q E   + L  GKHVL EKP AA +A A+  + +Y  +S    
Sbjct  73    LARDDIKAVILALPIPNQPEYIEQALAAGKHVLAEKPIAADVARAQKLIEYYKKVSAE--  130

Query  881   QKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  708
                 +A+AENYRF+P FT  +  + ++G ++     +   +     Y  ++WR+  ++ G
Sbjct  131   NGVTFAIAENYRFQPRFTTARDEVQKLGKVIGFNARVFFFVKLGGKYIETAWRKKPDYQG  190

Query  707   GFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  534
             GF+LD GVH+ A +R+L+G E    SV+A +      LPP D I+A+ +  +G +G FA+
Sbjct  191   GFLLDGGVHFAATVRLLLGTEAAPESVAAFSDLTRPHLPPIDTINAVIKTRSGVTGSFAV  250

Query  533   VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF-FYPFCGVQEELK  357
              V S      ++V   NG++ V         G+ + +   DG+ ++  F    GV+EE+K
Sbjct  251   SVGSSLSAFDFQVACENGSVTV--------SGHELIVKPLDGEARTTQFEQTTGVKEEVK  302

Query  356   TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
              +   +          K  P  +  E   D+  LE + +SG+++G  ++++
Sbjct  303   AWAEALV-------SGKPNPLQATDEALADLEFLEKIFKSGEQDGTRLKLE  346



>gb|EPS32813.1| hypothetical protein PDE_07773 [Penicillium oxalicum 114-2]
Length=336

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 103/346 (30%), Positives = 170/346 (49%), Gaps = 30/346 (9%)
 Frame = -2

Query  1238  SGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAGLEEII  1059
             +G F K Q++P +   ++L  LKAI+SRS  SA++    A +     +    G   E+++
Sbjct  2     TGNFAKEQHLPAVRAATEL-DLKAIYSRSLTSAKNLASGAPDCDLYSDDSGSGKSYEDLL  60

Query  1058  KDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQ  879
               + I  V + +    Q E   + L  GKHVL EKP A  +  A   L  Y +  T  TQ
Sbjct  61    ARSDISAVIIGLPILVQPEFIKKALLAGKHVLSEKPIAKDVIAARALLQWYQT--TFDTQ  118

Query  878   KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGG  705
             K IWAV EN+R+   F      +  +G +   +V ++  +   N Y+ + WR++  + GG
Sbjct  119   KLIWAVGENFRYMTKFLYAADKVRNMGQVRRFRVNVQSLVKQDNKYYLTLWRQSPGYQGG  178

Query  704   FILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMV  531
             F+LD GVH +AGLRM++G +  + SVSA T  +   LPP D + A+ Q E G +G  ++ 
Sbjct  179   FLLDGGVHMLAGLRMILGPKNRIVSVSAQTQQLQNYLPPIDTLDAVTQTELGATGTISLS  238

Query  530   VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTF  351
               SR    ++      GT++++  +            M + ++    +   GV  E++ F
Sbjct  239   WGSRFTDSLFEFECEKGTVKIQFDD-----------VMVNDEVHHIEFDGKGVVPEVREF  287

Query  350   LSDISLANTKGGECKGEP---RLSFVEGTRDIAVLEAMLESGKREG  222
                I          +G+P   R S  E   D+++LE M+ SG+ +G
Sbjct  288   AETI---------LRGDPVAKRQSPEEALADLSLLEQMMRSGEHDG  324



>gb|EWC48565.1| hypothetical protein DRE_01787 [Drechslerella stenobrocha 248]
Length=363

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 108/360 (30%), Positives = 170/360 (47%), Gaps = 31/360 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFP-NVECKWGGA  1077
             +AI+GSGIFV+++  P   +   L  LKAI+SR + S  + +    +  P +V     G 
Sbjct  6     VAIIGSGIFVESRQKPACLQDPALLSLKAIYSRRKVSVEAIIAN--DTIPIDVYSDDSGD  63

Query  1076  G--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   ++++K   +  V + +    Q     + L  GKHVL EKP           L   N
Sbjct  64    GRTYDDLLKREDVEFVIIALPILQQPAFIQKALLAGKHVLSEKPVGKD-------LAAAN  116

Query  902   SL---STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfss  732
              L          PIW+VAEN+R+   F    + ++E+G ++   V +   +     Y ++
Sbjct  117   ELIRWKRKHAPTPIWSVAENFRYWKTFKFAAQQVSELGRLLTFTVDVMQFIAPGGKYVNT  176

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGC-EVTSVSAMTSHVDKTLPPPDNISALFQLE  561
              WR+   + GGF LD GVH+ A LRML+G  E + VSA TS     LPP D + A   L+
Sbjct  177   EWRKVPQYQGGFCLDAGVHFTAALRMLIGNDEASRVSAFTSLNQPHLPPIDTVMATVMLK  236

Query  560   NGCSGVFAMVVSSRSPKIV-WRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYP  384
             +G  G F+M   + S K   W +V   GT+ V  G K       +   + D    S    
Sbjct  237   SGACGTFSMSHGTPSAKTFDWGIVCEGGTVRVADGQKVIVKKVDMPEVVSDF---SDNED  293

Query  383   FCGVQEELKTFLSDISLANTKG-GECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  207
             + GV+ E++ F      A  KG G     P ++      D+ ++E M++SG++ GA  ++
Sbjct  294   WSGVKAEVRAFAE----AVRKGVGNEDQSPEMAVA----DLELIEKMIKSGEQSGAPFEI  345



>gb|KIM22883.1| hypothetical protein M408DRAFT_332653 [Serendipita vermifera 
MAFF 305830]
Length=372

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 112/379 (30%), Positives = 185/379 (49%), Gaps = 45/379 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW----  1086
             IAILG+GIF +  ++P + E+  ++ LKAI+SRS+ SA    + A       E       
Sbjct  7     IAILGAGIFARIAHLPAIRELGDVYQLKAIYSRSKSSATELAKTAETSLALPEASLAIYY  66

Query  1085  --GG--AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
               GG    LE ++    I  V + +   +Q  + ++ L+ GKHV+ EKP A  + +    
Sbjct  67    DLGGQDGNLEALLARQDIQAVIIALPITSQPAIVVQCLEAGKHVISEKPVAPTVKDGIKL  126

Query  917   LMHYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGDMM--NVQVIIEGsm  759
             +  Y S+      KP   +W VAEN+  EP      K IAE  IG +   N QV+   ++
Sbjct  127   INTYESV-----YKPRGLVWRVAENFEAEPGLQAAGKAIAEQKIGKVCFWNYQVL--NNV  179

Query  758   nssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDN  585
             N+   ++ + WR   ++ GGF+LD GVH  A LR ++   +  +S + S   + L P D 
Sbjct  180   NTDGMWYKTPWRTVPDYQGGFLLDGGVHSAAALRTVLPSPLQQLSGLASLNREHLAPHDT  239

Query  584   ISALFQLENGCSGVFAM---VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM-  417
             I  L + ++G  G+F +   + SS      +RVVG  G L + + NK G+     + Y+ 
Sbjct  240   IHTLIRSKDGSHGLFELSFGLPSSAGGGDSFRVVGTEGILLITKFNKPGEKEGESTQYIK  299

Query  416   ------GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVL  255
                    DG  +      CGV++EL +F + +   +    +  G+P    +   +D+AV+
Sbjct  300   VQITSAKDGSTEEIIEKTCGVKQELSSFAAHVRGQD----DGLGKP----LRALQDVAVI  351

Query  254   EAMLESGKREGALVQVKKF  198
             +A L S    G++V + K 
Sbjct  352   QAALNS---NGSVVDLTKL  367



>ref|XP_007275100.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
gloeosporioides Nara gc5]
 gb|ELA35828.1| oxidoreductase nad-binding rossmann fold protein [Colletotrichum 
gloeosporioides Nara gc5]
Length=349

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 105/351 (30%), Positives = 181/351 (52%), Gaps = 27/351 (8%)
 Frame = -2

Query  1229  FVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH--FPNVECKWGGAG--LEEI  1062
             F K Q++P + E S    LKAI+SRS +SA+    LA      P++     GAG   +++
Sbjct  14    FAKEQHLPAV-EASDQLELKAIYSRSLKSAKDTASLANKSGAAPDLYSDDSGAGKSFKDL  72

Query  1061  IKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNMT  882
             +    I  V + +    Q E   + L  GKHVL EKP AA +A A+  + +Y  +S    
Sbjct  73    LARDDIKAVILALPIPNQPEYIEQALAAGKHVLAEKPIAADVARAQKLIEYYKKVSAE--  130

Query  881   QKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFG  708
                 +A+AENYRF+P FT  +  + ++G ++     +   +     Y  ++WR+  ++ G
Sbjct  131   NGVTFAIAENYRFQPRFTTARDEVQKLGKVIGFNARVFFFVKLGGKYIETAWRKKPDYQG  190

Query  707   GFILDMGVHYVAGLRMLVGCEVT--SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAM  534
             GF+LD GVH+ A +R+L+G E    SV+A +      LPP D I+A+ +  +G +G FA+
Sbjct  191   GFLLDGGVHFAATVRLLLGTEAAPESVAAFSDLTRPHLPPIDTINAVIKTRSGATGSFAV  250

Query  533   VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSF-FYPFCGVQEELK  357
              V S      + V   NG++ V         G+ + +   DG+ ++  F    GV+EE+K
Sbjct  251   SVGSSLSAFDFEVACENGSVTV--------SGHELIVKPLDGEARTTQFEQTTGVKEEVK  302

Query  356   TFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
              + +++ ++       K  P  S  E   D+  LE + +SG+++G  ++++
Sbjct  303   AW-AEVLVSG------KPNPLQSTDEALADLEFLEKIFKSGEQDGTRLKLE  346



>gb|EPS29944.1| hypothetical protein PDE_04894 [Penicillium oxalicum 114-2]
Length=349

 Score =   100 bits (250),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 103/350 (29%), Positives = 170/350 (49%), Gaps = 24/350 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +A++G GI+ + +++P +   S+   LKAI+SRS +SA      ++    ++        
Sbjct  5     VALIGGGIWAREEHLPAIL-ASEDLTLKAIYSRSRKSAEETASASKTQV-DLYSDDSEHA  62

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              +E++K   I  V + +   +Q       L   KHVL EKP A  +AEA+  +  Y    
Sbjct  63    YDELLKRNDIEAVIIALPIVSQASYIRAALLANKHVLSEKPVAENVAEAKELIKWYGD-E  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                  K  W V EN+R+   F   ++ I E+G++    V + G +     ++++ WR+  
Sbjct  122   IKPHGKVTWGVGENFRYLDTFRHAREKIKELGEITGFLVRLYGDVQPDGKFYNTDWRKVP  181

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
                GGFILD GVH+ AGLR L+G +V  T VSA T+ +   LPP D ++A+ +   G  G
Sbjct  182   THQGGFILDGGVHFTAGLRYLLGSDVHITQVSAFTTLIKDYLPPVDTVNAILKANTGAQG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSFFYPFCGV  372
                + + +  P   W V   NG++ V  G+       SV++ M DGQ  +        GV
Sbjct  242   TLQVSMGTHGPAPEWTVGCENGSVSV--GDS------SVTVRMADGQEHVDKIENERSGV  293

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
               E++ +   ++     GG  K  P  S  +   D+ ++E ML SG+  G
Sbjct  294   PPEVRLWAKALA-----GG--KVNPEQSPSQALADLELIELMLRSGENNG  336



>gb|KIV83264.1| hypothetical protein PV11_05309 [Exophiala sideris]
Length=343

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 169/351 (48%), Gaps = 24/351 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-HFPNVEC---KW  1086
             IA+LG+GIF   +++P L  +S    LKAI+SRS+++A + V  A+     +VE      
Sbjct  4     IALLGAGIFATDEHLPAL--VSNKADLKAIYSRSKKTALTLVAEAKKLGVKDVELFSENT  61

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
                 L++++K   I  V +V+    Q ++  R    GKHVL EKP A  +  A   +  Y
Sbjct  62    AHHTLDDLLKRDDIKAVIIVLPILVQPDIIRRCFAAGKHVLSEKPIAKDVQTALKLIADY  121

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfs  735
                  +  +  I++VAE +RF P F   +K + E   IGD+  + + I  +      Y+ 
Sbjct  122   KGQYAD--KGIIFSVAEQFRFMPEFELGRKWVVEEKAIGDVNQLHLKIWRNQAPGGKYYE  179

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D ++A   L 
Sbjct  180   TEWRKVPEYQGGFLLDGGVHQTAMLRWISGQEVVETRGFARQVAHHLPPLDTVNAGILLS  239

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G +G  +M  +S        ++G  G+  +     DG  GY V+L +  G+ ++     
Sbjct  240   GGGTGTISMSFASAKRATELTIIGTKGSFFL----TDGPDGYIVTLELTSGEKRTETLKT  295

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
              GVQ E+K FL  I   N    + +  P     E   D+A++E++   G +
Sbjct  296   NGVQVEIKAFLEAIQAGN---AQARSGPE----EALNDLAIIESLCSGGGK  339



>gb|KHE80312.1| NAD(P)-binding protein, partial [Neurospora crassa]
Length=355

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 115/376 (31%), Positives = 188/376 (50%), Gaps = 51/376 (14%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH---FPNVECKWG  1083
             IA+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A +    + +V     
Sbjct  4     IALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASSPVDVYYDVPTAGS  62

Query  1082  GAG--------LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaea  927
             G+G        L+ ++  T I  V + +    Q  +  + LK GKHVL EKP A  + EA
Sbjct  63    GSGEAANVEKTLDALLARTDIDAVVIALPILAQPAVIEKALKAGKHVLSEKPVAKDVEEA  122

Query  926   enALMHYNSLS-TNMTQKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmns  753
             +  +  Y +L   N  +KP+WAVAEN+R+ P+  +  + + EI G +   ++ + G +  
Sbjct  123   KRLVGFYEALDLDNNKKKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEE  182

Query  752   snpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPD  588
              N YF + WR+  ++ GGF+LD GVH++AGLR+L+     E+T V+  ++ +++ L P D
Sbjct  183   GNKYFKTEWRKVPSYQGGFLLDGGVHFIAGLRLLLSELNQEITHVAGFSALLEERLLPVD  242

Query  587   NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  408
              + A+    +G SG  ++   ++              LEVE     G      S+Y    
Sbjct  243   TVHAVALTNDGKSGTISISFGTQ----------FKTGLEVEVVTTQG------SVYWNPT  286

Query  407   QIKSFFYPF---------CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVL  255
             QIK+               GV+EE+  F   I    T   E +  P     E  +D+ V+
Sbjct  287   QIKTKTKEGEETEEFEKSTGVKEEMAAFAKAIEKGQT---EKEQTPE----EALKDLEVV  339

Query  254   EAMLESGKREGALVQV  207
             + +LESG+ +G +  V
Sbjct  340   QRLLESGEGKGVVKAV  355



>gb|KFY75511.1| hypothetical protein V499_04510 [Pseudogymnoascus pannorum VKM 
F-103]
Length=350

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 174/356 (49%), Gaps = 26/356 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + +  LKAI+SRS  +A +   +A+           G  
Sbjct  5     VAIIGSGIFATEQHLPAV-ESTPVLKLKAIFSRSLVAATTLATVAKGDVDTYADDNNGKD  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q       L  GKHVL EKP A  I  AE  +  Y ++ 
Sbjct  64    YAALLARSDITAVIIALPINVQPVYIEAALAAGKHVLSEKPIANDIEAAEKLIHFYTAMK  123

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                T K  WAVAEN+RF   F   ++ I ++G ++  ++ +   + +   YF + WR+  
Sbjct  124   EKGT-KATWAVAENFRFLAPFRFARQEIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKIP  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             ++ GGF+LD GVH+ AG R+L+G      S+SA T+ +   LPP D +++++Q   G SG
Sbjct  183   SYQGGFLLDGGVHFTAGTRLLLGSVNRPVSLSAYTALIQPHLPPIDTVNSIWQTAKGISG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG---DGQI--KSFFYPF  381
                +   +      + +   +G++ V R         +VS++ G   DG +  +      
Sbjct  243   TVQISFGTSLSGDEYTIACYDGSVSVSRD--------TVSVHTGEEKDGNVTKRVLLSSG  294

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  213
              GV+ E++ +   I          K  P  S  E   D+ +LEAM++SG+ +G  V
Sbjct  295   SGVKAEVQAWAEGIEAG-------KENPLQSPAEALADLELLEAMIKSGEGDGVKV  343



>gb|KIH86578.1| hypothetical protein SPBR_08549 [Sporothrix brasiliensis 5110]
Length=369

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 143/276 (52%), Gaps = 33/276 (12%)
 Frame = -2

Query  992  RLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKM  813
            + L  GKHVL EKP A  +A A + + +Y+SL      +PIW+VAEN+R+     +    
Sbjct  114  KALAAGKHVLSEKPVAPDVAAARDLVAYYDSLPA--ATRPIWSVAENFRYLRVVRDAAAK  171

Query  812  IAEIG-DMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFILDMGVHYVAGLRMLV---G  651
            I +IG  ++   ++  G +   + Y++++WR+   + GGF+LD GVH+VAGLR L+   G
Sbjct  172  IKDIGGRLVGFHLVRNGFVLEDDKYYNTAWRKEPGYQGGFLLDGGVHFVAGLRFLLAAAG  231

Query  650  CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLE  471
             EV  V++ +S ++K LPP D+I A+     G +G  +M   +               LE
Sbjct  232  DEVARVASFSSLLEKRLPPVDSIHAVASTHGGVNGTISMSFGTE----------FKNVLE  281

Query  470  VERGNKDGKHGYS------VSLYMGDGQIKSFFY-PFCGVQEELKTFLSDISLANTKGGE  312
            +E    +G+  ++      VS+  G    K+  Y P  GV       +S+++        
Sbjct  282  IEVVTTEGRVTWTWAPSSIVSVRRGQADPKTDTYEPDFGV-------VSEVAAFAASVAA  334

Query  311  CKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
             + +P  S  E  +D+A+L+A+LESG   GA+  V+
Sbjct  335  GQADPLQSPQEALKDLALLQALLESGP-TGAITNVE  369



>ref|XP_960192.1| NAD-binding Rossmann fold oxidoreductase [Neurospora crassa OR74A]
 gb|EAA30956.1| NAD-binding Rossmann fold oxidoreductase [Neurospora crassa OR74A]
Length=357

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 114/371 (31%), Positives = 186/371 (50%), Gaps = 51/371 (14%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH---FPNVECKWG  1083
             IA+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A +    + +V     
Sbjct  4     IALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASSPVDVYYDVPTAGS  62

Query  1082  GAG--------LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaea  927
             G+G        L+ ++  T I  V + +    Q  +  + LK GKHVL EKP A  + EA
Sbjct  63    GSGEAANVEKTLDALLARTDIDAVVIALPILAQPAVIEKALKAGKHVLSEKPVAKDVEEA  122

Query  926   enALMHYNSLS-TNMTQKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmns  753
             +  +  Y +L   N  +KP+WAVAEN+R+ P+  +  + + EI G +   ++ + G +  
Sbjct  123   KRLVGFYEALDLDNNKKKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEE  182

Query  752   snpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPD  588
              N YF + WR+  ++ GGF+LD GVH++AGLR+L+     E+T V+  ++ +++ L P D
Sbjct  183   GNKYFKTEWRKVPSYQGGFLLDGGVHFIAGLRLLLSELNQEITHVAGFSALLEERLLPVD  242

Query  587   NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  408
              + A+    +G SG  ++   ++              LEVE     G      S+Y    
Sbjct  243   TVHAVALTNDGKSGTISISFGTQ----------FKTGLEVEVVTTQG------SVYWNPT  286

Query  407   QIKSFFYPF---------CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVL  255
             QIK+               GV+EE+  F   I    T   E +  P     E  +D+ V+
Sbjct  287   QIKTKTKEGEETEEFEKSTGVKEEMAAFAKAIEKGQT---EKEQTPE----EALKDLEVV  339

Query  254   EAMLESGKREG  222
             + +LESG+ +G
Sbjct  340   QRLLESGEGKG  350



>gb|EKV16143.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum Pd1]
 gb|EKV18638.1| Oxidoreductase family, NAD-binding Rossmann fold protein [Penicillium 
digitatum PHI26]
Length=500

 Score =   102 bits (253),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 176/353 (50%), Gaps = 35/353 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF K Q++P +   S  F LKAI+SRS +SA+             E       
Sbjct  5     VAIIGSGIFAKEQHLPAVQAASN-FQLKAIYSRSLKSAQDLASGISEVDLYSEDSGSDKS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64    YAQLLARSDIGAVIIALPILVQPEFIRKALHAGKHVLSEKPIAKDVATAQELLKWYKS--  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
             T  T+K  WAVAEN+RF   +    + + ++G + N +V +   M+ +N YF ++WR+  
Sbjct  122   TIDTRKVFWAVAENFRFLTKYLFAAEQVQKLGRVQNFRVNVHSLMDENNKYFHTAWRKTP  181

Query  719   NFFGGFILDMGVHYVAGLRMLVGC--EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             N+ GGF+LD GVH +A LR+++G    ++++SA +      LPP D + A+ + E+G +G
Sbjct  182   NYQGGFLLDGGVHMIAALRLILGPTERLSTLSAQSQLQQSFLPPVDTVDAVTKTESGATG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQIKSFFYPFCG  375
             + ++   S     V+ V    G  TL  +    +G KH         DG+         G
Sbjct  242   IISLSWGSSFNDHVFEVACEKGLVTLNFDDVTINGEKHHVEF-----DGR---------G  287

Query  374   VQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  222
             V  E+  F + I           G+P  R S  E   D+ +LE ML SG+++G
Sbjct  288   VVPEVAEFANSI---------VSGKPDIRQSAEEALADLEILEQMLRSGEKDG  331



>ref|XP_007839104.1| hypothetical protein PFICI_12332 [Pestalotiopsis fici W106-1]
 gb|ETS75388.1| hypothetical protein PFICI_12332 [Pestalotiopsis fici W106-1]
Length=346

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 110/356 (31%), Positives = 179/356 (50%), Gaps = 27/356 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIFV+ Q++P + + S+   LKAI+SRS +SA+S  E       ++       G
Sbjct  7     VAIIGSGIFVREQHLPAVQK-SEDLELKAIYSRSLKSAQSVSEGLSG--VSLYSNDSQEG  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++K   I+ V + +   +Q +   + L  GKHVL EKP A  +  A   + HY  L 
Sbjct  64    YADLLKRDDIVAVIIALPIPSQPDFIKQALDAGKHVLAEKPLAKDVETARQLMDHYRGLK  123

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
                T    + VAE +R+  ++      IA++G ++  Q+ +  ++N    Y  + WR+  
Sbjct  124   GQAT----FGVAEQFRYLNSYLHGASEIAKLGRVLGCQLRLHFTVNLGTKYIETPWRKTP  179

Query  716   -FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
              F GGF+LD GVH +A LR+++   G +V  VSA T+ + + LPP D + A   L++G +
Sbjct  180   EFSGGFLLDGGVHQIAALRLMLKGGGVKVQKVSAFTTQLREWLPPVDTVDATLLLDSGAT  239

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CG  375
             G  +M   S        V    GT+ V+R      +G       G+ +  +   P    G
Sbjct  240   GFLSMSFGSSFDDAEIAVACERGTVSVDR------NGNVTVRAAGEKEAATVHKPNEEGG  293

Query  374   VQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  207
             V  E+  +   I     K G+   E   S  E   D+ +LEA+L+SG++ GA VQ+
Sbjct  294   VATEVWAWARSI-----KNGKPDAEQ--SPEEALADLEMLEALLKSGEQGGAPVQL  342



>ref|XP_001906379.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP67045.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP28788.1| Putative Oxidoreductase [Podospora anserina S mat+]
Length=352

 Score = 99.8 bits (247),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 109/354 (31%), Positives = 177/354 (50%), Gaps = 30/354 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG---  1083
             IA+LG+GIF + +++P +     L  LKA++SRS+ S+ +  +      P  +  +    
Sbjct  4     IALLGAGIFARHEHLPAILASPDLLSLKAVYSRSQTSSVALADALPADGPKPDIYYDSPS  63

Query  1082  --GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
               G GL +++K   I+ V V +    Q E+    LK GKHVL EKP AA +  A   +  
Sbjct  64    EPGRGLADLLKRDDIVAVDVALPILAQPEVIKAALKAGKHVLSEKPVAADVKGARELIKW  123

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfss  732
             Y +      +KP+W VAEN+R+  +     + +  IG  +++ ++   G +   N YF++
Sbjct  124   YET-ELPAEKKPLWGVAENFRYMKSLVFAGEEVKRIGGRVVSFKLEKFGWVAEDNKYFNT  182

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNISALFQ  567
              WR+  ++ GGF+LD GVH+VA LR L+G    E++ V+A T+ +++ L P D I  +  
Sbjct  183   QWRKVPDYQGGFLLDGGVHFVAALRYLLGASGQELSKVAAYTALLEERLQPLDTIHGVAS  242

Query  566   LENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS---VSLYMGDGQIKS  396
              + G +G   +   +            NGT ++E    +G   +S   V     +G+ K 
Sbjct  243   TKQGVNGSIVLSFGTEFK---------NGT-DLEIITTNGTVSWSPTEVKTVTKEGESKK  292

Query  395   FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
              F    GV EE+  F   I     K G  K +   +  E  RD+ VLE +LESG
Sbjct  293   EFEYSSGVGEEVAVFARAI-----KAGTGKVDGLQTPEEAFRDLEVLEGLLESG  341



>ref|XP_003045334.1| hypothetical protein NECHADRAFT_70521 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU39621.1| hypothetical protein NECHADRAFT_70521 [Nectria haematococca mpVI 
77-13-4]
Length=345

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 106/359 (30%), Positives = 171/359 (48%), Gaps = 29/359 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH-FPNVECKWGGA  1077
             +A++G G+F K +++P L +    F LKAI+SRS +SA+    L      P++     G 
Sbjct  6     VAMIGGGLFAKQEHMPALMKCDN-FALKAIYSRSLKSAQETAALNTRESTPDLYSADAGP  64

Query  1076  G--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G   ++++    I  + + +   +Q       L  GKHVL EKP A  +   +  L  Y 
Sbjct  65    GKSYDDLLARDDIAAIILALPIMSQPAHIEAALTAGKHVLAEKPLAPTVEAGKKLLEFYR  124

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWR  723
                T       +A+AEN+RF+P+F       A++G +    V + G M +   +++++WR
Sbjct  125   R--TAEANGATFAIAENFRFKPSFEYAAVEAAKLGSVQQFNVRVLGYMGADTQWYATAWR  182

Query  722   RN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
                 + GGF+LD GVH+ A  RML+      V A T+     LPP D ++A+ +LE+G S
Sbjct  183   AKPEYQGGFLLDGGVHFAAATRMLLTTRAADVRAQTALTQPHLPPIDTVNAVVRLESGVS  242

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             GV+     SR     +      GT+ V  G+K      +V+   G+  +K F     GV 
Sbjct  243   GVYQQSAGSRLSAFDFDFSYEKGTVSVS-GDK-----VTVTPLEGEAVVKEFERT-SGVS  295

Query  368   EELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             EE++ +   +           G+P  R S  +   D+  LE M ESG   G   + KK+
Sbjct  296   EEVEAWGKAL---------VAGKPDERQSVEKALGDLEFLEQMFESGSNGG---ETKKY  342



>gb|KFY61799.1| hypothetical protein V496_04887 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY99520.1| hypothetical protein V498_00671 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=852

 Score =   102 bits (254),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 175/358 (49%), Gaps = 22/358 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + L  LKAI+SRS  +A +   +A+           G  
Sbjct  507   VAIIGSGIFATEQHLPAV-EATPLLELKAIFSRSLLAATALATIAKGDVDTYADDNDGKD  565

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q       L  GKHVL EKP A  I  AE  L+H+ +  
Sbjct  566   YAALLARSDITAVIIALPINAQPVYIEAALAAGKHVLSEKPIAKDIESAEK-LIHFYTAL  624

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                  K  W VAEN+RF   F   ++ I ++G ++  +V +   + +   YF + WR+  
Sbjct  625   KEKGSKATWGVAENFRFMAPFIFARQEIEKLGGVVGFRVKVFQHVKAGTKYFETEWRKVP  684

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             ++ GGF+LD GVH+ A  R+L+G      S+SA T+ +   LPP D +++++Q  NG SG
Sbjct  685   SYQGGFLLDGGVHFTAATRLLLGANYRPKSLSAYTALLQPHLPPVDTVNSIWQTANGISG  744

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--CGV  372
                +   +      + +   NG++ V R     + G        DG + +   P    GV
Sbjct  745   TVQISFGTSLSGDEYTIACYNGSVVVSRDTVSVRSGEE-----KDGNVTTRVLPASGSGV  799

Query  371   QEELKTFLSDISLANTKGGECKGEPRL-SFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             + E+K +         +G E  GE  L S  E   D+ +LEAM++SG+ EG  V + +
Sbjct  800   KAEVKAW--------AEGIESGGENGLQSPAEALADLELLEAMIKSGEGEGVKVILTR  849



>ref|XP_009854174.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO54186.1| hypothetical protein NEUTE1DRAFT_131795 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ68383.1| NAD(P)-binding protein [Neurospora tetrasperma FGSC 2509]
Length=352

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 114/375 (30%), Positives = 189/375 (50%), Gaps = 52/375 (14%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNH---FPNVECKWG  1083
             IA+LG+GIF + Q++P +  +  L  LKAI+SRSE SA +    A +    + +V    G
Sbjct  4     IALLGAGIFAREQHLPAIESVPSL-SLKAIYSRSESSANTLASAASSPVDVYYDVPTGSG  62

Query  1082  GAG-------LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeae  924
              A        L+ ++  T I  V + +    Q  +  + LK GKHVL EKP A  + EA+
Sbjct  63    EANVWPEEKTLDALLARTDIDAVVIALPILAQPAVIEKALKAGKHVLSEKPVAKDVEEAK  122

Query  923   nALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEI-GDMMNVQVIIEGsmnssn  747
               +  Y +L     +KP+WAVAEN+R+ P+  +  + + EI G +   ++ + G +   N
Sbjct  123   RLVGFYEALDN---KKPLWAVAENFRYTPSLLKAAEKVKEIGGKLTTFRLNMNGWVEEGN  179

Query  746   pyfssSWRR--NFFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNI  582
              YF + WR+  ++ GGF+LD GVH++AGLR+L+     E+T V+  ++ +++ L P D +
Sbjct  180   KYFKTEWRKVPSYQGGFLLDGGVHFIAGLRLLLSELNQEITHVAGFSALLEERLLPVDTV  239

Query  581   SALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI  402
              A+    +G SG  ++   ++              LEVE     G      S+Y    QI
Sbjct  240   HAVALTNDGKSGTISISFGTQ----------FKTGLEVEVVTTQG------SVYWNPTQI  283

Query  401   KSF---------FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEA  249
             K+          F    GV+EE+  F   I     + G+ + E      E  +D+ V++ 
Sbjct  284   KTKTKEGEKTEEFEKSTGVKEEMAAFAKAI-----EKGQIEKEQTPE--EALKDLEVVQR  336

Query  248   MLESGKREGALVQVK  204
             +LESG+ +G +  V+
Sbjct  337   LLESGEGKGIVKAVE  351



>gb|KIO22407.1| hypothetical protein M407DRAFT_118073 [Tulasnella calospora MUT 
4182]
Length=372

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 195/389 (50%), Gaps = 50/389 (13%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFV---LKAIWsrseesarsavelaRNHF  1107
             M+ ++L  +AILG+GI+ K   +P +A +    V   ++A++SRS  SA +  E A+   
Sbjct  1     MSPTEL-SVAILGAGIWAKEADLPAIAALQSAQVPIKVEAVYSRSTSSASALAEAAQQTL  59

Query  1106  ------------PNVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVL  963
                         P+ E      GL+E++  + I  V VV+    Q E+ ++ LK GKHVL
Sbjct  60    KLNSGLTVYSDAPDRE------GLDELLARSDIQAVIVVLPLGQQPEIVIKALKAGKHVL  113

Query  962   QekpaaaciaeaenALMHYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMI--AEIG  798
              EKP A  +  A   +  Y +       KP   IW VAEN+  EP      + I   +IG
Sbjct  114   SEKPVAKDVKAALELIKTYET-----EYKPKGLIWRVAENFECEPGIRAAAEAIRSGKIG  168

Query  797   DMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAM  624
              +   ++ +   ++  + ++ +SWR   ++ GGF+LD GVH +A LR ++   V S+S  
Sbjct  169   KVAFFRLSVVNYIDQESKWYQTSWRTVPDYQGGFLLDGGVHSMAVLRTILPSPVVSLSGH  228

Query  623   TSHVDKTLPPPDNISALFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERG-  459
              S     L P D+I ++  L++G  G+    FA   S+R   +   + G  G LE+  G 
Sbjct  229   ASLTKPYLLPHDSIQSVLALDSGAHGILELSFAAPSSARGESLT-VITGTEGFLELTSGK  287

Query  458   NKDGKHGYSVSLYMG--DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSF  285
             N+ G  G+++   +G  D + +  FY   G+  E++ F+  + L   +     GEPR + 
Sbjct  288   NETGVQGWTIKTVVGTKDPKEEKQFYKGQGIDNEIEWFVQAV-LKGEQNSVSVGEPRGAI  346

Query  284   VEGTRDIAVLEAMLESGKREGALVQVKKF  198
                 RD+A+++A L SG   GALV +KK 
Sbjct  347   ----RDVALIQAALTSG---GALVDIKKL  368



>gb|KIH93169.1| hypothetical protein SPBR_02922 [Sporothrix brasiliensis 5110]
Length=369

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 111/374 (30%), Positives = 179/374 (48%), Gaps = 45/374 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW----  1086
             IA+LG+GIF + Q++P + + S L  LKA++SRS+ SA +    A    P ++  W    
Sbjct  5     IALLGAGIFAQAQHLPAI-KASDLLALKAVYSRSQASAEAFASKAG--VPGLDVYWDEPA  61

Query  1085  -GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
               G GL +++  + +  V+V +    Q +     L  GKHV+ EKP A  +A A+  +  
Sbjct  62    AAGRGLADLLARSDVAAVSVCMPINLQPQAIRAALAAGKHVISEKPVADTVAHAQALIAD  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECK-KMIAEIGDMMNVQVIIEGsmnssnpyfss  732
             Y++L     +KPIWAVAENYR+  +    + K+ A  GD+++  ++    + +   YF++
Sbjct  122   YDALP----RKPIWAVAENYRYMQSLQLAEAKLRALGGDLVSFSLVSNKFVRTDGNYFNT  177

Query  731   SWRRN--FFGGFILDMGVHYVAGLRMLVGC----------EVTSVSAMTSHVDKTLPPPD  588
             +WR+N    GGF+LD GVHYVA LR L+            ++T V+   + + + LPP D
Sbjct  178   AWRKNPTHPGGFLLDGGVHYVAALRSLLRAAPGGNTNNNNKITKVAGTMAQLLEILPPAD  237

Query  587   NISALFQLENGCSGVFAM------------VVSSRSPKIVWRVVGLNGTLEVERGNKDGK  444
              + A+   + G SGV  M             V++    + WR+  +  T    R   D  
Sbjct  238   TLRAIAFTQGGASGVVTMSFGTEFGPPLDIAVTTTEGMVTWRMKSVTVT---TRNAADPF  294

Query  443   HGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDI  264
               +   L   +           GV+ E          A+   G+   + R S VE   D+
Sbjct  295   KPHETVLDCSETNPSFPADEATGVKAEFAA-----FAASIAAGQNTVDARQSPVEALEDL  349

Query  263   AVLEAMLESGKREG  222
              +LEAM E+G   G
Sbjct  350   RLLEAMFETGAAGG  363



>gb|KEZ39853.1| Oxidoreductase-like protein [Scedosporium apiospermum]
Length=348

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 110/359 (31%), Positives = 177/359 (49%), Gaps = 32/359 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             IAILG+GIF + ++ P + E  + F LKA++SRS++SA +    A+    +V      A 
Sbjct  5     IAILGAGIFAREEHYPAI-EACEFFSLKAVYSRSQKSASTLASSAKAKV-DVYSDDSSAD  62

Query  1073  --LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
               L+ ++  + I  V V V   +Q  +  + +  GKHVL EKP A  +A A   +  Y  
Sbjct  63    KTLDALLSRSDIHAVTVAVPIPSQPSVIKKAIAAGKHVLSEKPIAKDLATARELIEWYKD  122

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfssSWR  723
             +      +PIW VAEN+RF  + T   + I  IG +++     +   +   + YF++ WR
Sbjct  123   IKA---PRPIWGVAENFRFLESVTYATEQIRAIGGEIVTFSFSLYALVKDDDKYFNTDWR  179

Query  722   R--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             +  ++ GGF+LD GVH+VAG+R  +   G EV  +SA TS + + LPP D +  L    +
Sbjct  180   KIPDYQGGFLLDGGVHFVAGIRSFLAAAGQEVKQLSARTSLIQEKLPPVDTVHGLLTTGS  239

Query  557   GCSGVFAMVVSSR-SPKIVWRVVGLNGTLEVE----RGNKDGKHGYSVSLYMGDGQIKSF  393
             G SG F +   +         +V   G + +        K G  G          + K  
Sbjct  240   GRSGTFCVSFGTEFKSDFCIELVTTKGAVRLTPVEVTTTKQGTDGEK-------AEEKKI  292

Query  392   FYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  216
             F    GV+ E+  F   I     + GE   +PR +  +G +D+ +L+ +LESG+  GA+
Sbjct  293   FEFSVGVKPEIVAFAKSI-----QKGEV--DPRQTPEQGYKDLEILQGLLESGECSGAI  344



>ref|XP_007588173.1| putative oxidoreductase nad-binding rossmann fold protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD44322.1| putative oxidoreductase nad-binding rossmann fold protein [Neofusicoccum 
parvum UCRNP2]
Length=330

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 174/358 (49%), Gaps = 41/358 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG+FV+ +++P + E   L  LKA++SRS +SA++            E    G  
Sbjct  5     VAIIGSGVFVREKHLPAVQEAPSL-TLKALFSRSLKSAQALGSDLSGVDLYSEDAGEGKA  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++  + I GV + +    Q E     L  GKHVL EKP A  +A A   L  YN   
Sbjct  64    FSDLLARSDIKGVIMALPIPAQPEYIKAALSAGKHVLSEKPIAKDVATARELLDWYNK--  121

Query  893   TNMTQ-KPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR-  720
              N+ + K  W VAEN+RF  ++    + + E+                      +SWR  
Sbjct  122   -NIDKSKVTWGVAENFRFFESYRYGAEKVKELA---------------------TSWRTK  159

Query  719   -NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
              ++ GGF+LD GVH++A  R+L+      TSVSA T+   + LPP D + A+++L NG S
Sbjct  160   PSYQGGFLLDGGVHFIAATRVLLSDSAHATSVSAFTALHQEHLPPVDTVDAIWKLSNGSS  219

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG---QIKSFFYPFC  378
             G F+   ++  P   +RVV   GT+    G       Y V++   D    + K F     
Sbjct  220   GTFSNSFAAPVPVTEYRVVCERGTVTTGFGTVPFAPAY-VAVKRADADDEEKKEFPEVGF  278

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
             GV  E+  +   +     KGG    + R    E  +D+ +LEAML+SG++ GA V ++
Sbjct  279   GVNPEVAAWGQKLE----KGG---FDERQLPEEALKDLEILEAMLKSGEQGGAPVTLQ  329



>emb|CCA69637.1| hypothetical protein PIIN_03576 [Piriformospora indica DSM 11827]
Length=367

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 179/362 (49%), Gaps = 32/362 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW----  1086
             +AILG+GIF +  ++P L ++   + LKAI+SRS+ SA    + A +        +    
Sbjct  6     VAILGAGIFARIAHLPALRKLGDTYELKAIYSRSQSSASELAKTAEDILARPASSFDLYH  65

Query  1085  -GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
               G  L+ ++  T I  V +V+    Q  + L+ L+ GKHV+ EKP A  + E    +  
Sbjct  66    DAGQNLDALLARTDIQAVIIVLPINQQPSIVLKALEAGKHVISEKPIAPTVKEGVKLIKM  125

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMM--NVQVIIEGsmnssnpy  741
             Y +   +  +  IW VAEN+  EP      K IA+  IG +   N+QV+   ++ + + +
Sbjct  126   YEAHYKD--KGLIWRVAENFEAEPGLRAAGKAIADQKIGKVCFWNMQVL--NNVETDSMW  181

Query  740   fssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQ  567
             +++ WR    + GGF+LD GVH  A LR ++  + T ++   S   + L P D I A+ +
Sbjct  182   YNTPWRTVPEYQGGFLLDGGVHSAAALRTVLPSKFTELAGFASLNREHLAPHDTIHAIIR  241

Query  566   LENGCSGVFAMV--VSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM-------G  414
              E+G  G+F +   + S      +RVVG +GTL++ R ++          ++        
Sbjct  242   SEDGSHGIFELSFGLPSSPGHDSFRVVGTDGTLDINRYHEKDPETQKDQAFIKVTIKNAK  301

Query  413   DGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
              GQ +      CGV+ EL+ F + ++  +   G  +G          +D++V++A L+S 
Sbjct  302   TGQKEEIVERSCGVERELENFAAHLNGHDDGLGTPQG--------ALQDVSVIQAALDSH  353

Query  233   KR  228
              R
Sbjct  354   GR  355



>gb|KJK67904.1| Oxidoreductase family NAD-binding Rossmann fold [Aspergillus 
parasiticus SU-1]
Length=354

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 107/375 (29%), Positives = 178/375 (47%), Gaps = 52/375 (14%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF------PNVEC  1092
             +A+LG+GIF K +++P +     L  LKA++SRS+ SA S    A          P+V+ 
Sbjct  5     VALLGAGIFAKKEHLPAIKSCPSL-SLKAVYSRSQTSAESFAATAGEDIEAYFESPSVQS  63

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             K     L+++++   I  V + VA     ++  + L  GKHVL EKP A  +  A+  L 
Sbjct  64    K----SLDDLLQRQDIAAVIIAVAITAAPDLIQKALAAGKHVLSEKPIAPDVETAQRLLD  119

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfs  735
             +++     M    +W V EN+RF     +  K++ E+G  ++   V      +S NP++ 
Sbjct  120   YHHQ---QMKGGVLWGVGENFRFWDPVHQAAKILTEMGGSLVTFSVTAYSFTDSKNPFYH  176

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALF  570
             + WR+   F GG++LD GVH+ A LR L+   G  V  VSA T+ + K LPP D + A+ 
Sbjct  177   TDWRQKPTFQGGYLLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQKDLPPLDTVHAVL  236

Query  569   QLENGCSGVFAMVVSSRSPK------------IVWRVVGLNGTLEVERGNKDGKHGYSVS  426
             +   G SG +   V  ++ +            +++R   +   ++ ++G +  +      
Sbjct  237   RTNKGRSGTYTSSVGIQAKRGMEFEIVTDKGYVIYRPFQMEILIKQDQGGRWEERSEPAP  296

Query  425   LYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAM  246
             L               GV+EE+  F + IS  +        + RLS  E   D+ ++EAM
Sbjct  297   L-------------MWGVKEEIAAFAASISTGSL-------DSRLSTTEALEDLKIVEAM  336

Query  245   LESGKREGALVQVKK  201
             L SG  +   V V K
Sbjct  337   LRSGDAQALPVDVTK  351



>gb|EPE09779.1| nad-binding rossmann fold oxidoreductase family protein [Ophiostoma 
piceae UAMH 11346]
Length=368

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 106/371 (29%), Positives = 175/371 (47%), Gaps = 48/371 (13%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNV---ECKWG  1083
             IA+LG+GIF + Q++P + +   L  LKA++SRS+ +A + V         V   E    
Sbjct  5     IALLGAGIFAQNQHLPAI-DGCDLLELKAVYSRSQATAEAFVTKTGKTGLPVYFDEPATP  63

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G GL +++  + I  VAV +    Q +     L  GKHVL EKP A  +A A   + HY 
Sbjct  64    GKGLADLLARSDIAAVAVAMPINLQPQAIRTALAAGKHVLSEKPVANTVANARALIAHYA  123

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyf--ssS  729
             SL +     P+W VAENYR++ +    ++ + +IG  + V  ++  +          +++
Sbjct  124   SLPS----APLWGVAENYRYQASLHLAEEEVKKIGGTL-VSFVLNSNKFVRPDGNYFNTA  178

Query  728   WRRN--FFGGFILDMGVHYVAGLRMLVGC---------EVTSVSAMTSHVDKTLPPPDNI  582
             WR+N    GGF+LD G+HYVA LR L+           ++T ++     + + LPP D +
Sbjct  179   WRKNPTHPGGFLLDGGIHYVASLRSLLAAAGAPPSKSNKITKLAGTMEQLLEILPPADTV  238

Query  581   SALFQLENGCSGVFAMV------------VSSRSPKIVWRVVGLNGTLEVERGNKDGKHG  438
               +   E+G SGV  M             V++    + W         +V    ++    
Sbjct  239   RNIAVTESGASGVVTMSFGTEFGCPLEISVTTTEGMVTWT------PKKVTVATRNEADL  292

Query  437   YSVSLYMGDGQIKSFFYPF---CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRD  267
             ++  +   D   K+  +P     GV+ E + F ++I+      G+   E RLS  E   D
Sbjct  293   FNPHIVEHDCSPKNPAFPADEGTGVKAEFRAFAANIA-----AGKKAVETRLSPAEALAD  347

Query  266   IAVLEAMLESG  234
             + +LEAM +SG
Sbjct  348   LELLEAMFDSG  358



>dbj|GAM35894.1| oxidoreductase [Talaromyces cellulolyticus]
Length=349

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 102/348 (29%), Positives = 171/348 (49%), Gaps = 20/348 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +A++G GI+ K +++P +   S+   LKAI+SRS +SA+           ++  +    G
Sbjct  5     VALIGGGIWAKEEHLPAIL-ASKDLELKAIYSRSLKSAKDVAGEVSQKI-DLYSEDTSQG  62

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              E+I+K   I  + V +    QV      L  GKHVL EKP A  +A+A N +  Y+   
Sbjct  63    YEDILKRDDIQALVVSLPIANQVPFIRSALSAGKHVLSEKPVAENVADAVNLIKWYHEHK  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
                 +   W+VAEN+R+  +F   +  I ++G ++  +V I  ++     +F +SWR+N 
Sbjct  123   A-AHKDATWSVAENFRYLESFKNARLEIEKLGKIIGFRVRIYANIQEGWKFFETSWRKNP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
                GGF+LD GVHY A LR L+G +  VT ++A T+ + + LPP D + A+ +   G  G
Sbjct  182   THQGGFLLDGGVHYTAALRGLLGSDVHVTRLAAFTTLLKEHLPPVDTMDAILKTNTGIQG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  366
              F   V++      W +    GT+ V       K   +V    G+   K+      GV  
Sbjct  242   TFQSSVATTLTGPEWTIACEKGTVTV------AKSEVTVRPVDGEEVTKTIPDERTGVPP  295

Query  365   ELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             E++ +   ++         +  P  S  E   D+ +++ ML SG++EG
Sbjct  296   EIRAWGEALAAG-------RQNPEQSPEEALADLELIQLMLRSGEKEG  336



>ref|XP_002382548.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
flavus NRRL3357]
 gb|EED47706.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
flavus NRRL3357]
Length=341

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 101/352 (29%), Positives = 173/352 (49%), Gaps = 32/352 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG F + +++P + + S  F LKAI+SRS  SA++            E    G  
Sbjct  5     VAIIGSGNFAREEHLPGV-QASDAFDLKAIYSRSLTSAQTLATGVSGIDLYSEDAGPGKT  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++  + I  V + +    Q E   + L  GKHVL EKP A  ++ A++ +  +NS  
Sbjct  64    YDDLLSRSDITAVIIALPILAQPEFIRKALTAGKHVLSEKPIAKDLSAAQDLINLHNS--  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
               ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR  
Sbjct  122   RIVSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
              + GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +G
Sbjct  182   EYQGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--C  378
             V ++   S     ++     +G  TL+ +R   +G+ GY V              PF   
Sbjct  242   VLSVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDV--------------PFEGR  286

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             GV +EL  F   I+  +      + E  L+      D+ V+E +  S ++ G
Sbjct  287   GVNKELVEFAESITTGDGIATRLRPEEALA------DLEVMEGIFTSSEKAG  332



>ref|XP_007367395.1| oxidoreductase family protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF59932.1| oxidoreductase family protein [Dichomitus squalens LYAD-421 SS1]
Length=368

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 115/379 (30%), Positives = 180/379 (47%), Gaps = 40/379 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF-----PNV-EC  1092
             +AILGSGIF K  ++P LAE+   F LKA++SRS +SA +  + A+        P+V   
Sbjct  6     LAILGSGIFAKEAHLPALAELGDSFELKAVYSRSSKSASAFAKDAQEALKLQSPPDVYHD  65

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             +     L+ +   + I  V VV+    Q  + L+ L  GKHVL EKP A  +++    + 
Sbjct  66    EDTSVSLDVLFARSDIDAVIVVLPITVQPAIVLKALAAGKHVLSEKPIAPDVSKGRALIQ  125

Query  911   HYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssn  747
              Y +       KP   +W VAEN+  EP F   +++I E  +G ++         ++ ++
Sbjct  126   EYET-----KYKPKGLVWRVAENFEAEPGFQAARRVIREGKLGKIVYFNARSYNWIDETS  180

Query  746   pyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISAL  573
              ++++ WR   ++ GGF+LD GVH +A LR+++    T++SA  S   + LPP D I+A+
Sbjct  181   KWYNTPWRTVPDYQGGFLLDGGVHTIAALRLILDSPFTTLSAHASLAKEILPPQDTINAI  240

Query  572   FQLENGCSGVFAMVVSSRSPKIVW------RVVGLNGTLEVERGNKDGKHGYSVSLYMGD  411
                 NG  G+  +   S  P           V G +G LE+ R +   +     +     
Sbjct  241   VSTANGAHGIVELSWGSPVPSRAADAHNSISVTGKDGWLEITRASGIVRITVKTATRDEK  300

Query  410   G-----QIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAM  246
             G     Q         GVQ E+ +FL  +   N K     G PR + V    D+A +EA 
Sbjct  301   GTVTGEQTAVIEEKEAGVQLEIASFLEAL---NGKDDGLDG-PRGTLV----DVAFIEAA  352

Query  245   LESGKREGALVQVKKF*AF  189
             L S   +G  V V K  A 
Sbjct  353   LNS---DGVAVDVGKLAAL  368



>ref|XP_001275918.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
clavatus NRRL 1]
 gb|EAW14492.1| NAD-binding Rossmann fold oxidoreductase family protein [Aspergillus 
clavatus NRRL 1]
Length=341

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 137/242 (57%), Gaps = 7/242 (3%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF + +++P + + ++ F L+A++SRS +SA+       +     E    G G
Sbjct  5     VAIIGSGIFAREEHLPAV-QAAKDFQLRAVYSRSLKSAQELASGTPDVELYSEDSGPGKG  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++    I  V + +    Q E   + L  GKHVL EKP A  IA A + L  Y++  
Sbjct  64    YADLLARQDIAAVVIALPILVQPEFIRKALAAGKHVLSEKPIAKDIATARDLLQWYHA--  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
                T+K +WAVAEN+R+   F    + + ++G + N +V     +   + Y+ ++WR+  
Sbjct  122   NVDTRKTLWAVAENFRYMTKFIRAAEEVQKLGRVKNFRVHCHYLVEKDSKYYKTAWRQTP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
              + GGFILD GVH +AGLR+++G +  +T++SA +    + LPP D + A+ + ++G +G
Sbjct  182   EYQGGFILDGGVHMIAGLRLILGAQDPITTLSAQSCLQQQYLPPLDTVDAVLKTKSGATG  241

Query  545   VF  540
             V 
Sbjct  242   VL  243



>dbj|BAE61316.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=341

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 101/352 (29%), Positives = 172/352 (49%), Gaps = 32/352 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG F + +++P + + S  F LKAI+SRS  SA+             E    G  
Sbjct  5     VAIIGSGNFAREEHLPGV-QASDAFDLKAIYSRSLTSAQILATGVSGIDLYSEDAGPGKT  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++  + I  V + +    Q E   + L  GKHVL EKP A  ++ A++ +  +NS  
Sbjct  64    YDDLLSRSDITAVIIALPILAQPEFIRKALTAGKHVLSEKPIAKDLSAAQDLINLHNS--  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
               ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR  
Sbjct  122   RIVSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
              + GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +G
Sbjct  182   EYQGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--C  378
             V ++   S     ++     +G  TL+ +R   +G+ GY V              PF   
Sbjct  242   VLSVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDV--------------PFEGR  286

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             GV +EL  F   I+  +      + E  L+      D+ V+E +  S ++ G
Sbjct  287   GVNKELVEFAESITTGDGIATRLRPEEALA------DLEVMEGIFTSSEKAG  332



>gb|ERT01696.1| hypothetical protein HMPREF1624_02949 [Sporothrix schenckii ATCC 
58251]
Length=369

 Score = 97.4 bits (241),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 110/374 (29%), Positives = 176/374 (47%), Gaps = 45/374 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW----  1086
             IA+LG+GIF + Q++P + + S L  LKA++SRS+ SA +    A    P ++  W    
Sbjct  5     IALLGAGIFAQAQHLPAI-KASDLLALKAVYSRSQASAEAFASKAG--VPGLDVYWDEPA  61

Query  1085  -GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
               G GL +++  + +  V+V +    Q +     L  GKHV+ EKP A  +A A+  +  
Sbjct  62    AAGRGLADLLARSDVAAVSVCMPINLQPQAIRAALAAGKHVISEKPVADTVAHAQALIAD  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECK-KMIAEIGDMMNVQVIIEGsmnssnpyfss  732
             Y++L     +KPIWAVAENYR+  +    + K+ A  GD+++  ++    +     YF++
Sbjct  122   YDALP----RKPIWAVAENYRYMQSLQLAEAKLRALGGDLVSFSLVSNKFVRPDGNYFNT  177

Query  731   SWRRN--FFGGFILDMGVHYVAGLRMLVGC----------EVTSVSAMTSHVDKTLPPPD  588
             +WR+N    GGF+LD GVHYVA LR L+            ++T V+   + + + LPP D
Sbjct  178   AWRKNPTHPGGFLLDGGVHYVAALRSLLRAAPGGNTTNNNKITKVAGTMAQLLEILPPAD  237

Query  587   NISALFQLENGCSGVFAM------------VVSSRSPKIVWRVVGLNGTLEVERGNKDGK  444
              + A+   + G SGV  M             V++    + WR+  +  T    R   D  
Sbjct  238   TLRAIAFTQGGASGVVTMSFGTEFGPPLDIAVTTTEGMVTWRMKSVTVT---TRNAADPF  294

Query  443   HGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDI  264
               +   L   +           GV+ E          A    G+   + R S  E   D+
Sbjct  295   KPHETVLDCSETNPSFPADEATGVKAEFAA-----FAATIAAGQNTVDARQSPAEALEDL  349

Query  263   AVLEAMLESGKREG  222
              +LEAM E+G   G
Sbjct  350   RLLEAMFETGAAGG  363



>gb|EER41723.1| NAD-binding Rossmann fold oxidoreductase [Histoplasma capsulatum 
H143]
Length=352

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 170/359 (47%), Gaps = 39/359 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLA--------------EISQLFVLKAIWsrseesarsavelaR  1116
             IA+LG+GIF K  ++P LA              E S   V++A+ S S     + +++  
Sbjct  4     IALLGAGIFAKEAHVPVLAHNDKAKVLAVYSRSETSANSVVEALHSTSTAGTSATLDVYS  63

Query  1115  NHFPNVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaci  936
             +  P       G GL+E+++   I  V VV+       +  + L  GKHVL EKP    +
Sbjct  64    DEKP-------GYGLDELLQRADIEAVIVVLPILVLPAVVRKCLAAGKHVLAEKPIGPDV  116

Query  935   aeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGs  762
             A     +  Y S  T   +  + ++AE +R+E A     ++IA  +IG++ +V   +  +
Sbjct  117   AAGRALIAEYES--TYAPRNLVLSIAEQFRYETALIRAGELIAGGKIGELHHVHGRVATT  174

Query  761   mnssnpyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPD  588
             M   N +  ++WR    + GGF+LD GVH+VA +RM+ G E+   ++ T+     L P D
Sbjct  175   MAPDNKFCKTAWRATPGYQGGFVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVD  234

Query  587   NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  408
              ++A  +   G  G F+M  ++ +    +  +G  G L V+R      H  +V +   D 
Sbjct  235   TVNAALKFSGGAQGTFSMSFAAATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDL  290

Query  407   Q-IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
             + I    +   G+  E+  F+  ++    + G+  G PR    E   D+AV+E++   G
Sbjct  291   KPISEEAFKADGMMNEISAFVQAVA---ARKGDKAGSPR----EALADVAVIESICSGG  342



>ref|XP_007699535.1| hypothetical protein COCSADRAFT_89105 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD65015.1| hypothetical protein COCSADRAFT_89105 [Bipolaris sorokiniana 
ND90Pr]
Length=342

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 127/240 (53%), Gaps = 22/240 (9%)
 Frame = -2

Query  905  NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
            N  +T++T    + VAEN+RF  ++    + +A +G +++ +V +   +   + Y+ ++W
Sbjct  120  NPANTSVT----YTVAENFRFIDSYIWASQQLASLGRVLSFRVRVMFFVPVGSKYYETAW  175

Query  725  RRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
            R+     GGF+LD GVH+VA  R+L+   G +V  VSA T+ + + LPP D ++A+ QLE
Sbjct  176  RKKPEHQGGFVLDGGVHFVAATRLLLQGAGQKVKRVSAFTAQLQEHLPPVDTLNAVLQLE  235

Query  560  NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
            NG SG  ++ V +      + V    G + V RG         V     +G+ K F    
Sbjct  236  NGSSGTLSISVGTTDQGSEYVVACEKGVVTVSRGK------VVVKRQGEEGETKEFPDEG  289

Query  380  CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKK  201
             GV++E+K +    SL   K  E +     S  E  +D+ +LE+ L+SG++ G  + V++
Sbjct  290  NGVKQEIKAWAK--SLEEGKRNEMQ-----SPEEALKDLEILESCLKSGEQGGTPIDVEQ  342



>gb|EWG49872.1| glucose-fructose oxidoreductase [Fusarium verticillioides 7600]
 gb|EWG49873.1| glucose-fructose oxidoreductase [Fusarium verticillioides 7600]
Length=345

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 179/358 (50%), Gaps = 28/358 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave--laRNHFPNVECKWGG  1080
             +A++G G+F K  ++P + +   L  LKAI+SRS +SA+            P++     G
Sbjct  6     VALIGGGLFAKQAHMPAIMKADNL-ALKAIYSRSLKSAKETAALNTRSGQDPDLYSADSG  64

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             +G   ++++    I  V + +   +Q E     L  GKHVL EKP A  +A+ +  + +Y
Sbjct  65    SGKSFDDLLAREDIEAVIIALPIPSQPEHIRAALAAGKHVLAEKPLAPTVADGKKLIEYY  124

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
              SL    T    +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++W
Sbjct  125   RSLGDKAT----FSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAW  180

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             R    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G 
Sbjct  181   RAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVVRLKSGV  240

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SG +     S+    V++     G++ V+ G+K      +V+ + G+  +K F     GV
Sbjct  241   SGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDGEPAVKEFERT-SGV  293

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EE++ +   ++       E + + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  294   TEEVEAWSKALA-------EGRPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>ref|XP_009263289.1| hypothetical protein FPSE_11897 [Fusarium pseudograminearum CS3096]
 gb|EKJ67888.1| hypothetical protein FPSE_11897 [Fusarium pseudograminearum CS3096]
Length=354

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 106/360 (29%), Positives = 176/360 (49%), Gaps = 34/360 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF-----------  1107
             +A++G G+F K  ++P + +   L  LKAI+SRS +SA+    L                
Sbjct  6     VALIGGGLFAKQAHMPAIVKAGNL-DLKAIYSRSLKSAQETAALDTRGTGAGSGPGSGSG  64

Query  1106  PNVECKWGGAG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaacia  933
             P++     G G  L +++    I  V + +   +Q E     L  GKHVL EKP A  +A
Sbjct  65    PDLYSADSGPGKSLNDLLARDDIDAVIIALPIPSQPEYIQAALAAGKHVLAEKPIAPSVA  124

Query  932   eaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmns  753
             +A   + +Y SL    T    +++AEN+R++P F       A++G + +  V +   M  
Sbjct  125   DANKLIDYYRSLQGKCT----FSIAENFRYKPCFEYAANEAAKLGALQHFSVRVFFFMAE  180

Query  752   snpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  579
              + ++ +SWR    F GGF+LD GVH+VA +R L       VSA TS V   L P D ++
Sbjct  181   DSKWYGTSWRAKPQFQGGFLLDGGVHFVAAMRQLFDEPAADVSAFTSQVQPHLAPVDTVN  240

Query  578   ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIK  399
             A+ +L++G SG +     ++     ++     G++ V+ G+K      +V+ + G+  +K
Sbjct  241   AVIRLKSGVSGTYQQSCGTKMSTSAFQFGYEKGSVVVD-GDK-----VTVTPWEGEQVVK  294

Query  398   SFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  219
              F     GV EE++ + + +        + K + R S  E   D+ +LE M ESG   GA
Sbjct  295   DFERT-SGVDEEIEAWANALV-------DGKPDKRQSVEEALADLELLEMMFESGSDGGA  346



>gb|KJR88931.1| hypothetical protein SPSK_07648 [Sporothrix schenckii 1099-18]
Length=369

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 110/374 (29%), Positives = 175/374 (47%), Gaps = 45/374 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW----  1086
             IA+LG+GIF + Q++P + + S L  LKA++SRS+ SA +    A    P ++  W    
Sbjct  5     IALLGAGIFAQAQHLPAI-KASDLLALKAVYSRSQASAEAFASKAG--VPGLDVYWDEPA  61

Query  1085  -GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
               G GL +++  + +  V+V +    Q +     L  GKHV+ EKP A  +A A+  +  
Sbjct  62    AAGRGLADLLARSDVAAVSVCMPINLQPQAIRAALAAGKHVISEKPVADTVAHAQALIAD  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECK-KMIAEIGDMMNVQVIIEGsmnssnpyfss  732
             Y++L     +KPIWAVAENYR+  +    + K+ A  GD+++  ++    +     YF++
Sbjct  122   YDALP----RKPIWAVAENYRYMQSLQLAEAKLRALGGDLVSFSLVSNKFVRPDGNYFNT  177

Query  731   SWRRN--FFGGFILDMGVHYVAGLRMLVGC----------EVTSVSAMTSHVDKTLPPPD  588
             +WR+N    GGF+LD GVHYVA LR L+            ++T V+   + + + LPP D
Sbjct  178   AWRKNPTHPGGFLLDGGVHYVAALRSLLRAAPGGNTTNNNKITKVAGTMAQLLEILPPAD  237

Query  587   NISALFQLENGCSGVFAM------------VVSSRSPKIVWRVVGLNGTLEVERGNKDGK  444
              + A+     G SGV  M             V++    + WR+  +  T    R   D  
Sbjct  238   TLRAIAFTRGGASGVVTMSFGTEFGPPLDIAVTTTEGMVTWRMKSVTVT---TRNAADPF  294

Query  443   HGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDI  264
               +   L   +           GV+ E          A    G+   + R S  E   D+
Sbjct  295   KPHETVLDCSETNPSFPADEATGVKAEFAA-----FAATIAAGQNTVDARQSPAEALEDL  349

Query  263   AVLEAMLESGKREG  222
              +LEAM E+G   G
Sbjct  350   RLLEAMFETGAAGG  363



>gb|KKA24050.1| NAD-binding Rossmann fold oxidoreductase family protein [Rasamsonia 
emersonii CBS 393.64]
Length=397

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 135/262 (52%), Gaps = 25/262 (10%)
 Frame = -2

Query  992  RLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPI-WAVAENYRFEPAFTECKK  816
            + L  GKHVL EKP A  +A A+  +  Y+S   N+  K I W VAEN+R+   F    +
Sbjct  147  KALSAGKHVLSEKPIAKDLATAQELVQWYHS---NVDSKRIFWGVAENFRYFTQFLYAAE  203

Query  815  MIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCE-  645
             + ++G + N +V +     +   Y+ + WR+   + GGF+LD G+H VAG+R+L+G E 
Sbjct  204  QVQKLGRVKNFRVNVHTMTKTDFKYYLTEWRKVPEYQGGFLLDGGIHIVAGIRLLLGPEN  263

Query  644  -VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEV  468
             +T++SA T+ + + LPP D + A+ + ++G +G F+    S      + +    G + V
Sbjct  264  PITTLSAHTNLLQEHLPPVDTVDAIMKTKSGATGTFSASYGSDFKDFGFELSCEGGVVSV  323

Query  467  ERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLS  288
             R   DG           +G+ +   +   GV  E+  F + I+    KGG    + R  
Sbjct  324  SR---DG--------VFVNGEDQHIAFDGKGVVPEVADFAASIA----KGGPL--DRRQW  366

Query  287  FVEGTRDIAVLEAMLESGKREG  222
              E   D+ +LE ML SG+R+G
Sbjct  367  PEEALADLEILEKMLRSGERDG  388



>gb|KIH88824.1| hypothetical protein SPBR_07486 [Sporothrix brasiliensis 5110]
Length=343

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 104/351 (30%), Positives = 169/351 (48%), Gaps = 24/351 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-HFPNVEC---KW  1086
             IAILG+GIF   +++P L  ++    +KAI+SRS+ +A   V  A+      VE      
Sbjct  4     IAILGAGIFATEEHLPAL--VANKASVKAIYSRSQATAAPLVAEAQRLGQAGVELYSDDT  61

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G  L++++    I  V VV+    Q  +  R    GKHVL EKP A  +  A   +  Y
Sbjct  62    PGRTLDDLLARKDIAAVVVVLPIAVQPAIVRRCWAAGKHVLSEKPVAKDVQTARQLIRDY  121

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfs  735
              +  T   Q  +++VAE  RF P F   ++ + +   +G +  + + I  +  +   Y+ 
Sbjct  122   QA--TYAGQGLVFSVAEQIRFMPEFERGRQWVVDEQALGTITQLHLRIWRNQAAGGKYYE  179

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D ++A   L 
Sbjct  180   TPWRKVPAYQGGFLLDGGVHQTAMLRYIAGQEVVETHGYARQVAPHLPPLDTVNAGLVLS  239

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G +G  +M  +S        ++G  G+  +     DG  GY ++L +  G+ ++     
Sbjct  240   GGATGTLSMSFASPRRATELVILGTQGSFHL----TDGPDGYVLTLELLSGERRTETIKS  295

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
              GV+ E+K FL  I+     GG  K +PR    E   D+A++E++ + G +
Sbjct  296   RGVELEVKAFLEAIA-----GG--KAQPRAGPEEALNDLAIIESLCQGGGK  339



>ref|XP_011399715.1| Uncharacterized protein F751_0699 [Auxenochlorella protothecoides]
 gb|KFM26767.1| Uncharacterized protein F751_0699 [Auxenochlorella protothecoides]
Length=375

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 109/377 (29%), Positives = 179/377 (47%), Gaps = 32/377 (8%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
             ++A+LG G F ++ Y+P L        L  IWSR+ ESA SA          V    G  
Sbjct  6     RVALLGGGTFARSAYLPLLTPGQTDRTLIGIWSRTRESAESAA----GEAGGVPSWHGEV  61

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
             GL+E++    +  V VVVA Q  +++  + L  GK VL EKPA   +A  +  L   + +
Sbjct  62    GLQEVLARPDVDAVIVVVAAQATLQIVRQALAAGKVVLSEKPAGPTVAAVKEVL---DWM  118

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmnssnpyfssSWR  723
               +      W+V ENYR E       ++     +G ++   ++ E  MN  + Y++S+WR
Sbjct  119   QASGIPAARWSVQENYRGESGLVMAAELARSGALGRLVKADLVAELPMNPGSRYYASAWR  178

Query  722   RNFFGGFILDMGVHYVAGLRMLVGC----EVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             R   G F+L+ GVH+VA LR++       E   VSA+ +   + +P PD +    + + G
Sbjct  179   RQLPGSFLLEGGVHFVAALRLVCAAAGAGEPGRVSALLTRGSEGVPGPDTLVGWARFDGG  238

Query  554   CSGVFAMVVSSRSPKI--------VWRVVGL--NGTLEVERGNKDGKHGYSVSLYM----  417
                  ++  +   P++        VW VV +   GT+E +RG          + Y     
Sbjct  239   VPAGVSITQAGAIPRLCVTLVGTQVWMVVWIARGGTIEAKRGQWGAWTAAPANSYTLHAE  298

Query  416   --GD--GQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEA  249
               GD    +     PF GV  ++  F++  + A   G + + +  LS  E  RD+A++EA
Sbjct  299   SSGDVPASVDQRVLPFDGVGTQVGAFVAHAA-ALRDGRDAELDASLSVQEAARDLALMEA  357

Query  248   MLESGKREGALVQVKKF  198
             +L SG+R+G  V V++ 
Sbjct  358   LLRSGERQGEAVDVERL  374



>gb|ESZ98482.1| hypothetical protein SBOR_1144 [Sclerotinia borealis F-4157]
Length=345

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 179/357 (50%), Gaps = 23/357 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG-GA  1077
             +AI+GSGIFV+T+++P +     +  LKAI+SRS  SA+S       + P      G G 
Sbjct  5     VAIIGSGIFVQTEHLPAVQATPHI-SLKAIYSRSLSSAQSLNV----NVPLYSDDSGVGK  59

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
                +++  T I  V + +    Q E     L  GKHVL EKP A  +  A+  L +Y S 
Sbjct  60    AFNDLLLRTDIHAVIIALPILVQPEYIEAALAAGKHVLSEKPIAGDLERAQRLLQYYKS-  118

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR-  720
               N+  +  W+VAEN+RF  +F   +K + ++G ++  ++ +  ++   + YF + WR+ 
Sbjct  119   -DNVKGRATWSVAENFRFLDSFIHARKEVEKLGRVLGFRIKVFLNVKPGDKYFETEWRKK  177

Query  719   -NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
              ++ GGF+LD GVH+ A  R+++G     T+V A ++ + + LPP D I++++  ++G S
Sbjct  178   PSYQGGFLLDGGVHFTAAARLILGEATRPTTVVAFSTLLREHLPPVDTINSVWLTKSGIS  237

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             G F+           + +   NG++ V R     + G       G+     F     GV+
Sbjct  238   GTFSASFGITLSGPEYTIACENGSVTVIRSKVIVRKGEEKE---GNSTEVEFTEEGSGVK  294

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
             +E+  +   I        + K + R S  E   D+ +LE +L SG+ EG   Q  +F
Sbjct  295   QEVAAWAQSIK-------DGKPDSRQSPEEALADLEILEKLLRSGE-EGGKSQSLQF  343



>ref|XP_007793174.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
 gb|EMR67736.1| putative oxidoreductase nad-binding rossmann fold protein [Eutypa 
lata UCREL1]
Length=317

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/310 (28%), Positives = 144/310 (46%), Gaps = 32/310 (10%)
 Frame = -2

Query  1106  PNVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaea  927
             P +     G G EE++K T I  V + +   +Q       L  GKHVL EKP A  + +A
Sbjct  25    PELYSDEAGKGFEELLKRTDIDAVIISLPIASQPPYIKSALLAGKHVLSEKPVAENVKDA  84

Query  926   enALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssn  747
                +  Y S     T    W + EN+RF  ++T   K +  +G ++  Q   + S+  + 
Sbjct  85    VELIKWYRSEIKGQT----WTIGENWRFLNSYTYAAKELKSLGKIIGFQGRQQASIQLNW  140

Query  746   pyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGC----EVTSVSAMTSHVDKTLPPPDN  585
              +  + WRR     GG++LD GVHYVAGLR+L+G     E+  ++A TS + + LPP D 
Sbjct  141   KFNLTEWRRTPTHQGGYLLDGGVHYVAGLRLLIGTEPGNEIAKLAAFTSQIKEYLPPVDT  200

Query  584   ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG----NKDGKHGYSVSLYM  417
                + Q ++G +G F +   +      W V   NG +++E      ++DGK         
Sbjct  201   ADVILQTKSGITGTFQISRGTSLSADEWTVACENGWIKIENDKVTISRDGKE--------  252

Query  416   GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  237
                 +K+      GV  E++ +   +     +    + EP  +      D+ ++E ML S
Sbjct  253   ---DVKTVANERSGVPPEVRAWGEALVAGKIR---PEQEPEAALA----DLEIIELMLRS  302

Query  236   GKREGALVQV  207
             G++ GA ++ 
Sbjct  303   GEQGGAPLET  312



>ref|XP_006696746.1| hypothetical protein CTHT_0064410 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS18415.1| hypothetical protein CTHT_0064410 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=510

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 110/370 (30%), Positives = 183/370 (49%), Gaps = 43/370 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN--------HFPNV  1098
             IA++G+GIF + Q++P +   + L  LKA++SRS+ SA +    +++          P V
Sbjct  4     IALIGAGIFARQQHLPAIESCAGL-ALKAVYSRSQRSAEALAAASKDASSVAIYFDVPAV  62

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             +    G  L+++++   I+ V +V+    Q  +  + L  GKHVL EKP A  + + +  
Sbjct  63    K----GKSLDDLLQREDIVAVDIVLPIPHQPSVIRKALATGKHVLSEKPIAGNVVDGQEL  118

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNV-QVIIEGsmnssnpy  741
                Y  L     +KP+W VAEN+RF  +     + + EIG ++   ++   G +   N Y
Sbjct  119   FEWYLGLGE---RKPVWGVAENFRFLESLAYAAQKVKEIGGLLRTFRLEKYGFVGEDNKY  175

Query  740   fssSWRR--NFFGGFILDMGVHYVAGLRMLVGC---EVTSVSAMTSHVDKTLPPPDNISA  576
             F++ WRR   + GGF+LD GVH+VA LR L+G    E+  V+A TS ++  L P D + A
Sbjct  176   FNTEWRRVPQYQGGFLLDGGVHFVAALRFLLGAAGHELDKVAAFTSLLEPRLLPADTVHA  235

Query  575   LFQLENGCSGVFAMVVSSRSPKIVW-RVVGLNGTL-----EVERGNKDGKHGYSVSLYMG  414
             +   + G SG   +   +    ++   VV  NG +      V   N+ G         + 
Sbjct  236   VAFTKGGKSGTINITFGTEFKDVLEVEVVTTNGAVTWTPNAVTTVNRKGD-------CLA  288

Query  413   DGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLES  237
             D  +K+  +P+C GV  E+ +F   +            + R    EG +D+ V++ MLES
Sbjct  289   DKAVKTKEFPYCSGVLAEVASFAQALESGRL-------DLRQMPAEGLKDLEVVQRMLES  341

Query  236   GKREGALVQV  207
             G+  G L  V
Sbjct  342   GEDHGVLKTV  351



>gb|EEQ92492.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ER-3]
Length=345

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 103/348 (30%), Positives = 175/348 (50%), Gaps = 22/348 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4     IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63    GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssS  729
             +  T   +  +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++
Sbjct  123   T--TYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELHHVHARVATSMAPENKYFQTA  180

Query  728   WRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G
Sbjct  181   WRAEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKG  240

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFC  378
               G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + S   +P  
Sbjct  241   AQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVVSEEVFPAD  296

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
             G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  297   GNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>gb|EQL35203.1| hypothetical protein BDFG_03181 [Blastomyces dermatitidis ATCC 
26199]
Length=345

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 103/348 (30%), Positives = 175/348 (50%), Gaps = 22/348 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4     IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63    GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssS  729
             +  T   +  +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++
Sbjct  123   T--TYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELRHVHARVATSMAPENKYFQTA  180

Query  728   WRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G
Sbjct  181   WRAEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKG  240

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFC  378
               G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + S   +P  
Sbjct  241   AQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVVSEEVFPAD  296

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
             G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  297   GNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>ref|XP_001554573.1| hypothetical protein BC1G_07162 [Botrytis cinerea B05.10]
 emb|CCD44433.1| similar to oxidoreductase family [Botrytis cinerea T4]
 gb|EMR88754.1| putative oxidoreductase nad-binding rossmann fold protein [Botrytis 
cinerea BcDW1]
Length=345

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 103/350 (29%), Positives = 177/350 (51%), Gaps = 24/350 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF +T+++P +     L  LKAI+SRS +SA+S       +  +      G  
Sbjct  5     VAIIGSGIFAQTEHLPAVQATPHL-SLKAIYSRSLKSAQSLNVDVPLYSDDSGV---GNT  60

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++  T +  V + +    Q E     L  GKHVL EKP A  + +A+  L +YN   
Sbjct  61    YYDLLLRTDVHAVIIALPILAQPEFIEAALAAGKHVLSEKPIAGDLEKAQRLLEYYNG--  118

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
               +     W+VAEN+RF  +F   +K I ++G ++  ++ + GS+     YF + WR+  
Sbjct  119   DKVKGGATWSVAENFRFLDSFIHARKEIEKLGRVLGFRIQVFGSVKPGMKYFETEWRKKP  178

Query  719   NFFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             ++ GGF+LD GVH+ A  R+L+G E   T+V A ++ + + LPP D I++++  ++G SG
Sbjct  179   DYQGGFLLDGGVHFTAAGRLLLGEEAKPTAVVAFSTLLREHLPPVDTINSIWLTKSGISG  238

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  366
              F++   +      + V   +G++ V R     + G        + +   F     GV++
Sbjct  239   TFSVSFGTTLSGPEYTVACEHGSVSVIRSKVIVRKGEESEKNFTEVE---FTEEGSGVKQ  295

Query  365   ELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  222
             E+  +   I           G+P  R S  E   D+ +LE +L SG+ +G
Sbjct  296   EVAAWAQSI---------VDGKPNSRQSPQEALADLEILEKLLRSGEEQG  336



>ref|XP_007295758.1| oxidoreductase family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD13668.1| oxidoreductase family protein [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=344

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 106/355 (30%), Positives = 178/355 (50%), Gaps = 29/355 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIFV  +++P + + S    LKAI+SRS +SA++       +    E    G  
Sbjct  5     VAIIGSGIFVTEEHLPAV-KASPNLTLKAIYSRSLKSAQALNTGVDLY---SEDSGDGKT  60

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++    I  V + +    Q E   + L  GKHVL EKP A  I  AE  +  Y    
Sbjct  61    YGDLLLREDITAVIIALPILAQPEFIEQALIAGKHVLSEKPIAGNIKRAEELIQFYKG--  118

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
               +     WAVAEN+RF  +F   ++ + ++G ++  +V   G +     YF ++WR+  
Sbjct  119   ERVKHGATWAVAENFRFLDSFKFGREQVEKLGKVLGFRVKQAGKVKMGGKYFETAWRKRP  178

Query  719   NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             +  GGF+LD GVH+VAG+R+L+G   + T++SA T  + + L P D + +++Q ++G +G
Sbjct  179   DHQGGFLLDGGVHFVAGIRLLLGNNAKPTALSAFTHLLQEHLAPVDTVDSIWQTKSGVTG  238

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF-----  381
              F+    +      + V   NG++ V    K       V + +G+   K+F   +     
Sbjct  239   TFSACFGTTLSGSEYTVACENGSVTVIVREK-------VIVRLGEESDKNFKEEWFKEEG  291

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  216
              GV++E+K +   +        + K  P  S  E   D+ +LE ML SG++ G L
Sbjct  292   SGVKQEVKAWAQSLV-------DRKPLPAQSPEEALIDLEILEKMLRSGEQNGQL  339



>ref|XP_002626131.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ76920.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
SLH14081]
Length=345

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 103/348 (30%), Positives = 175/348 (50%), Gaps = 22/348 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4     IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63    GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssS  729
             +  T   +  +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++
Sbjct  123   T--TYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELRHVHARVATSMAPENKYFQTA  180

Query  728   WRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G
Sbjct  181   WRAEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKG  240

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFC  378
               G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + S   +P  
Sbjct  241   AQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVLSEEVFPAD  296

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
             G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  297   GNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>ref|XP_008085160.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis 
ATCC 20868]
 gb|EPE27801.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis 
ATCC 20868]
Length=346

 Score = 95.1 bits (235),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 140/268 (52%), Gaps = 22/268 (8%)
 Frame = -2

Query  986  LKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  807
            L  GKHVL EKP A  I  A+  + +Y S    +     W VAEN+RF  +F   ++ + 
Sbjct  91   LAAGKHVLSEKPIAKDITSAQKLIDYYKS--DKVKGGATWGVAENFRFLDSFLFARQEVQ  148

Query  806  EIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCEV--T  639
            ++G ++  +V + G++   + YF ++WR+   + GGF+LD GVH++A  R+L+G E   T
Sbjct  149  KLGRVLGFRVKMFGNVQPGSKYFETAWRKKPEYQGGFLLDGGVHFIAATRLLLGEEATPT  208

Query  638  SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERG  459
            +++A T+ + + LPP D +++++Q + G SG F++   +      + +    G++ VE  
Sbjct  209  ALTAFTTLLQEHLPPVDTVNSVWQTKTGISGTFSVSFGTTLSGSEYVIACEKGSVAVEFS  268

Query  458  NKDGKHGYSVSLYMGDGQ---IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLS  288
                    +V L M   +   +K F     GV++E+  +   +S      G+    P  +
Sbjct  269  K------VTVRLGMEKDKKETVKEFKEEGAGVKQEVAAWAKSLSEGTPNPGQA---PEQA  319

Query  287  FVEGTRDIAVLEAMLESGKREGALVQVK  204
                  D+ +LE ML+SG+ +GA   +K
Sbjct  320  LA----DLEILEKMLKSGENQGAAQSLK  343



>gb|ERT02500.1| hypothetical protein HMPREF1624_00799 [Sporothrix schenckii ATCC 
58251]
 gb|KJR80219.1| hypothetical protein SPSK_05385 [Sporothrix schenckii 1099-18]
Length=343

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 101/359 (28%), Positives = 170/359 (47%), Gaps = 40/359 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             IAILG+GIF   +++P L  ++    +KAI+SRS+ +A   V  A+        K G AG
Sbjct  4     IAILGAGIFATEEHLPAL--VANKASVKAIYSRSQATAAPLVAEAQ--------KLGQAG  53

Query  1073  ------------LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciae  930
                         L++++    I  V VV+    Q ++  R    GKHVL EKP A  +  
Sbjct  54    VELYSDDTPGHTLDDLLARKDIAAVVVVLPIAVQPDIVRRCWAAGKHVLSEKPVAKDVQT  113

Query  929   aenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsm  759
             A   +  Y +  T   Q  ++++AE  RF+P F + ++ + +   +G +  + + I  + 
Sbjct  114   ARQLIRDYQA--TYAGQGLVFSIAEQIRFQPEFEKGRQWVVDEQALGTITQLHLRIWRNQ  171

Query  758   nssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDN  585
              +   Y+ + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D 
Sbjct  172   AAGGKYYETPWRKVPAYQGGFLLDGGVHQTAMLRYISGQEVVETHGYARQVAPHLPPLDT  231

Query  584   ISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ  405
             ++A   L  G +G  +M  +S        ++G  G+  +     DG  GY ++L +  G+
Sbjct  232   VNAGLVLSGGATGTLSMSFASTRRATELVIIGTQGSFHL----TDGPDGYVLTLELLSGE  287

Query  404   IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
              ++      GV+ E+K FL  I+         K + R    E   D+A++E++ + G +
Sbjct  288   RRTETIKSRGVELEVKAFLEAIA-------SGKAQSRAGPEEALNDLAIIESLCQGGGK  339



>gb|EGE83963.1| NAD-binding Rossmann fold oxidoreductase [Blastomyces dermatitidis 
ATCC 18188]
Length=345

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 103/348 (30%), Positives = 175/348 (50%), Gaps = 22/348 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVEC---KWG  1083
             IA+LG+GIF +  ++P + + +   VL A++SRSE SA S VE   N    ++    +  
Sbjct  4     IALLGAGIFAREAHVPAILKNAAAKVL-AVYSRSENSANSVVEALNNTTTPIDVYSDEKP  62

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
             G GL+E+++   I  V V++       +  + L  GKHVL EKP A  IA     +  Y 
Sbjct  63    GHGLDELLQRPDIEAVIVLLPILVLPAVVRKCLAAGKHVLAEKPIAKDIATGRALITEYE  122

Query  902   SLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyfssS  729
             +  T   +  +++VAE +R++  F +  +++A   IG++ +V   +  SM   N YF ++
Sbjct  123   T--TYAPRNLVFSVAEQFRYDTGFLKASEVVASGTIGELHHVHARVATSMAPENKYFQTA  180

Query  728   WR--RNFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
             WR    + GGF+LD GVH+VA +RM+ G E+    + T+     L P D ++A  +   G
Sbjct  181   WRVEPGYQGGFVLDAGVHFVALVRMVAGQEIVETKSFTAQFAPHLRPLDTVNAALRFSKG  240

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS-FFYPFC  378
               G  ++  ++ +    +  +G  G L V+    D     +V +  GD  + S   +P  
Sbjct  241   AQGTLSISFAAATYIADFVFIGTAGVLTVKCAGVD----TTVRVEGGDRNVVSEEVFPAD  296

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
             G   E++ F+  I+      G+  G PR    E   D+AV+E++   G
Sbjct  297   GNVNEIRAFVQAIAAGK---GDRAGSPR----EALADVAVIESVCAGG  337



>gb|KFY88446.1| hypothetical protein V500_06334 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=350

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 167/353 (47%), Gaps = 20/353 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + L  LKAI+SRS  +A +    A+           G  
Sbjct  5     VAIIGSGIFATEQHLPAV-EATPLLKLKAIFSRSLLAATTLATAAKGDVDTYADDNDGKD  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q       L  GKHVL EKP A  I  AE  L+H+ +  
Sbjct  64    YAALLARSDITAVIIALPINVQPVYIEAALAAGKHVLSEKPIANDIEAAEK-LIHFYTAL  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                  K  W VAEN+RF       ++ I ++G ++  ++ +   + +   YF + WR+  
Sbjct  123   KEKGSKATWGVAENFRFLEPLKFARQQIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKVP  182

Query  719   NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             ++ GGF+LD GVH+ AG R+L+G     +S+SA T+ +   LPP D +++++Q  NG SG
Sbjct  183   SYQGGFLLDGGVHFTAGTRLLLGPHNRPSSLSAYTALLQPHLPPIDTVNSIWQTTNGISG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS--FFYPFCGV  372
                +   +      + +    G++ V R     + G        DG + S        GV
Sbjct  243   TVQISFGTSLSGDEYTIACYEGSVTVSRDTVTVRSGEE-----KDGNLTSRVILGSGSGV  297

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  213
             + E+K +   I        +       S  E   D+ +LEAM++SG+ EG  V
Sbjct  298   KAEVKAWAEGIEAGVENAAQ-------SPAEALADLELLEAMIKSGEGEGVKV  343



>ref|XP_001593666.1| hypothetical protein SS1G_05094 [Sclerotinia sclerotiorum 1980]
 gb|EDO02617.1| hypothetical protein SS1G_05094 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=345

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 175/349 (50%), Gaps = 22/349 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG-GA  1077
             +AI+GSGIF +T+++P + + + L  LKAI+SRS  SA+S         P      G G 
Sbjct  5     VAIIGSGIFAQTEHLPAV-QATPLLSLKAIYSRSLSSAQSLNV----DVPLYSDDSGVGK  59

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
                +++  + I  V + +    Q E     L  GKHVL EKP A  +  A+  L +Y S 
Sbjct  60    TYHDLLLRSDIHAVIIALPILVQPEYIEAALAAGKHVLSEKPIAGDLERAQRLLEYYKS-  118

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR-  720
                +     W+VAEN+RF  +F   +K I ++G ++  ++   G++   + Y+ + WR+ 
Sbjct  119   -DKVKDGTTWSVAENFRFLDSFIHARKEIEKLGRVLGFRMQSFGNVKQGSKYYETEWRKK  177

Query  719   -NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
              ++ GGF+LD GVH+ A  R+L+G     TSV A ++ + + LPP D I++++   +G S
Sbjct  178   PDYQGGFLLDGGVHFTAAGRLLLGGAARPTSVVAFSTLLREHLPPVDTINSVWLTNSGVS  237

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             G F++   +      + V   +G++ V R     + G        + +   F     GV+
Sbjct  238   GTFSVSFGTTLSGPEYTVACEDGSVTVIRSKVIVRKGEENEKNFTEVE---FTEEGSGVK  294

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             +E+  +   I        + K + R S  E   D+ +LE +L SG+ +G
Sbjct  295   QEVAAWAQSIV-------DKKPDTRQSPEEALADLEILEKLLRSGEEQG  336



>gb|ELR09495.1| hypothetical protein GMDG_00677 [Pseudogymnoascus destructans 
20631-21]
Length=350

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 105/354 (30%), Positives = 172/354 (49%), Gaps = 28/354 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + L  LKAI+SRS  +A +    A+           G  
Sbjct  5     VAIIGSGIFATEQHLPAV-ESTPLLKLKAIFSRSLVAATALATAAKGDVDTYADDNNGKD  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q       L  GKHVL EKP A  I  AE  L+H+ +  
Sbjct  64    YAALLARSDITAVIIALPINVQPMYIEAALAAGKHVLSEKPIANDIEAAEK-LIHFYTAL  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                  K  W VAEN+RF   F   ++ I ++G ++  ++ +   + +   YF + WR+  
Sbjct  123   KEKGSKASWGVAENFRFLAPFKFARREIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKIP  182

Query  719   NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             ++ GGF+LD GVH+ AG R+L+G      S+SA T+ +   LPP D +++++Q   G SG
Sbjct  183   SYQGGFLLDGGVHFTAGTRLLLGPLNRPVSLSAYTALIQPHLPPIDTVNSIWQTTKGVSG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMG---DGQIKS--FFYPF  381
                +   +      + +   +G++ V R         +VS++ G   DG + +       
Sbjct  243   TVQISFGTSLSGDEYTIACYDGSVSVSRD--------TVSVHNGEEKDGNVTTRVLLSSG  294

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRL-SFVEGTRDIAVLEAMLESGKREG  222
              GV+ E+  +         +G E   E  L S  E   D+ +LEAM++SG+ EG
Sbjct  295   SGVKAEVHAW--------AEGIETGKENSLQSPAEALADLELLEAMIKSGEGEG  340



>gb|KFZ09203.1| hypothetical protein V502_08867 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=350

 Score = 94.4 bits (233),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 167/353 (47%), Gaps = 20/353 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + L  LKAI+SRS  +A +    A+           G  
Sbjct  5     VAIIGSGIFATEQHLPAV-EATPLLNLKAIFSRSLLAATTLATAAKGDVDTYADDNDGKD  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q       L  GKHVL EKP A  I  AE  L+H+ +  
Sbjct  64    YAALLARSDITAVIIALPINVQPVYIEAALAAGKHVLSEKPIANDIEAAEK-LIHFYTAL  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                  K  W VAEN+RF       ++ I ++G ++  ++ +   + +   YF + WR+  
Sbjct  123   KEKGSKATWGVAENFRFLEPLKFARQQIEKLGGVVGFRIKVFQHVKAGTKYFETEWRKVP  182

Query  719   NFFGGFILDMGVHYVAGLRMLVG--CEVTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             ++ GGF+LD GVH+ AG R+L+G     +S+SA T+ +   LPP D +++++Q  NG SG
Sbjct  183   SYQGGFLLDGGVHFTAGTRLLLGPHNRPSSLSAYTALLQPHLPPIDTVNSIWQTTNGISG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS--FFYPFCGV  372
                +   +      + +    G++ V R     + G        DG + S        GV
Sbjct  243   TVQISFGTSLSGDEYTIACYEGSVTVSRDTVTVRSGEE-----KDGNLTSRVILGSGSGV  297

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALV  213
             + E+K +   I        +       S  E   D+ +LEAM++SG+ EG  V
Sbjct  298   KAEVKAWAEGIEAGVENAAQ-------SPAEALADLELLEAMIKSGEGEGVKV  343



>gb|KIL95797.1| glucose-fructose oxidoreductase [Fusarium avenaceum]
Length=345

 Score = 94.0 bits (232),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 104/358 (29%), Positives = 180/358 (50%), Gaps = 28/358 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave--laRNHFPNVECKWGG  1080
             IA++G G+F K  ++P + +   L  LKAI+SRS +SA+         +  P++     G
Sbjct  6     IALIGGGLFAKQAHMPAIMKAENL-ALKAIYSRSLKSAQETAALNTRSDQGPDLYSADSG  64

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             +G   ++++    I  V + +   +Q E     L  GKHVL EKP A  +AE +  + ++
Sbjct  65    SGKSFDDLLARDDIEAVIIALPIPSQPEHIRAALAAGKHVLAEKPLAPTVAEGKKLIEYH  124

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
              SL    T    +++AEN+RF+P+F        ++G + +    +   M++ + ++S++W
Sbjct  125   RSLGGKAT----FSIAENFRFKPSFEYAASEANKLGKLQHFGARVFFYMSADSQWYSTAW  180

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             R    F GGF+LD GVH+ A  R L+      VSA T+ V   L P D ++A+ +L++G 
Sbjct  181   RAKPEFQGGFLLDGGVHFTAATRQLLTEPAADVSAFTAQVQAHLAPIDTVNAVIRLKSGV  240

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SG +     ++     ++     G++EV+ G+K      +V+ + G+  +K F     GV
Sbjct  241   SGTYQQSCGAKMSTSTFQFGYEKGSIEVD-GDK-----VTVTPWEGEKSVKEFERT-SGV  293

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EE+  +    +L + K  E     + S  E   D+  LE M ESG   G   + KK+
Sbjct  294   TEEVAAWAK--ALVDGKPNE-----KQSPEEALADLEFLELMFESGANGG---EAKKY  341



>ref|XP_011318574.1| hypothetical protein FGSG_02628 [Fusarium graminearum PH-1]
 gb|ESU08089.1| hypothetical protein FGSG_02628 [Fusarium graminearum PH-1]
 gb|EYB30901.1| hypothetical protein FG05_02628 [Fusarium graminearum]
 emb|CEF74956.1| unnamed protein product [Fusarium graminearum]
Length=358

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 133/258 (52%), Gaps = 20/258 (8%)
 Frame = -2

Query  986  LKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  807
            L  GKHVL EKP A  +A+A   + +Y SL    T    +++AEN+R++P F       A
Sbjct  111  LAAGKHVLAEKPIAPSVADANKLIEYYRSLQGKGT----FSIAENFRYKPCFEYAANEAA  166

Query  806  EIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSV  633
            ++G + +  V +   M+  + ++ +SWR    F GGF+LD GVH+VA +R L       V
Sbjct  167  KLGALQHFSVRVLFFMSEDSQWYGTSWRAKPQFQGGFLLDGGVHFVAAMRQLFDEPAADV  226

Query  632  SAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNK  453
            SA TS V   L P D ++A+ +L++G SG +     ++     ++     G++ V+ G+K
Sbjct  227  SAFTSQVQPHLAPVDTVNAVIRLKSGVSGTYQQSCGTKMSTSAFQFGYEKGSVVVD-GDK  285

Query  452  DGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGT  273
                  +V+ + G+  +K F     GV EE++ + + +        + K + R S  E  
Sbjct  286  -----VTVTPWEGEQVVKDFERT-SGVDEEIEAWANALV-------DGKPDKRQSVEEAL  332

Query  272  RDIAVLEAMLESGKREGA  219
             D+ +LE M ESG   GA
Sbjct  333  ADLELLEMMFESGSDGGA  350



>gb|KGO75187.1| Oxidoreductase, N-terminal [Penicillium italicum]
Length=507

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 107/350 (31%), Positives = 172/350 (49%), Gaps = 29/350 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG+F K Q++P +   S  F LKAI+SRS +SA+             E       
Sbjct  5     VAIIGSGLFAKEQHLPAVQAASN-FQLKAIYSRSLKSAQDLASGTSEVDLYSEDSGSDKS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64    YADLLARSDIGAVIIALPILVQPEFIKKSLLAGKHVLSEKPIAKDVATAQELLKWYKS--  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
             T  T K  WAVAEN+R+   F    + + ++G + N +V +   MN +N YF+++WR+  
Sbjct  122   TIDTSKVFWAVAENFRYITKFIFAAEQVQKLGKVKNFRVNVHSLMNENNKYFNTAWRKTP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALFQLENGCSG  546
              + GGF+LD GVH  A LR+++G  E  S+ +  S + +  LPP D + A+ + E+G +G
Sbjct  182   EYQGGFLLDGGVHMTAALRLILGPTERLSILSAQSQLQQPFLPPVDTVDAVAKTESGATG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  366
             V ++   S     ++ V    G + ++  +              +G+     +   GV  
Sbjct  242   VISLSWGSSFKDQIFEVACEKGLVTLDSDD-----------VTVNGEKHHVEFDGRGVVP  290

Query  365   ELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  222
             E+  F + I           G+P  R S  E   D+ +LE ML SG+++G
Sbjct  291   EVAEFANSI---------LSGKPAIRQSAEEALADLEILEQMLRSGEKDG  331



>ref|XP_001822449.2| hypothetical protein AOR_1_404134 [Aspergillus oryzae RIB40]
Length=489

 Score = 95.5 bits (236),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 100/341 (29%), Positives = 167/341 (49%), Gaps = 35/341 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG F + +++P + + S  F LKAI+SRS  SA+             E    G  
Sbjct  5     VAIIGSGNFAREEHLPGV-QASDAFDLKAIYSRSLTSAQILATGVSGIDLYSEDAGPGKT  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++  + I  V + +    Q E   + L  GKHVL EKP A  ++ A++ +  +NS  
Sbjct  64    YDDLLSRSDITAVIIALPILAQPEFIRKALTAGKHVLSEKPIAKDLSAAQDLINLHNS--  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
               ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR  
Sbjct  122   RIVSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
              + GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +G
Sbjct  182   EYQGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSV----------------SLY  420
             V ++   S     ++     +G  TL+ +R   +G+ GY V                S+ 
Sbjct  242   VLSVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDVPFEGRGVNKELVEFAESIT  300

Query  419   MGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEP  297
              GDG I +   P     EE    L+D+ L+     +C G P
Sbjct  301   TGDG-IATRLRP-----EEA---LADLELSEALAPDCTGRP  332



>ref|XP_002839683.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83874.1| unnamed protein product [Tuber melanosporum]
Length=348

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 179/352 (51%), Gaps = 18/352 (5%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             IAILG GIFV+ +++P +   S + VLKA++SRSE SA+  ++       ++       G
Sbjct  6     IAILGCGIFVQEEHLPAVEACSDV-VLKAVYSRSEASAKKLLQAKSGV--DIYSDDSENG  62

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
             L  ++  + I  V + +    Q E+  + L  GKHVL EKP A  +A+A   L+ Y    
Sbjct  63    LGVLLARSDIQAVIIALPITIQPEVIKKALGAGKHVLSEKPVAKDLAQARE-LISYKQSY  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
              ++     W+VAEN+RF+ A+    + I  +G ++N +  +   +     Y+ +SWR+  
Sbjct  122   PDLN----WSVAENFRFQEAWRHAHREITALGRVINFRSRVCWLVTPGWKYYETSWRKTP  177

Query  719   NFFGGFILDMGVHYVAGLRMLVGCE-VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGV  543
             ++ GGF+LD GVHY A +R+L+  E +  VSA T+   + LPP D ISA+F+ + G  G 
Sbjct  178   DYQGGFLLDAGVHYAASMRILLSDEKIVKVSAFTASNFEHLPPVDTISAIFKTDKGVVGS  237

Query  542   FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEE  363
             F + V +      + V   NG++ V   ++             D  +K F     GV  E
Sbjct  238   FEVSVGTTFEGWEFAVACENGSVTVRPVSEVVILRRKPGGGFEDEIVKKFPDDKKGVGPE  297

Query  362   LKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  207
             +  F   +        + +  P L+      D+ ++E ML SG+ +GA++++
Sbjct  298   VAAFAKAVIAG---APDERQTPELA----VGDLEMIEKMLRSGENDGAVMEI  342



>ref|XP_009153161.1| glucose-fructose oxidoreductase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY52700.1| glucose-fructose oxidoreductase [Exophiala dermatitidis NIH/UT8656]
Length=341

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 171/358 (48%), Gaps = 34/358 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AILG GIF + ++ P + E +    LKA++SRS  SAR+            +    G  
Sbjct  6     VAILGGGIFAREEHKPAV-EAAPDLTLKAVYSRSLNSARTLEVDESKVDVYSDESGAGKS  64

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
             L++++  T I  V + +  + Q E   + L  GKHVL EKP A  + +A   +  Y S  
Sbjct  65    LDDLLARTDIQAVIIALPIRNQPEYVRKALMAGKHVLSEKPVAENVQDAVQLIKWYRS--  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSW  726
                 +K  W+VAEN+R+  +F    + +   G  +     +Q ++EG            W
Sbjct  123   EIAPRKVTWSVAENFRYLNSFLHAAEAVKTKGRQLTFRCRMQTLVEGGKYFETS-----W  177

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             R+     GGF+LD GVH+ AGLR+++G +  + +VSA ++ + + LPP D + A  + +N
Sbjct  178   RKTPTHQGGFLLDGGVHFTAGLRLMLGKDNPLATVSAFSAQLQEHLPPVDTVEATGRTKN  237

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             G  G  ++   + +    W V   NG + + R          V++   DG+ +       
Sbjct  238   GAVGTISISFGTTAKGSEWTVGCENGAVSISRDQ--------VTV---DGKTERIEDEKS  286

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
             GV  E++ +   ++   T         + S  E   D+ ++EAML SG++ G  ++++
Sbjct  287   GVPPEVRNWGKALAAGTTN-------EQQSPEEALADLELIEAMLRSGEQGGVPIKLE  337



>ref|XP_680622.1| hypothetical protein AN7353.2 [Aspergillus nidulans FGSC A4]
 gb|EAA61724.1| hypothetical protein AN7353.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF78561.1| TPA: oxidoreductase family, NAD-binding Rossmann fold protein 
(AFU_orthologue; AFUA_2G16380) [Aspergillus nidulans FGSC A4]
Length=344

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 167/355 (47%), Gaps = 34/355 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF + Q++P + E + +F LKAI+SRS +SA+   E         +    G  
Sbjct  5     VAIIGSGIFAREQHLPAIKE-APMFSLKAIYSRSLKSAQGLAEGLEGVDLYSDDSGAGKS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++    I  V + +    Q       L   KHVL EKP A  +A A++ +  YN  +
Sbjct  64    YQDLLARQDIGAVILALPIVAQPAYIKEALAAKKHVLSEKPIAKDLATAQDLMAWYNDNA  123

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnp--yfssSWRR  720
                  K  W VAEN+RF   + +  + + ++G +   +V++   + +        + WR+
Sbjct  124   NVDKSKTFWGVAENFRFIRKWLKTAEEVQKLGGVKTFRVVVRNKVGTEGKYFSIDTPWRK  183

Query  719   --NFFGGFILDMGVHYVAGLRMLVG---CEVTSVSAMTSHVDKTLPPPDNISALFQLENG  555
                + GGF+LD G+H VAG+R+++G     + S++A TS + + LPP D + AL    +G
Sbjct  184   IPEYQGGFLLDGGIHTVAGVRLILGRGKNSLKSLTAQTSQLQEHLPPIDTVDALLTTASG  243

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--  381
              +GVF++   S     V       G + +   ++   +G +  +            PF  
Sbjct  244   AAGVFSLSFGSEFKSFVLEFTCEKGVVSL-VDDQLTVNGVATEI------------PFEG  290

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFV--EGTRDIAVLEAMLESGKREG  222
              GV+EE+K F   I           GE     V  E   D+ VLE M  SG+  G
Sbjct  291   VGVKEEVKAFGESI---------VNGELNKKLVPDEALADLEVLEMMFRSGEDGG  336



>gb|KJJ26537.1| Ribosomal protein L32e [Penicillium solitum]
Length=1203

 Score = 95.9 bits (237),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 171/354 (48%), Gaps = 37/354 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG+F K Q++P +   S  F LKAI+SRS +SA+             E       
Sbjct  708   VAIIGSGLFAKEQHLPAVQAASN-FQLKAIYSRSLKSAQDLASGTSEVDLYSEDSGSDKS  766

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  767   YADLLARSDIGAVIIALPILVQPEFIQKALLAGKHVLSEKPIAKDVATAQELLKWYKS--  824

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
             T  T K  WAVAEN+R+   F    + + ++G + N +V +   M+ +N YF ++WR+  
Sbjct  825   TIDTSKVFWAVAENFRYITKFLFAAEQVQKLGKVQNFRVNVHSLMDQNNKYFHTAWRKTP  884

Query  716   -FFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALFQLENGCSG  546
              + GGF+LD GVH  A LR+++G  E  S+ +  S + K+ LPP D + A+ + E+G +G
Sbjct  885   EYQGGFLLDGGVHMTAALRLILGPAERLSILSAQSQLQKSFLPPVDTVDAVAKTESGATG  944

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGD----GQIKSFFYPFC  378
             V ++   S     ++ V    G                V+L   D    G+     +   
Sbjct  945   VISLSWGSSFNDQIFEVACEKGV---------------VTLNFDDVTVNGEKHHVEFDGK  989

Query  377   GVQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  222
             GV  E+  F + I           G+P  R S  E   D+ +LE ML SG+R+G
Sbjct  990   GVVPEVAEFANSI---------VSGKPDIRQSPEEALADLEILEQMLRSGERDG  1034



>ref|XP_002146783.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
marneffei ATCC 18224]
 gb|EEA26236.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
marneffei ATCC 18224]
Length=346

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 174/350 (50%), Gaps = 27/350 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +A++G GI+ K +++      S+   LKAI+SRS +SA+   E   N    +  +    G
Sbjct  5     VALIGGGIWAKEEHLV----TSKDLELKAIYSRSFKSAKDVAEDV-NEKVELYSEDTSQG  59

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              E+I+K   +  V + +    QV      L  GKHVL EKP A  +A+A N +  Y+  +
Sbjct  60    YEDILKREDVQAVIISLPIANQVPFIRSALSAGKHVLSEKPVAENVADAVNLIKWYHE-N  118

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
                 +   W VAEN+R+  +F   ++ I ++G+++  +V I  ++     +F +SWR+N 
Sbjct  119   KAANKNVTWGVAENFRYLKSFQYARQEIEKLGEIIGFRVRIYANIKQDWKFFQTSWRKNP  178

Query  716   -FFGGFILDMGVHYVAGLRMLVGCEV--TSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
                GGF+LD GVHY A LR L+G +V  T ++A T+ + + LPP D + A+ +   G  G
Sbjct  179   THQGGFLLDGGVHYTAALRGLLGPDVHFTRLAAFTTLLKEHLPPVDTMDAILKTNTGIQG  238

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQ--IKSFFYPFCGV  372
              F   V++      W +    GT+ V         G  V++   DG+  +++      GV
Sbjct  239   TFQSSVATTLTGPEWTIACEKGTVTVV--------GSDVTVRPVDGEELVQTIADERTGV  290

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
               E++ +   ++         +  P  +  E   D+ ++E ML SG+ EG
Sbjct  291   PPEIRAWGEALAAG-------RQNPEQTPEEALADLELIELMLRSGESEG  333



>gb|KFY35329.1| hypothetical protein V494_06008 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=350

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 96/305 (31%), Positives = 150/305 (49%), Gaps = 9/305 (3%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + L  LKAI+SR   +A +    A+    +      G  
Sbjct  5     VAIIGSGIFATEQHLPAV-EATPLLQLKAIFSRRLVAATTLATAAKGDVDSYADDNDGKD  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++    I  V + +    Q       L  GKHVL EKP A  IA AE  L+H+ +  
Sbjct  64    YAALLARPDISAVIIALPINVQPTYIEAALAAGKHVLSEKPIANDIAAAEK-LIHFYTAL  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                  K  W VAEN+RF  AF    + I ++G ++  +V +   + +   YF + WR+  
Sbjct  123   KEKGSKATWGVAENFRFLEAFQYASREIEKLGGVLGFRVKVFQHVKAGTKYFETDWRKTP  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             +  GGFILD GVH+ AG R+L+G +   TS++A T+ +   LPP D +++++Q   G SG
Sbjct  183   SHQGGFILDGGVHFTAGTRLLLGPQNRPTSLAAYTALLQPHLPPIDTVNSIWQTAKGISG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  366
                +   +      + V   NG++ V R   D  H  +     G+   K F     GV+ 
Sbjct  243   TVQISFGTSLSGDDYTVACYNGSVTVSR---DTVHVRTGEEKDGNVSTKVFVGGGSGVKA  299

Query  365   ELKTF  351
             E+K +
Sbjct  300   EVKAW  304



>gb|KFY14890.1| hypothetical protein V492_02347 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=350

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 151/305 (50%), Gaps = 9/305 (3%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF   Q++P + E + L  LKAI+SR   +A +    A+    +      G  
Sbjct  5     VAIIGSGIFATEQHLPAV-EATPLLQLKAIFSRRLVAATTLATAAKGDVDSYADDNDGKD  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q       L  GKHVL EKP A  IA AE  L+H+ +  
Sbjct  64    YAALLARSDISAVIIALPINVQPTYVEAALAAGKHVLSEKPIANDIAAAEK-LIHFYTAL  122

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR--  720
                  K  W VAEN+RF  A+    + I ++G ++  +V +   + +   YF + WR+  
Sbjct  123   KEKGSKATWGVAENFRFLEAYQYASREIEKLGGVLGFRVKVFQHVKAGTKYFETEWRKTP  182

Query  719   NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
             +  GGFILD GVH+ AG R+L+G +   TS+SA T+ +   LPP D +++++Q   G SG
Sbjct  183   SHQGGFILDGGVHFTAGTRLLLGPQNRPTSLSAYTALLQPHLPPIDTVNSIWQTAKGISG  242

Query  545   VFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQE  366
                +   +      + +   NG++ V R   D  H  +     G+   K F     GV+ 
Sbjct  243   TVQISFGTSLSGDEYTIACYNGSVTVSR---DTVHVRTGEEKDGNVSTKVFVGGGSGVKA  299

Query  365   ELKTF  351
             E+K +
Sbjct  300   EVKAW  304



>gb|KGO40526.1| Oxidoreductase, N-terminal [Penicillium expansum]
 gb|KGO63123.1| Oxidoreductase, N-terminal [Penicillium expansum]
 gb|KGO66915.1| Oxidoreductase, N-terminal [Penicillium expansum]
Length=500

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 174/353 (49%), Gaps = 35/353 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG+F K Q++P +   S  F LKAI+SRS +SA+             E       
Sbjct  5     VAIIGSGLFAKEQHLPAVQAASN-FQLKAIYSRSLKSAQDLASGTSEVDLYSEDSGSDKS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
                ++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64    YANLLARSDIGAVIIALPILVQPEFIKKALLAGKHVLSEKPIAKDVATAQELLKWYKS--  121

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
             T  T K  WAVAEN+R+   +    + + ++G + N +V +   M+ +N YF ++WR+  
Sbjct  122   TIDTTKVFWAVAENFRYITKYLFAAEQVQKLGKVQNFRVNVHSLMDENNKYFHTAWRKTP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALFQLENGCSG  546
              + GGF+LD GVH  A LR+++G  E  S+ +  S + ++ LPP D + A+ + E+G +G
Sbjct  182   EYQGGFLLDGGVHMTAALRLILGPTERLSILSAQSQLQQSFLPPVDTVDAVAKTESGATG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQIKSFFYPFCG  375
             V ++   S     ++ V    G  TL ++    +G KH         DG+         G
Sbjct  242   VISLSWGSSFDDHIFEVACEKGVVTLNLDDVTVNGEKHHVEF-----DGR---------G  287

Query  374   VQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKREG  222
             V  E+  F + I           G+P  R S  E   D+ +LE ML SG+++G
Sbjct  288   VGPEVAEFANSI---------VSGKPDIRQSAEEALADLEILEQMLRSGEKDG  331



>gb|EHK24126.1| hypothetical protein TRIVIDRAFT_45259 [Trichoderma virens Gv29-8]
Length=350

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 99/354 (28%), Positives = 169/354 (48%), Gaps = 26/354 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPN----VECKW  1086
             +AI+G G+FVK  ++P + E  +LF LKAI+SRS +SA+    L  +  P      E   
Sbjct  7     VAIIGGGLFVKGSHLPAVLEC-ELFSLKAIYSRSLKSAQETANLIPDSVPQPDLYSEDSG  65

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G   ++I++   I  V + +   +Q       L  GKHVL EKP A  ++ A   + + 
Sbjct  66    AGKSYQDILQRDDISAVIIALPILSQPSFIEAALSAGKHVLAEKPIAKDVSAARALIANA  125

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
               + ++   K   A+AEN RF P+F       A++G + N  V +   +   N +++++W
Sbjct  126   QRICSST--KATLAIAENIRFFPSFAYAASEAAKLGKVHNFSVRVLWRIEPDNKWYNTTW  183

Query  725   RR--NFFGGFILDMGVHYVAGLRMLVGCEVT---SVSAMTSHVDKTLPPPDNISALFQLE  561
             R+  ++ GGF+LD GVH+ A  R+L+  +     +V A T+ + + LPP D ++A+ + +
Sbjct  184   RQKPDYQGGFLLDAGVHWAAATRLLLTGDENKPETVQAFTAQMCEHLPPIDTVNAIIKTQ  243

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
             +G +GVF     S      W      GT+++           +V    G+  +K F    
Sbjct  244   SGATGVFQNSAGSLLQAFEWSFSYEKGTIKI------AGETVTVQPAGGEEHVKEFTRT-  296

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  219
              GV EE+  +   I        + K  P  +  +   D+  +E M  SG   G+
Sbjct  297   NGVSEEVAAWAQSIV-------DGKVNPLQTPEQALADLEFVEKMFTSGDENGS  343



>ref|XP_008045096.1| oxidoreductase family protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW51984.1| oxidoreductase family protein [Trametes versicolor FP-101664 
SS1]
Length=368

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 108/374 (29%), Positives = 179/374 (48%), Gaps = 35/374 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-----HFPNV-EC  1092
             IAILGSGIF    ++P +A +     LKA++SRS +SA +    A++     H  +V   
Sbjct  6     IAILGSGIFATEAHLPAIATLGDAIELKAVYSRSNKSASTFARSAQDILKLSHALDVYHD  65

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             +   A L+ ++  + I  V VV+    Q ++ L+ L  GKHVL EKP A  +++    + 
Sbjct  66    EDPAASLDVLLARSDIAAVIVVLPITVQPKVILKALAAGKHVLSEKPVAPDVSQGRALIQ  125

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnpyf  738
              Y S     ++  +W VAEN+  EP +   ++ I +  IG +      +   ++ ++ ++
Sbjct  126   EYES--KYKSRGLVWRVAENFEAEPGYRAARRAIEDGKIGKVAFYNACVVNYIDENSKWY  183

Query  737   ssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQL  564
             ++ WR   ++ GGF+LD GVH +A LR+++   + +VSA  S     LPP D I+A+ + 
Sbjct  184   NTPWRTVPDYQGGFLLDGGVHTIASLRVVLPSALQTVSAFASLAKDILPPQDTINAIVRN  243

Query  563   ENGCSGVFAM------VVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI  402
              +G  G+  +      V  ++       V G  G LE+ R N  G    +V     D   
Sbjct  244   VDGSHGLVELTWGAPTVTRAKQAGNNITVTGTEGWLEITRAN--GVMRIAVHTITRDKDG  301

Query  401   KS-------FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAML  243
             KS             G+Q E+++FL     A     +   +PR + V    D+A +EA L
Sbjct  302   KSTGETEEVIEEKEVGIQREIESFLR----ATDGSDDGVDDPRSTLV----DVAFIEAAL  353

Query  242   ESGKREGALVQVKK  201
              S      LV + K
Sbjct  354   NSNGAPVDLVALAK  367



>dbj|BAE63558.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=359

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 104/374 (28%), Positives = 181/374 (48%), Gaps = 54/374 (14%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF------PNVEC  1092
             +A+LG+GIF K +++P +     L  LKA++SRS+ SA S    A          P+V+ 
Sbjct  5     VALLGAGIFAKKEHLPAIESCPSL-SLKAVYSRSQTSAESFAAAAGEDIEAYFESPSVQS  63

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             K     L+++++   I+ V + VA     ++  + L  GKHVL EKP A  +  A+  + 
Sbjct  64    K----SLDDLLQRQDIVAVIIAVAITAAPDLIQKALAAGKHVLSEKPIAPDVETAQRLMD  119

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfs  735
             +Y+  + +     +W V EN+RF     +  +++ E+G  ++   V      +S NP++ 
Sbjct  120   YYHGQTKSGV---LWGVGENFRFWDPVQKAARILTEMGGSLVTFSVTAYSFTDSKNPFYH  176

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALF  570
             + WR+   F GG++LD GVH+ A LR L+   G  V  VSA T+ + + LPP D + A+ 
Sbjct  177   TDWRQKPTFQGGYLLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQEDLPPLDTVHAIL  236

Query  569   QLENGCSGVFAMVVSSRSPK------------IVWRVVGLNGTLEVERGNKDGKHGYSVS  426
             +   G SG +   V  ++ +            + +R   +   ++ ++G           
Sbjct  237   RTNKGGSGTYTSSVGIQAKRGMEFEIVTDKGYVTYRPFQMEILVKQDQG-----------  285

Query  425   LYMGDGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEA  249
                G+ + +S   P   GV+EE+  F + IS         + + RLS  E   D+ ++EA
Sbjct  286   ---GNWEERSEPAPLMWGVKEEIAAFATSISTG-------RLDSRLSTTEALEDLKIVEA  335

Query  248   MLESGKREGALVQV  207
             ML SG  +   V +
Sbjct  336   MLRSGDAQALPVDI  349



>gb|KJJ31534.1| Oxidoreductase family NAD-binding Rossmann fold [Aspergillus 
flavus AF70]
Length=359

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 104/374 (28%), Positives = 181/374 (48%), Gaps = 54/374 (14%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF------PNVEC  1092
             +A+LG+GIF K +++P +     L  LKA++SRS+ SA S    A          P+V+ 
Sbjct  5     VALLGAGIFAKKEHLPAIESCPSL-SLKAVYSRSQTSAESFAAAAGEDIEAYFESPSVQS  63

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             K     L+++++   I+ V + VA     ++  + L  GKHVL EKP A  +  A+  + 
Sbjct  64    K----SLDDLLQRQDIVAVIIAVAITAAPDLIQKALAAGKHVLSEKPIAPDVETAQRLMD  119

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfs  735
             +Y+  + +     +W V EN+RF     +  +++ E+G  ++   V      +S NP++ 
Sbjct  120   YYHGQTKSGV---LWGVGENFRFWDPVQKAARILTEMGGSLVTFSVTAYSFTDSKNPFYH  176

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALF  570
             + WR+   F GG++LD GVH+ A LR L+   G  V  VSA T+ + + LPP D + A+ 
Sbjct  177   TDWRQKPTFQGGYLLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQEDLPPLDTVHAIL  236

Query  569   QLENGCSGVFAMVVSSRSPK------------IVWRVVGLNGTLEVERGNKDGKHGYSVS  426
             +   G SG +   V  ++ +            + +R   +   ++ ++G           
Sbjct  237   RTNKGRSGTYTSSVGIQAKRGMEFEIVTDKGYVTYRPFQMEILVKQDQG-----------  285

Query  425   LYMGDGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEA  249
                G+ + +S   P   GV+EE+  F + IS         + + RLS  E   D+ ++EA
Sbjct  286   ---GNWEERSEPAPLMWGVKEEIAAFATSISTG-------RLDSRLSTTEALEDLKIVEA  335

Query  248   MLESGKREGALVQV  207
             ML SG  +   V +
Sbjct  336   MLRSGDAQALPVDI  349



>gb|EHK50187.1| hypothetical protein TRIATDRAFT_233440, partial [Trichoderma 
atroviride IMI 206040]
Length=343

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 169/351 (48%), Gaps = 24/351 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-HFPNVECKWG--  1083
             IAILG+GIF    ++P L  ++    LKA++SRS  +A + V  A      N++      
Sbjct  4     IAILGAGIFATEAHLPAL--VANKANLKAVYSRSTSTASTLVTEATKLGVANIDLYADDK  61

Query  1082  -GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G  L+++++ + I  V +V+    Q  +  + L  GKHVL EKP A  +  A + +  Y
Sbjct  62    PGHTLDDLLQRSDIDAVIIVLPILIQPSIVRQCLAAGKHVLCEKPIAKDVKTARDLIADY  121

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfs  735
             N L  +  +  I+++AE +RF   F   +K I E   IG++    + +  +      ++ 
Sbjct  122   NKLYAD--KGLIFSIAEQFRFMHEFELGRKWIVEEKAIGEITQAHLRVWRNQPPVGKWYE  179

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+   + GGF+LD GVH  A LR + G EV         V   LPP D ++A   L 
Sbjct  180   TPWRKVPEYQGGFLLDGGVHQTALLRFITGQEVVETQGFARQVVPHLPPLDTLNAGILLS  239

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G +G  +M  +S        ++G  G+ ++     DG  G+ ++L +  G+ +S     
Sbjct  240   GGGTGTISMSFASLRSAGELTLIGTKGSFQI----VDGPSGFVLTLDLVSGESRSETVNS  295

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
              GV+ E+K FL  I +        K E R    E   D+A +E+M + G +
Sbjct  296   KGVELEIKAFLEAIKIG-------KAEKRSGPEEALNDLASIESMCQGGGK  339



>gb|KIY44168.1| NAD(P)-binding protein, partial [Fistulina hepatica ATCC 64428]
Length=357

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 111/371 (30%), Positives = 180/371 (49%), Gaps = 37/371 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelaRNHF----PNVECK  1089
             IAILG+GIF K+ ++P +A + S +  +KA++SRS +SA    +          P+V   
Sbjct  2     IAILGAGIFAKSAHLPAIATLHSGVVEVKAVYSRSHKSAAEFADAVSVSLSCSPPDVYFD  61

Query  1088  WGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
                A L+ ++  T I  V VV+    Q  +  + L  GKHVL EKP A  +A+  + L  
Sbjct  62    DTDANLDALLARTDISAVIVVLPITRQPAVIRKALNAGKHVLSEKPMAPTVADGLSLLNE  121

Query  908   YNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGsmnssnp  744
             YN      T KP   IW VAEN+  EP++ E  + I +  IGD+   +      ++S N 
Sbjct  122   YNE-----TYKPKGLIWRVAENFEAEPSYREAARAITDGKIGDVKLFKATKVTYVDSDNN  176

Query  743   yfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  570
             Y+ + WR   ++ GGF+LD GVH +A LR ++   + S+SA  S   + L P D I+A+ 
Sbjct  177   YYQTPWRTIPDYQGGFLLDGGVHTIAALRTILPEPLDSLSAFASLNKEILAPHDTINAIV  236

Query  569   QLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQI  402
             +      G+    FA  V ++ P  ++ + G  G + V + +++ +         G    
Sbjct  237   R-AGAAHGIVELSFANPVRAQPPSTLFTITGTKGWITVSKNDRELRTVIRYHDAAGLEVE  295

Query  401   KSFFYPFCGVQEELKTFLSDISLANTKGGECK---GEPRLSFVEGTRDIAVLEAMLESGK  231
             +    P  GV  E+  F+  +     KG       G+P    +   RD+A +EA L S  
Sbjct  296   EDVDSPLSGVAIEIVAFVEAV-----KGDSAALQIGDP----LGALRDVAFIEAALRSN-  345

Query  230   REGALVQVKKF  198
               GA + +++ 
Sbjct  346   --GAQIDLRQL  354



>gb|EWZ38499.1| glucose-fructose oxidoreductase [Fusarium oxysporum Fo47]
 gb|EWZ83059.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA46087.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK40591.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXL79085.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL99025.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM22188.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=345

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 100/358 (28%), Positives = 177/358 (49%), Gaps = 28/358 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave--laRNHFPNVECKWGG  1080
             +A++G G+F K  ++P + +   L  LKAI+SRS +SA+            P++     G
Sbjct  6     VALIGGGLFAKQAHMPAIMKADNL-ALKAIYSRSLKSAKETAALNTRSGQEPDLYSADSG  64

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             +G   ++++    I  V + +   +Q E     L  GKHVL EKP A  +A+ +  + +Y
Sbjct  65    SGKSFDDLLAREDIEAVIIALPIPSQPEHIRAALAAGKHVLAEKPLAPTVADGQKLIEYY  124

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
               L    T    +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++W
Sbjct  125   RGLGGKAT----FSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAW  180

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             R    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G 
Sbjct  181   RAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGV  240

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV
Sbjct  241   SGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGV  293

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EE++ +   ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  294   TEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>ref|XP_006455042.1| hypothetical protein AGABI2DRAFT_194743 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV43777.1| hypothetical protein AGABI2DRAFT_194743 [Agaricus bisporus var. 
bisporus H97]
Length=376

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 176/370 (48%), Gaps = 43/370 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelaRN----------HF  1107
             +AILG+GIF K  ++P LA + +    LKA++SRSE+SA+   + A            +F
Sbjct  7     VAILGAGIFAKEAHLPALAALGASAPPLKAVYSRSEKSAKDLAQTAATILKLSSPPSVYF  66

Query  1106  PNVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaea  927
              N       + L+ ++  + I  V V++   TQ  + L+ L  GKHV+ EKP AA +   
Sbjct  67    DNDSS----SNLDVLLARSDISSVIVILPITTQPAIVLKALAAGKHVISEKPVAADVQSG  122

Query  926   enALMHYNSLSTNMTQKP-IWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmn  756
                +  YNS   N   K  IW VAEN+  EP +      I   +IG + + +      ++
Sbjct  123   LKLIADYNS---NFKSKNLIWRVAENFEAEPGYQAAAAAIRAGKIGQVHSFKAEKIDYID  179

Query  755   ssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNI  582
             +   ++ + WR   ++ GGF+LD GVH +A LR+++   +T VS   S     L P D I
Sbjct  180   TETKWYKTPWRTIPDYQGGFLLDGGVHTIAALRVMLPHPLTHVSGFASLNKAYLAPHDTI  239

Query  581   SALFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYM-  417
              A+ Q   G SGV    FA    SR     + ++G NG L V   +K G  G  + + + 
Sbjct  240   HAIVQAGPGVSGVADLIFASPTKSRPAGSEFAILGTNGWLSVNHVSKPGVSGSVIRVIIH  299

Query  416   -----GDGQ----IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDI  264
                   DG      +    P  GVQ EL +F + IS      G+  G+P    +    D+
Sbjct  300   SIVRSKDGTEVEEEEIIDEPGIGVQAELASFFAAIS--GKDDGKGLGDP----LAALGDV  353

Query  263   AVLEAMLESG  234
             A ++A L SG
Sbjct  354   AFIQAALNSG  363



>gb|EWY91836.1| glucose-fructose oxidoreductase [Fusarium oxysporum FOSC 3-a]
Length=345

 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 100/358 (28%), Positives = 177/358 (49%), Gaps = 28/358 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave--laRNHFPNVECKWGG  1080
             +A++G G+F K  ++P + +   L  LKAI+SRS +SA+            P++     G
Sbjct  6     VALIGGGLFAKQAHMPAIMKADNL-ALKAIYSRSLKSAKETAALNTRSGQEPDLYSADSG  64

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             +G   ++++    I  V + +   +Q E     L  GKHVL EKP A  +A+ +  + +Y
Sbjct  65    SGKSFDDLLAREDIEAVIIALPIPSQPEHIKAALAAGKHVLAEKPLAPTVADGQKLIEYY  124

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
               L    T    +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++W
Sbjct  125   RGLGGKAT----FSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAW  180

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             R    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G 
Sbjct  181   RAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGV  240

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV
Sbjct  241   SGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGV  293

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EE++ +   ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  294   TEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>emb|CDM31202.1| NAD(P)-binding domain [Penicillium roqueforti FM164]
Length=346

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 174/366 (48%), Gaps = 44/366 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG+F K Q++P +  +S  F LKAI+SR+ +SA+             E    G  
Sbjct  5     VAIIGSGLFAKEQHLPAVQAVSN-FQLKAIYSRTLKSAQDLASGTSEVDLYSEDSGSGKS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++  + I  V + +    Q E   + L  GKHVL EKP A  +A A+  L  Y S  
Sbjct  64    YTDLLARSDIGAVIIALPILVQPEFIRKALLAGKHVLSEKPIAKDVATAQELLNWYKS--  121

Query  893   TNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnp-------yf  738
              N+ T K  WAVAEN+R+   F    + + ++G + N +V +   M+  N          
Sbjct  122   -NIDTSKVFWAVAENFRYITKFLFAAEQVQKLGKVQNFRVNVHSLMDKENKYFPTDYIEL  180

Query  737   ssSWRRN--FFGGFILDMGVHYVAGLRMLVG-CEVTSVSAMTSHVDKT-LPPPDNISALF  570
              ++WR+   + GGF+LD GVH  A LR+++G  E  S+ +  S + K  LPP D + A+ 
Sbjct  181   DTAWRKTPEYQGGFLLDGGVHMTAALRLILGPTERLSILSAQSQLQKPFLPPVDTVDAVA  240

Query  569   QLENGCSGVFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDG-KHGYSVSLYMGDGQIK  399
             + ++G +GV ++   S     ++      G  TL  +    +G KH         DG+  
Sbjct  241   KTKSGATGVISLSWGSSFNDQIFEFACEKGVVTLNFDDVTVNGEKHHVEF-----DGR--  293

Query  398   SFFYPFCGVQEELKTFLSDISLANTKGGECKGEP--RLSFVEGTRDIAVLEAMLESGKRE  225
                    GV  E+  F   I           G+P  R S  E   D+ +LE ML SG+++
Sbjct  294   -------GVLPEVAAFADSI---------VNGKPDSRQSPEEALADLEILEQMLRSGEKD  337

Query  224   GALVQV  207
             G  VQ+
Sbjct  338   GEKVQL  343



>gb|EHK17838.1| hypothetical protein TRIVIDRAFT_136949, partial [Trichoderma 
virens Gv29-8]
Length=331

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 103/345 (30%), Positives = 168/345 (49%), Gaps = 24/345 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-HFPNVEC---KW  1086
             IAILG+GIF   +++P L  +     +KA++SRS+ +A + V  A      N++      
Sbjct  2     IAILGAGIFATEEHLPAL--VLNKANIKAVYSRSKSTASTLVAEANKLGVTNLDLYSEDT  59

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G  L++++K + I  V +V+    Q  +  R L  GKHVL EKP A  +A A   +  Y
Sbjct  60    SGHTLDDLLKRSDIEAVIIVLPILVQPSIVRRCLAAGKHVLCEKPIAKDVATARELIEDY  119

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfs  735
             N L     +  I+ +AE +RF   F   +K I E   +GD+    + I  +   +  ++ 
Sbjct  120   NKLYAG--KGLIFNIAEQFRFMHEFELGRKWIVEEKAVGDITQAHLRIWRNQPPNGKWYE  177

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+   + GGF+LD GVH  A LR + G EV   +     V   LPP D ++A   L 
Sbjct  178   TPWRKVPEYQGGFLLDGGVHQTAMLRYISGQEVVETAGFARQVAPHLPPLDTLNAGILLS  237

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G +G  +M  +S        ++G  G+  +     DG  G+ +SL +  G+ +S     
Sbjct  238   GGGTGTISMSFASTRRASELTIIGSKGSFFL----TDGPDGFLLSLDLATGERRSETIRS  293

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAM  246
              GV+ E++ FL  + +  +   E K  P     E   D+A++E+M
Sbjct  294   KGVELEIQAFLEAVKMGKS---EKKAGPE----EALNDLAIIESM  331



>gb|EIT72400.1| putative dehydrogenase [Aspergillus oryzae 3.042]
 gb|KDE75123.1| putative dehydrogenase [Aspergillus oryzae 100-8]
Length=412

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 104/374 (28%), Positives = 181/374 (48%), Gaps = 54/374 (14%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF------PNVEC  1092
             +A+LG+GIF K +++P +     L  LKA++SRS+ SA S    A          P+V+ 
Sbjct  58    VALLGAGIFAKKEHLPAIESCPSL-SLKAVYSRSQTSAESFAAAAGEDIEAYFESPSVQS  116

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             K     L+++++   I+ V + VA     ++  + L  GKHVL EKP A  +  A+  + 
Sbjct  117   K----SLDDLLQRQDIVAVIIAVAITAAPDLIQKALAAGKHVLSEKPIAPDVETAQRLMD  172

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfs  735
             +Y+  + +     +W V EN+RF     +  +++ E+G  ++   V      +S NP++ 
Sbjct  173   YYHGQTKSGV---LWGVGENFRFWDPVQKAARILTEMGGSLVTFSVTAYSFTDSKNPFYH  229

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALF  570
             + WR+   F GG++LD GVH+ A LR L+   G  V  VSA T+ + + LPP D + A+ 
Sbjct  230   TDWRQKPTFQGGYLLDGGVHFAAVLRTLLAALGQRVDVVSAYTTSLQENLPPLDTVHAIL  289

Query  569   QLENGCSGVFAMVVSSRSPK------------IVWRVVGLNGTLEVERGNKDGKHGYSVS  426
             +   G SG +   V  ++ +            + +R   +   ++ ++G           
Sbjct  290   RTNKGRSGTYTSSVGIQAKRGMEFEIVTDKGYVTYRPFQMEILVKQDQG-----------  338

Query  425   LYMGDGQIKSFFYPFC-GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEA  249
                G+ + +S   P   GV+EE+  F + IS         + + RLS  E   D+ ++EA
Sbjct  339   ---GNWEERSEPAPLMWGVKEEIAAFATSISTG-------RLDSRLSTTEALEDLKIVEA  388

Query  248   MLESGKREGALVQV  207
             ML SG  +   V +
Sbjct  389   MLRSGDAQALPVDI  402



>ref|XP_755974.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus Af293]
 gb|EAL93936.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus Af293]
 gb|EDP55143.1| oxidoreductase family, NAD-binding Rossmann fold protein [Aspergillus 
fumigatus A1163]
 gb|KEY76538.1| oxidoreductaseNAD binding Rossmann fold protein [Aspergillus 
fumigatus var. RP-2014]
Length=379

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 84/272 (31%), Positives = 137/272 (50%), Gaps = 42/272 (15%)
 Frame = -2

Query  992  RLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNM-TQKPIWAVAENYRFEPAFTECKK  816
            + L  GKHVL EKP A  IA A + +  Y++   N+ T+K +WAVAEN+R+   F    +
Sbjct  126  KALTAGKHVLSEKPIAKDIATARDLVQWYHA---NIDTRKTLWAVAENFRYMTKFLRTAE  182

Query  815  MIAEIGDMMNVQVIIEGsmnssnpyfssSWR-----RNFFGGFILDMGVHYVAGLRMLVG  651
             + ++G + N +V     +++ + YFS  +R      ++ GGFILD GVH VA LR+++G
Sbjct  183  EVQKLGRVKNFRVNFHALVSTDSKYFSKLYRLRSTSHDYLGGFILDGGVHVVAALRLILG  242

Query  650  CE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWR------V  495
                V ++SA +    + LPP D ++A+ + ++G +GV ++   S     V+       V
Sbjct  243  SNDPVATISAQSCLQQQHLPPLDTVNAVMKTKSGATGVLSLSFGSAFDDSVFEFDCEGGV  302

Query  494  VGLNG-TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKG  318
            V LN  TL ++                  G+     +   GV  E+  F + I+     G
Sbjct  303  VALNSDTLTIK------------------GESNELAFDGRGVSREVAVFATTIA----SG  340

Query  317  GECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
            G    + R S  E   D+ ++E ML SG+R+G
Sbjct  341  GSV--DKRQSPEEALADLEIMEKMLTSGERDG  370



>gb|KKA20212.1| hypothetical protein T310_5781 [Rasamsonia emersonii CBS 393.64]
Length=353

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 93/360 (26%), Positives = 167/360 (46%), Gaps = 22/360 (6%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEISQLFV------LKAIWsrseesarsavelaR  1116
             MA+S +  +A++G+GI+ K  Y+P L +     V      LK+      E+ +     A 
Sbjct  1     MAQSAVNGVALIGAGIYPKEAYLPALHKTKATLVAIYSRSLKSASECLAEARKFDGLCAE  60

Query  1115  NHFPNVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaci  936
             N     +      GL+++++   +  V V +    Q  + L+ L  GKHVL EKP A  +
Sbjct  61    NIAAYHDGSPSNGGLDQLLQRDDVTSVIVALPTTVQPAVVLKCLAAGKHVLMEKPIAKDV  120

Query  935   aeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIEGs  762
              +A   +  Y S     +QK I AVAE +RF+ A  + ++++++  IG+++     I  +
Sbjct  121   KDAVALIAEYES--QFQSQKLILAVAEQFRFDLAHEKARQIVSDGTIGELVAAHARIWSN  178

Query  761   mnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPD  588
             M   N ++ + WR+  ++ GGF+LD GVH++A LR +   E+   ++        LPP D
Sbjct  179   MQPGNKWYETEWRKVPDYQGGFLLDGGVHFIALLRYVSSDEIEETASFARQTYDHLPPLD  238

Query  587   NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  408
              +    + ++G  G  +M  +S   +  +  +G  G+L +     DG       L + D 
Sbjct  239   TVQGALRFKSGALGTISMSWASVKGEYSYNFIGTKGSLTIT--GADG----GTKLVVEDE  292

Query  407   QIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
             Q K         +   + FL          G+ +  PR +      D+AV+E++L  G +
Sbjct  293   QGKVVSEEIIAGEGTAQEFLGFFEAIKRGQGDERASPRQALA----DVAVVESLLNGGGK  348



>gb|ETS04874.1| NAD-binding Rossmann fold oxidoreductase [Trichoderma reesei 
RUT C-30]
Length=343

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 105/351 (30%), Positives = 168/351 (48%), Gaps = 24/351 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-HFPNVEC---KW  1086
             IAILG+GIF   +++P L  +     +KA++SRS+ +A + V  A      N++      
Sbjct  4     IAILGAGIFATEEHLPAL--VLNKANVKAVYSRSKATASTLVAEATKLGIGNLDLYSEDT  61

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G  L++++K + I  V +V+    Q  +  R L  GKHVL EKP A  +A A   +  Y
Sbjct  62    PGHTLDDLLKRSDIEAVVIVLPILVQPSIVRRCLAAGKHVLCEKPIAKDVATARELIEDY  121

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfs  735
               L    ++  I+ +AE +RF   F   ++ + +   IGD+    + I         ++ 
Sbjct  122   KKLYA--SKGLIFNIAEQFRFMHEFERGREWVVDEQAIGDITQAHLRIWRHQPPEGKWYE  179

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+   + GGF+LD GVH  A LR + G EV   +     V   LPP D ++A   L 
Sbjct  180   TPWRKVPEYQGGFLLDGGVHQTAMLRFISGQEVVETAGFARQVLPHLPPLDTLNAGILLS  239

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G +G  +M  +S        ++G  G+  +     DG  G ++SL +  G+ +S     
Sbjct  240   GGGTGTISMSFASIRRATELTIIGSKGSFSL----TDGPDGSTLSLDLATGERRSETIRS  295

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
              GV+ E+K FL  I     K G  K E R    E   D+A++E+M   G +
Sbjct  296   KGVELEIKAFLEAI-----KAG--KSEKRAGPEEALNDLAIIESMCSGGGK  339



>gb|EEH05857.1| NAD-binding Rossmann fold oxidoreductase [Histoplasma capsulatum 
G186AR]
Length=352

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 96/359 (27%), Positives = 168/359 (47%), Gaps = 39/359 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLA--------------EISQLFVLKAIWsrseesarsavelaR  1116
             IA+LG+GIF K  ++P LA              E S   V++A+ S S     + +++  
Sbjct  4     IALLGAGIFAKEAHVPVLAHNDKAKVLAVYSRSETSANSVVEALHSTSTAGTSATIDVYS  63

Query  1115  NHFPNVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaci  936
             +  P       G  L+E+++   I  V VV+       +  + L  GKHVL EKP    +
Sbjct  64    DEKP-------GYRLDELLQRADIEAVIVVLPILVLPAVVRKCLAAGKHVLAEKPIGPDV  116

Query  935   aeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA--EIGDMMNVQVIIEGs  762
             A     +  Y S  T   +  + ++AE +R+E A     ++IA  +IG++ +V   +  +
Sbjct  117   AAGRALIAEYES--TYAPRNLVLSIAEQFRYETALIRAGELIAGGKIGELHHVHGRVATT  174

Query  761   mnssnpyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPD  588
             M   N +  ++WR    + GGF+LD GVH+VA +RM+ G E+   ++ T+     L P D
Sbjct  175   MAPDNKFCKTAWRATPGYQGGFVLDAGVHFVALMRMVAGQEIVETTSFTAQFAPHLSPVD  234

Query  587   NISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  408
              ++A  +   G  G F+M  ++ +    +  +G  G L V+R      H  +V +   D 
Sbjct  235   TVNAALKFSGGAQGTFSMSFAAATFVADFIFIGTAGMLTVKR----AVHETTVRVDGPDL  290

Query  407   Q-IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
             + I    +   G+  E+  F+  ++    + G+    PR    E   D+AV+E++   G
Sbjct  291   KPISEEAFKADGMMNEISAFVQAVA---ARKGDKAASPR----EALADVAVIESICSGG  342



>ref|XP_007330917.1| hypothetical protein AGABI1DRAFT_114560 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78203.1| hypothetical protein AGABI1DRAFT_114560 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=377

 Score = 91.7 bits (226),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 118/383 (31%), Positives = 182/383 (48%), Gaps = 47/383 (12%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelaRN----------HF  1107
             +AILG+GIF K  ++P LA + +    LKA++SRSE+SA+   + A            +F
Sbjct  7     VAILGAGIFAKEAHLPALAALGASAPPLKAVYSRSEKSAKDLAQTAATILKLSSPPSVYF  66

Query  1106  PNVECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaea  927
              N       + L+ ++  + I  V V++   TQ  + L+ L  GKHV+ EKP AA +   
Sbjct  67    DNDSS----SNLDVLLARSDISSVIVILPITTQPAIVLKALAAGKHVISEKPVAADVQSG  122

Query  926   enALMHYNSLSTNMTQKP-IWAVAENYRFEPAFTECKKMI--AEIGDMMNVQVIIEGsmn  756
                +  YNS   N   K  IW VAEN+  EP +      I   +IG + + +      ++
Sbjct  123   LKLIADYNS---NFKSKNLIWRVAENFEAEPGYQAAAAAIRAGKIGQVHSFKAEKIDYID  179

Query  755   ssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNI  582
             +   ++ + WR   ++ GGF+LD GVH +A LR+++   +T VS   S     L P D I
Sbjct  180   TETKWYKTPWRTIPDYQGGFLLDGGVHTIAALRVMLPHPLTHVSGFASLNKAYLAPHDII  239

Query  581   SALFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHG-------Y  435
              A+ Q   G SGV    FA    SR     + ++G NG L V   +K G  G       +
Sbjct  240   HAIVQAGPGVSGVADLIFASPTKSRPAGSEFAILGTNGWLSVNHVSKPGVSGSVIRVIIH  299

Query  434   SVSLYMGDGQIKS----FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRD  267
             S+     D +++        P  GVQ EL +F + IS      G+  G+P  +      D
Sbjct  300   SIVKSKDDTEVEEKEEIIDEPGIGVQAELASFFAAIS--GKDDGKGLGDPLAAL----GD  353

Query  266   IAVLEAMLESGKREGALVQVKKF  198
             +A ++A L SG   G LV + + 
Sbjct  354   VAFIQAALNSG---GNLVDLTQL  373



>gb|KJJ31192.1| Ribosomal protein L32 [Aspergillus flavus AF70]
Length=517

 Score = 93.2 bits (230),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 165/333 (50%), Gaps = 26/333 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG F + +++P + + S  F LKAI+SRS  SA++            E    G  
Sbjct  5     VAIIGSGNFAREEHLPGV-QASDAFDLKAIYSRSLTSAQTLATGVSGIDLYSEDAGPGKT  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++  + I  V + +    Q E   + L  GKHVL EKP A  ++ A++ +  +NS  
Sbjct  64    YDDLLSRSDITAVIIALPILAQPEFIRKALTAGKHVLSEKPIAKDLSAAQDLINLHNSRI  123

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
               ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR  
Sbjct  124   --VSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKP  181

Query  716   -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
              + GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +G
Sbjct  182   EYQGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATG  241

Query  545   VFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--C  378
             V ++   S     ++     +G  TL+ +R   +G+ GY V              PF   
Sbjct  242   VLSVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDV--------------PFEGR  286

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVE  279
             GV +EL  F   I+  +      + E  L+ +E
Sbjct  287   GVNKELVEFAESITTGDGIATRLRPEEALADLE  319



>gb|KFH44383.1| hypothetical protein ACRE_048520 [Acremonium chrysogenum ATCC 
11550]
Length=348

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 123/262 (47%), Gaps = 23/262 (9%)
 Frame = -2

Query  986  LKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  807
            L  GKHVL EKP A  +A A   L +Y S+S+    K   A+AEN+RF P+F    +  A
Sbjct  96   LAAGKHVLAEKPIAGDVAAARKLLGYYRSVSSK--NKATLAIAENHRFFPSFVYAAEQAA  153

Query  806  EIGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVT--  639
             +G + +  V     M   N YF++ WR    + GGF+LD GVH+ A  R+ +  +    
Sbjct  154  SLGKLQHFSVKCFSLMAQDNKYFNTPWRTKPQYQGGFLLDGGVHHAAATRLFLHGDANGA  213

Query  638  -SVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVER  462
             +V A T      LPP D +SA+ +  +G +G +     S      W +    G++ V  
Sbjct  214  HTVQAFTQQAQAHLPPIDTVSAIIKTRSGATGTYQHSAGSNVRAFEWDLGYEKGSVNV--  271

Query  461  GNKDGKHGYSVSLYMGDGQIK-SFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSF  285
                  +G +V++    G+     F    GV+EE+  +   ++       + K  PR S 
Sbjct  272  ------NGETVTVTPAGGEKTVKHFERTSGVEEEVAAWAQSLA-------DGKPNPRQSP  318

Query  284  VEGTRDIAVLEAMLESGKREGA  219
             E   D+  LE M +SG  +G+
Sbjct  319  EEALADLEFLEKMFKSGDEKGS  340



>gb|KIY03803.1| hypothetical protein Z520_00494 [Fonsecaea multimorphosa CBS 
102226]
Length=339

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 173/358 (48%), Gaps = 36/358 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AILG GIF + ++ P + E S+   LKA++SRS +SA++            +    G  
Sbjct  4     VAILGGGIFAREEHKPAV-EASKDLTLKAVYSRSLKSAKTLEVDESKVDLYSDDSGAGKS  62

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
             L++++  + I  V + +  + Q +   + L  GKHVL EKP A  + +A   +  Y S  
Sbjct  63    LDDLLARSDIQAVIIALPIKNQPDYIRKALLAGKHVLSEKPVAENVKDAAELIQWYRS--  120

Query  893   TNMTQKPI-WAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssS  729
               M  K + W VAEN R+  +F    +++   G  +     +Q ++EG            
Sbjct  121   -EMEPKKVTWGVAENVRYTDSFIRAAEVVKTKGRQLTFRCRMQTLVEGGKYFETE-----  174

Query  728   WRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLE  561
             WR+     GGF+LD GVH+ AGLR+++G +  + S+SA ++ + + LPP D + A  + +
Sbjct  175   WRKVPTHQGGFLLDGGVHFTAGLRLMMGKDNPLVSLSAHSAQLQEHLPPVDTVEATAKSK  234

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
             NG  G  ++   +      W V    G++ +  GNK             DG+ +      
Sbjct  235   NGNVGTISISFGTTHKGSEWAVGCEKGSVSLS-GNK----------VTYDGKTEEVQDER  283

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQV  207
              GV  E++ +    +LA  K  E +     S  EG  D+ ++EAML SG++ G  +++
Sbjct  284   TGVPGEVRAWGE--ALAAGKVNESQ-----SPEEGLADLELIEAMLRSGEQGGVPIKL  334



>gb|EXL57961.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=345

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 96/346 (28%), Positives = 172/346 (50%), Gaps = 25/346 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave--laRNHFPNVECKWGG  1080
             +A++G G+F K  ++P + +   L  LKAI+SRS +SA+            P++     G
Sbjct  6     VALIGGGLFAKQAHMPAIMKADNL-ALKAIYSRSLKSAKETAALNTRSGQEPDLYSADSG  64

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             +G   ++++    I  V + +   +Q E     L  GKHVL EKP A  +A+ +  + +Y
Sbjct  65    SGKSFDDLLAREDIEAVIIALPIPSQPEHIRAALAAGKHVLAEKPLAPTVADGQKLIEYY  124

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
               L    T    +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++W
Sbjct  125   RGLGGKAT----FSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAW  180

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             R    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G 
Sbjct  181   RAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGV  240

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV
Sbjct  241   SGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGV  293

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESG  234
              EE++ +   ++       E K + R S  E   D+  LE M ESG
Sbjct  294   TEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESG  332



>ref|XP_773472.1| hypothetical protein CNBI0860 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL18825.1| hypothetical protein CNBI0860 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=358

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 107/360 (30%), Positives = 169/360 (47%), Gaps = 24/360 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +A+LG GIF    ++P LA+   L  L+A+WSRSE S+  A E  ++       K+   G
Sbjct  5     VALLGGGIFAVDAHLPALAKSGTLASLEAVWSRSESSSTKAAEAWKSLTGQEVTKYSETG  64

Query  1073  ---LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                L++++    I  V + +   +Q ++  R LK GKHVL EKP +  +  A   L  Y 
Sbjct  65    CDNLDKLLSREDIEAVIIALPILSQSDIIARALKAGKHVLSEKPVSQDVTSATKMLKDYQ  124

Query  902   SLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfss  732
                    Q  +W VAEN+  EPA  F         IG++    +  +    +  N YF +
Sbjct  125   E--NYQAQGLVWRVAENWEVEPAHIFAAQALKAGHIGNLNTFSISSVLFVDSEDNKYFET  182

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE-  561
              WR+     GG++LD GVH    LR ++   +T +SA T+  ++ LPP D +S + + + 
Sbjct  183   EWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLSAHTALNNEHLPPYDWLSVITRSKP  242

Query  560   NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMGD-GQIKS--  396
             N   G   +   +R  + +W  R+ G +G +  E  N DG     V +  G  G+ K   
Sbjct  243   NNIHGQILIDYGARGREPMWELRLTGSDGEIYSEDINDDGVDSIKVQVRSGKFGRTKREI  302

Query  395   FFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGAL  216
               +P  GV EE + F   I+    + G  +G           D+A+++A L S   E AL
Sbjct  303   KIFPKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQAALTSNGNEVAL  354



>gb|KIV93979.1| hypothetical protein PV10_05146 [Exophiala mesophila]
Length=341

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 96/350 (27%), Positives = 159/350 (45%), Gaps = 33/350 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AILG GIF + +++P +  +  L  LKA WSRS +S ++            E    G  
Sbjct  8     VAILGGGIFAREEHVPAVDAVKNL-TLKAAWSRSLKSVKTLEVDTSKVDLYSEDSAPGKQ  66

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
             L++++  + I  V + +  + Q E   + L  GKHVL EKP A  + EA   +  Y++  
Sbjct  67    LDDLLARSDITAVIIALPIKNQPEYIRKSLLAGKHVLSEKPVAENVVEAAELIEWYHAEI  126

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSW  726
             T       WAVAEN R+  +F +    +   G  +     +Q ++ G            W
Sbjct  127   TTKADT-TWAVAENQRYLDSFEKAANAVKTKGRQLTFRLRMQTLVTGGKYFETS-----W  180

Query  725   RR--NFFGGFILDMGVHYVAGLRMLV--GCEVTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             R+     GGF+LD GVH+VAGLR L+  G  + ++SA ++ +   LPP D + A  + +N
Sbjct  181   RKVPTHQGGFLLDGGVHFVAGLRYLLGKGNPIVTISAHSAQLQDHLPPVDTVEATARTKN  240

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             G  G  ++   + +    W +           G +DG      S    DG  + F     
Sbjct  241   GAIGTLSISFGTTAKGTEWTI-----------GAEDGVVSIIDSDLTIDGNKQDFTNERS  289

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
             GV  E++ +   ++  +        + R +  E   D+ ++EAML SG +
Sbjct  290   GVPPEVRAWGEALAAGSI-------DARQTPEEALADLELIEAMLVSGGK  332



>gb|KIR53880.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
Ru294]
Length=358

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 113/367 (31%), Positives = 174/367 (47%), Gaps = 30/367 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   G
Sbjct  5     VALLGGGIFAVDAHLPALAKLGTLASLKAVWSRSESSSTKAAEAWKSLTGQQVTRYSENG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +  A   L  Y 
Sbjct  65    SEDLENLLSRKDIDAVIIALPILSQANIIARALQTGKHVLSEKPVAKDVDTATKMLQDYQ  124

Query  902   SLSTNMT-QKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfs  735
                TN   Q  +W VAEN+  EPA  F         IG++ +  +  I    N +N YF 
Sbjct  125   ---TNFQPQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNSFSISSILFVDNENNKYFE  181

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E
Sbjct  182   TEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNQHLPPYDWLSVITRSE  241

Query  560   -NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQ  405
              +   G   +   +R  + VW  R+ G +G +  E  +  G     V +  G     + +
Sbjct  242   PSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVSDHGVDSIKVQVRSGKFGRTNAE  301

Query  404   IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKRE  225
             +K F  P  GV EE + F   I+    + G  +G           D+A+++A L S   E
Sbjct  302   VKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQAALTSNGNE  351

Query  224   GALVQVK  204
              AL  +K
Sbjct  352   VALNTLK  358



>ref|XP_003194017.1| hypothetical protein CGB_D1030C [Cryptococcus gattii WM276]
 gb|ADV22230.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
 gb|KIR81130.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
EJB2]
 gb|KIY34122.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
E566]
 gb|KJE03749.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
NT-10]
Length=358

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 113/367 (31%), Positives = 174/367 (47%), Gaps = 30/367 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   G
Sbjct  5     VALLGGGIFAVDAHLPALAKLGTLASLKAVWSRSESSSTKAAEAWKSLTGQQVTRYSENG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +  A   L  Y 
Sbjct  65    SEDLENLLSRKDIDAVIIALPILSQANIIARALQTGKHVLSEKPVAKDVDTATKVLQDYQ  124

Query  902   SLSTNMT-QKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfs  735
                TN   Q  +W VAEN+  EPA  F         IG++ +  +  I    N +N YF 
Sbjct  125   ---TNFQPQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNSFSISSILFVDNENNKYFE  181

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E
Sbjct  182   TEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVITRSE  241

Query  560   -NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQ  405
              +   G   +   +R  + VW  R+ G +G +  E  +  G     V +  G     + +
Sbjct  242   PSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVSDHGVDSIKVQVRSGKFGRTNAE  301

Query  404   IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKRE  225
             +K F  P  GV EE + F   I+    + G  +G           D+A+++A L S   E
Sbjct  302   VKIF--PKTGVYEEQRRFFEAIAGKPDEYGSAQG--------ALNDVALIQAALTSNGNE  351

Query  224   GALVQVK  204
              AL  +K
Sbjct  352   VALNTLK  358



>gb|EXK91996.1| glucose-fructose oxidoreductase [Fusarium oxysporum f. sp. raphani 
54005]
Length=345

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 99/358 (28%), Positives = 176/358 (49%), Gaps = 28/358 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave--laRNHFPNVECKWGG  1080
             +A++G G+F K  ++P + +   L  L AI+SRS +SA+            P++     G
Sbjct  6     VALIGGGLFAKQAHMPAIMKADNL-ALNAIYSRSLKSAKETAALNTRSGQEPDLYSADSG  64

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             +G   ++++    I  V + +   +Q E     L  GKHVL EKP A  +A+ +  + +Y
Sbjct  65    SGKSFDDLLAREDIEAVIIALPIPSQPEHIRAALAAGKHVLAEKPLAPTVADGQKLIEYY  124

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
               L    T    +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++W
Sbjct  125   RGLGGKAT----FSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAW  180

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             R    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G 
Sbjct  181   RAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGV  240

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV
Sbjct  241   SGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGV  293

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
              EE++ +   ++       E K + R S  E   D+  LE M ESG   G   Q KK+
Sbjct  294   TEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKY  341



>gb|KIR59526.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1873]
Length=358

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 111/362 (31%), Positives = 171/362 (47%), Gaps = 28/362 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   G
Sbjct  5     VALLGGGIFAVDAHLPALAKLGTLVSLKAVWSRSESSSTKAAEAWKSLTGQQVTRYSENG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +A A   L  Y 
Sbjct  65    SDDLENLLSRKDIDAVIIALPILSQANIIARALQAGKHVLSEKPVAKDVATATKMLQDYQ  124

Query  902   SLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfss  732
                    Q  +W VAEN+  EPA  F         IG++    +  I    N +N YF +
Sbjct  125   I--NFQPQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNTFSISSILFVDNENNKYFET  182

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE-  561
              WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E 
Sbjct  183   EWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVITRSEP  242

Query  560   NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQI  402
             +   G   +   +R  + VW  R++G +G +  E  N +G     V +  G     + ++
Sbjct  243   SNIHGQMLIDYGARGREPVWELRLIGSDGEIYSEDVNDNGMDSIKVQVRSGKFGRTNTEV  302

Query  401   KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             K F  P  GV EE + F   I+    + G  +G           D+A+++  L S   E 
Sbjct  303   KIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSNGNEV  352

Query  221   AL  216
             AL
Sbjct  353   AL  354



>gb|EIT80267.1| putative dehydrogenase [Aspergillus oryzae 3.042]
 gb|KDE78827.1| putative dehydrogenase [Aspergillus oryzae 100-8]
Length=333

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 101/352 (29%), Positives = 166/352 (47%), Gaps = 40/352 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSG F  T         S  F LKAI+SRS  SA+             E    G  
Sbjct  5     VAIIGSGTFNHT---------SDAFDLKAIYSRSLTSAQILATGVSGIDLYSEDAGPGKT  55

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              ++++  + I  V + +    Q E   + L  GKHVL EKP A  ++ A++ +  +NS  
Sbjct  56    YDDLLSRSDITAVIIALPILAQPEFIRKALTAGKHVLSEKPIAKDLSAAQDLINLHNS--  113

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRRN-  717
               ++ K +WAVAEN+R+   F    + +  +G + N +V++   +   + Y  + WRR  
Sbjct  114   RIVSSKTVWAVAENWRYMSKFVRAAEEVRRLGGVKNFRVVMRSMIKPGSKYHKTEWRRKP  173

Query  716   -FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCSG  546
              + GGF+LD GVH VA LR+++G    +  V+A +S   + L P D + AL +  +G +G
Sbjct  174   EYQGGFVLDGGVHVVAALRLILGQSDGLAMVAAHSSLRQEHLAPVDTVDALVKTRSGATG  233

Query  545   VFAMVVSSRSPKIVWRVVGLNG--TLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF--C  378
             V ++   S     ++     +G  TL+ +R   +G+ GY V              PF   
Sbjct  234   VLSVSYGSEINDSLFEFTCADGVVTLDFDRLTVNGE-GYDV--------------PFEGR  278

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             GV +EL  F   I+  +      + E  L+      D+ V+E +  S ++ G
Sbjct  279   GVNKELVEFAESITTGDGIATRLRPEEALA------DLEVMEGIFTSSEKAG  324



>gb|KIR46389.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1280]
Length=358

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 111/362 (31%), Positives = 171/362 (47%), Gaps = 28/362 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   G
Sbjct  5     VALLGGGIFAVDAHLPALAKLGTLASLKAVWSRSESSSTKAAEAWKSLTGQQVTRYSENG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +A A   L  Y 
Sbjct  65    SDDLENLLSRKDIDAVIIALPILSQANIIARALQAGKHVLSEKPVAKDVATATKMLQDYQ  124

Query  902   SLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfss  732
                    Q  +W VAEN+  EPA  F         IG++    +  I    N +N YF +
Sbjct  125   I--NFQPQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNTFSISSILFVDNENNKYFET  182

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE-  561
              WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E 
Sbjct  183   EWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVITRSEP  242

Query  560   NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQI  402
             +   G   +   +R  + VW  R++G +G +  E  N +G     V +  G     + ++
Sbjct  243   SNIHGQMLIDYGARGREPVWELRLIGSDGEIYSEDVNDNGMDSIKVQVRSGKFGRTNTEV  302

Query  401   KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             K F  P  GV EE + F   I+    + G  +G           D+A+++  L S   E 
Sbjct  303   KIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSNGNEV  352

Query  221   AL  216
             AL
Sbjct  353   AL  354



>gb|KIS02481.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
2001/935-1]
Length=358

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 172/366 (47%), Gaps = 28/366 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   G
Sbjct  5     VALLGGGIFAVDAHLPALAKLGTLASLKAVWSRSESSSTKAAEAWKSLTGQQVTRYSEDG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +A A   L  Y 
Sbjct  65    SDDLENLLSRKDIDAVIIALPILSQANIIARALQAGKHVLSEKPVAKDVATAAKMLQDYQ  124

Query  902   SLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfss  732
                    Q  +W VAEN+  EPA  F         IG++    +  +    N +N YF +
Sbjct  125   E--NFQAQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNTFSISSVLFVDNENNKYFET  182

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE-  561
              WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E 
Sbjct  183   EWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVITRSEP  242

Query  560   NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQI  402
             +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     + ++
Sbjct  243   SNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQVRSGKFGRTNTEV  302

Query  401   KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             K F  P  GV EE + F   I+    + G  +G           D+A+++  L S   E 
Sbjct  303   KIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSNGNEV  352

Query  221   ALVQVK  204
             AL  +K
Sbjct  353   ALNTMK  358



>gb|KIR26739.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
LA55]
 gb|KIR36612.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
MMRL2647]
 gb|KIR39015.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
Ram5]
 gb|KIR95985.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CBS 10090]
 gb|KIY58928.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
99/473]
Length=358

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 172/366 (47%), Gaps = 28/366 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   G
Sbjct  5     VALLGGGIFAVDAHLPALAKLGTLASLKAVWSRSESSSTKAAEAWKSLTGQQVTRYSEDG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +A A   L  Y 
Sbjct  65    SDDLENLLSRKDIDAVIIALPILSQANVIARALQAGKHVLSEKPVAKDVATAAKMLQDYQ  124

Query  902   SLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfss  732
                    Q  +W VAEN+  EPA  F         IG++    +  +    N +N YF +
Sbjct  125   E--NFQAQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNTFSISSVLFVDNENNKYFET  182

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE-  561
              WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E 
Sbjct  183   EWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVITRSEP  242

Query  560   NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQI  402
             +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     + ++
Sbjct  243   SNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQVRSGKFGRTNTEV  302

Query  401   KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             K F  P  GV EE + F   I+    + G  +G           D+A+++  L S   E 
Sbjct  303   KIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSNGNEV  352

Query  221   ALVQVK  204
             AL  +K
Sbjct  353   ALNTMK  358



>gb|KIR85165.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
IND107]
Length=358

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 111/367 (30%), Positives = 172/367 (47%), Gaps = 28/367 (8%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---  1086
              +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   
Sbjct  4     NVALLGGGIFAVDAHLPALAKLGTLASLKAVWSRSESSSTRAAEAWKSLTGQQVTRYSED  63

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             G   LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +A A   L  Y
Sbjct  64    GSDDLENLLSRKDIDAVIIALPILSQANVIARALQAGKHVLSEKPVAKDVATAAKMLRDY  123

Query  905   NSLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfs  735
                     Q  +W VAEN+  EPA  F         IG++    +  +    N +N YF 
Sbjct  124   QK--NFQPQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNTFSISSVLFVDNENNKYFE  181

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E
Sbjct  182   TEWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVITRSE  241

Query  560   -NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQ  405
              +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     + +
Sbjct  242   PSNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQIRSGKFGRTNTE  301

Query  404   IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKRE  225
             +K F  P  GV EE + F   I+      G  +G          +D+A+++  L S   E
Sbjct  302   VKIF--PKTGVYEEQRRFFEAIAGKPDGYGSVRG--------ALKDVALIQVALTSNGNE  351

Query  224   GALVQVK  204
              AL  +K
Sbjct  352   VALNTLK  358



>ref|XP_568129.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW46612.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=358

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 170/363 (47%), Gaps = 28/363 (8%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
              +A+LG GIF    ++P LA+   L  L+A+WSRSE S+  A E  ++       K+   
Sbjct  4     NVALLGGGIFAVDAHLPALAKSGTLASLEAVWSRSESSSTKAAEAWKSLTGQEVTKYSET  63

Query  1076  G---LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             G   L++++    I  V + +   +Q ++ +R LK  KHVL EKP +  +  A   L  Y
Sbjct  64    GCDNLDKLLSREDIEAVIIALPILSQPDIIVRALKARKHVLSEKPVSQDVTSATKMLKDY  123

Query  905   NSLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfs  735
                     Q  +W VAEN+  EPA  F         IG++    +  +    N  N YF 
Sbjct  124   QE--NYQAQGLVWRVAENWEVEPAHIFAAQALKAGHIGNLNTFSISSVLFVDNEDNKYFE  181

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WR+     GG++LD GVH    LR ++   +T +SA T+  ++ LPP D +S + + E
Sbjct  182   TEWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLSAHTALNNEHLPPYDWLSVITRSE  241

Query  560   -NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQ  405
              N   G   +   +R  + +W  R+ G +G +  E  N DG     V +  G     + +
Sbjct  242   PNNIHGQILIDYGARGREPMWELRLTGSDGEIYSEDINDDGVDSIKVQVRSGKFGRTNRE  301

Query  404   IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKRE  225
             IK F  P  GV EE + F   I+    + G  +G           D+A+++A L S   E
Sbjct  302   IKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQAALTSNGNE  351

Query  224   GAL  216
              AL
Sbjct  352   VAL  354



>ref|XP_001261103.1| hypothetical protein NFIA_091650 [Neosartorya fischeri NRRL 181]
 gb|EAW19206.1| predicted protein [Neosartorya fischeri NRRL 181]
Length=360

 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 112/375 (30%), Positives = 181/375 (48%), Gaps = 59/375 (16%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AI+GSGIF + +++P + + ++ F LKAI+SRS +SA+             E    G G
Sbjct  5     VAIIGSGIFAREEHLPAV-QAAKDFQLKAIYSRSLKSAQDLASGTTRVDLYSEDSGPGKG  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
               +++    I  V + +    Q +   + L  GKHVL EKP A  IA A N L  Y++  
Sbjct  64    YADLLAREDIAAVLIALPILVQPDFIRKALTAGKHVLSEKPIAKDIATARNLLQWYHA--  121

Query  893   TNM-TQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQV-----IIEGs----------  762
              N+ T K +WAVAEN+R+   F    + + ++G + N +V     I  GS          
Sbjct  122   -NIDTSKTLWAVAENFRYMTKFLRTAEEVQKLGRVKNFRVNSHALISTGSKYFSKLYLLC  180

Query  761   ----mnssnpyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDK  606
                   + +    ++WR+   + GGFILD GVH +A LR+++G    V ++SA +    +
Sbjct  181   YVFSSIALSDEAETAWRQTPGYQGGFILDGGVHIIAALRLILGSNDPVATISAQSCLQQQ  240

Query  605   TLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWR------VVGLN-GTLEVERGNKDG  447
              L P D ++A+ + ++G +GV ++   S     V+       VV LN  TL +    KD 
Sbjct  241   HLLPLDTVNAVMKTKSGATGVLSLSYGSAFNDSVFEFDCEGGVVALNFDTLTI----KDE  296

Query  446   KHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRD  267
              +  +      DG+         GV  E+  F + I+     GG    + R S  E   D
Sbjct  297   SNELAF-----DGR---------GVSREVAVFATTIA----SGGSV--DKRQSPEEALAD  336

Query  266   IAVLEAMLESGKREG  222
             + ++E ML SG+R+G
Sbjct  337   LEIMEKMLTSGERDG  351



>gb|EGU88150.1| hypothetical protein FOXB_01288 [Fusarium oxysporum Fo5176]
Length=1063

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 102/367 (28%), Positives = 179/367 (49%), Gaps = 28/367 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsave--laRNHFPNVECKWGG  1080
             +A++G G+F K  ++P + +   L  LKAI+SRS +SA+            P++     G
Sbjct  688   VALIGGGLFAKQAHMPAIMKADNL-ALKAIYSRSLKSAKETAALNTRSGQEPDLYSADSG  746

Query  1079  AG--LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             +G   ++++    I  V + +   +Q E     L  GKHVL EKP A  +A+ +  + +Y
Sbjct  747   SGKSFDDLLAREDIEAVIIALPIPSQPEHIRAALAAGKHVLAEKPLAPTVADGQKLIEYY  806

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
               L    T    +++AEN+R++P+F       +++G + +  V +   M+  + ++ ++W
Sbjct  807   RGLGGKAT----FSIAENFRYKPSFDYAAAEASKLGKLQHFSVRVFFYMSEDSQWYGTAW  862

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGC  552
             R    F GGF+LD GVH+ A  R L+      V+A T+     L P D ++A+ +L++G 
Sbjct  863   RAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDVTAFTTQTQPHLAPIDTVNAVIRLKSGV  922

Query  551   SGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGV  372
             SG +     S+    V++     G++ V+ G+K      +V+ +  +  +K F     GV
Sbjct  923   SGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK-----VTVTPWDDEPVVKEFERT-SGV  975

Query  371   QEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVKKF*A  192
              EE++ +   ++       E K + R S  E   D+  LE M ESG   G   Q KK+  
Sbjct  976   TEEVEAWAKALA-------EGKPDKRQSVEEALADLEFLELMFESGLNGG---QAKKYEC  1025

Query  191   FCTIGTT  171
              C    T
Sbjct  1026  RCPNNVT  1032



>emb|CCX08562.1| Similar to Putative uracil phosphoribosyltransferase urg2; acc. 
no. Q9US43 [Pyronema omphalodes CBS 100304]
Length=603

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 135/245 (55%), Gaps = 10/245 (4%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRL--AEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGG  1080
             IA+LG+GIF + Q++P L   EI   F L AI+SR+  SA++         P     +  
Sbjct  8     IALLGTGIFAQQQHLPALLSPEIQARFKLLAIYSRTLISAQNLA----QKVPYSVDVYSD  63

Query  1079  AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNS  900
               L E++    I  V + +    Q  +    L+  KHVL EKP A  + EA N L  Y+S
Sbjct  64    ETLLELLGRDDIKAVIICLPIPAQPRVIENCLRHKKHVLSEKPIAPSLDEARNLLKTYHS  123

Query  899   LSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmns-snpyfssSWR  723
             +    +++ IW VAENYR++  +   ++ +  +G ++   V +E  +    N Y  ++WR
Sbjct  124   VIPG-SERGIWGVAENYRYQKWWETAREEVKGLGKVLGFSVRMETLVEQGVNKYLETTWR  182

Query  722   R--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
             +     GGF+LD GVH+ AGLR+++G E+ +VSA+T+   + LPP D ++A+ + E+G  
Sbjct  183   KEPTHQGGFLLDGGVHFTAGLRLMLGEEIKTVSALTALTREYLPPVDTVNAVLKTESGVV  242

Query  548   GVFAM  534
             G F +
Sbjct  243   GTFCV  247



>ref|XP_002183307.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45007.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=416

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/263 (27%), Positives = 115/263 (44%), Gaps = 49/263 (19%)
 Frame = -2

Query  872  IWAVAENYRFEPAFTECKKMIA--------------------EIGDMMNVQVIIEGsmns  753
            +W+VAEN+R+EP      + +A                     IG  +   + I      
Sbjct  165  VWSVAENFRYEPGIVATSRAVATSVPTDADSSSSSSSSVPTHTIGTPLLASLQIRAPFLP  224

Query  752  snpyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNIS  579
             N + ++ WR+N  ++GG  +D  VH+ AGLR ++G EV +VSA+TS     LP  D ++
Sbjct  225  DNQFLNTPWRKNASWYGGLFIDSFVHHAAGLRAVLG-EVETVSAVTSDRADYLPGVDTLA  283

Query  578  ALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGN--------------KDGKH  441
            A     +G  GV ++  + R  +  + + G  GT+ +ER                  G  
Sbjct  284  AQLTWSSGVQGVVSVTYAGRDLQYEFGITGTTGTVSLERAGLGHRLTVVSSSHTASTGTD  343

Query  440  GYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGE--PRLSFVEGTRD  267
               V+         +  Y F GV+EE   F           G C+G+   R +  E  RD
Sbjct  344  REKVATTDNTSTTTTTEYGFTGVEEEFLAF----------AGACRGQGSDRNTPREALRD  393

Query  266  IAVLEAMLESGKREGALVQVKKF  198
            +A++E +L SG++ G  + V K+
Sbjct  394  LALVETLLASGQQNGRPLPVPKY  416



>ref|XP_007350429.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD41563.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
Length=379

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 118/373 (32%), Positives = 180/373 (48%), Gaps = 47/373 (13%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHF---PNVECKWG  1083
             IA+LG+G+F K  ++P +A +     L A++SRS+ SA S  ELA +       V     
Sbjct  6     IAVLGAGLFAKEAHLPAIAALGDKVKLAAVYSRSQSSAASLAELASSVLKLDAPVAVYHD  65

Query  1082  G---AGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
             G   A L+ ++    I  VAVV+    Q ++ L+ L+ GKHVL EKP A  +A     + 
Sbjct  66    GDPQANLDALLARPDIDAVAVVLPIAQQPDVILKSLEAGKHVLSEKPVAKDVASGIELIK  125

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMI--AEIG--DMMNVQVIIEGsmnssnp  744
              YN+      +  IW VAENY  EPAF    K I   +IG   M N+  I   +++ ++ 
Sbjct  126   TYNAKYKG--KGLIWRVAENYELEPAFHAAAKAIRDGKIGKLSMFNLSAI--NALDETSK  181

Query  743   yfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALF  570
             ++ + WR    + GGF+LD GVH  A LR ++   + S+S   +   K L P D I+A+ 
Sbjct  182   WYKTPWRTVPEYQGGFLLDGGVHSAAALRTVLPDALVSLSGHATLTKKYLAPQDTINAVV  241

Query  569   QLENGCSGVFAMVVSSRSP---KIVWRVVGLNGTLEVERGNK--DGKHGYSVSLYM----  417
             +   G  G+F +  ++  P   K +    G NG +E+   N   +GK G SVS       
Sbjct  242   RTAGGAVGIFELSFAAPFPTRAKGLTTYTGTNGWIEIATHNAVINGK-GQSVSRVTIHSV  300

Query  416   -------GDGQ------IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEG  276
                     DG       ++    P CGV++E ++F+  +   N  G    G P    +  
Sbjct  301   KEKGTTDKDGNKEYEEVVEVVEEPLCGVRKEFESFVEHLK-GNDDG---YGTP----LGA  352

Query  275   TRDIAVLEAMLES  237
              RD+A +EA L S
Sbjct  353   LRDVAFIEAALTS  365



>ref|XP_002479070.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
stipitatus ATCC 10500]
 gb|EED22107.1| oxidoreductase family, NAD-binding Rossmann fold protein [Talaromyces 
stipitatus ATCC 10500]
Length=354

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 93/349 (27%), Positives = 166/349 (48%), Gaps = 20/349 (6%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-HFPNVECKWGGA  1077
             +A++G GI+ K +++P +   S+   LKAI+SRS +SA       ++    ++  +    
Sbjct  5     VALIGGGIWAKEEHLPAIL-ASKDLELKAIYSRSLKSANDVAGEVKDTQKIDLYSEDSSQ  63

Query  1076  GLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSL  897
                +I+K   I  V + +    Q     R L   KHVL EKP +  + +    +  YN +
Sbjct  64    TFGDILKRDDIQAVVISLPIANQGTFIKRALLAKKHVLSEKPVSENVQDGVVLISWYNGV  123

Query  896   STNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSWRR-  720
                      W+VAEN+R+  +F   ++ I E+G ++  +V +  ++     ++ +SWR+ 
Sbjct  124   KEEF-DNVTWSVAENFRYLESFKYARQQIEELGKIIGFRVRVYANITEDFKFYHTSWRKE  182

Query  719   -NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLENGCS  549
                 GG+ILD GVH+ AGLR+L+G +  V  V+A T+ + + LPP D + A+ +   G  
Sbjct  183   PTHQGGYILDGGVHFTAGLRLLLGSDVFVERVAAFTTSLKEHLPPVDTVDAILKTNTGIQ  242

Query  548   GVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQ  369
             G F   V++      W +   NG++ V           +V    G+  +K       GV 
Sbjct  243   GTFQSSVATTLTGPEWTIACENGSVTVSSSTV------TVLSVDGEEVVKEIPNERSGVP  296

Query  368   EELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
              E++ +   ++         +  P  +  EG  D+ ++E ML SG  +G
Sbjct  297   PEVRAWGEALAAG-------RQNPEQTPEEGLADLELIELMLRSGNHDG  338



>gb|KGB78824.1| hypothetical protein CNBG_4662 [Cryptococcus gattii R265]
 gb|KIR76041.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus gattii 
CA1014]
Length=358

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 110/366 (30%), Positives = 172/366 (47%), Gaps = 28/366 (8%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKW---G  1083
             +A+LG GIF    ++P LA++  L  LKA+WSRSE S+  A E  ++       ++   G
Sbjct  5     VALLGGGIFAVDAHLPALAKLGTLASLKAVWSRSESSSTKAAEAWKSLTGQQVTRYSEDG  64

Query  1082  GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYN  903
                LE ++    I  V + +   +Q  +  R L+ GKHVL EKP A  +A A   L  Y 
Sbjct  65    SDDLENLLSRKDIDAVIIALPILSQANVIARALQAGKHVLSEKPVAKDVATAAKMLQDYQ  124

Query  902   SLSTNMTQKPIWAVAENYRFEPA--FTECKKMIAEIGDMMNVQVI-IEGsmnssnpyfss  732
                    Q  +W VAEN+  EPA  F         IG++    +  +    N +N YF +
Sbjct  125   E--NFQAQGLVWRVAENWEVEPAHIFAAQALKAGRIGNLNTFSISSVLFVDNENNKYFET  182

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE-  561
              WR+     GG++LD GVH    LR ++   +T VSA T+  ++ LPP D +S + + E 
Sbjct  183   EWRKKPQHQGGYLLDAGVHNAGVLRTVLPSPITHVSAHTALNNEHLPPYDWLSVITRSEP  242

Query  560   NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DGQI  402
             +   G   +   +R  + VW  R+ G +G +  E  N +G     V +  G     + ++
Sbjct  243   SNIHGQMLIDYGARGREPVWELRLTGSDGEIYSEDVNDNGVDSIKVQVRSGKFGRTNTEV  302

Query  401   KSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
             K F  P  GV EE + F   I+    + G  +G           D+A+++  L S   E 
Sbjct  303   KIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALIQVALTSNGNEV  352

Query  221   ALVQVK  204
             A+  +K
Sbjct  353   AINTMK  358



>ref|XP_007324396.1| hypothetical protein SERLADRAFT_364213 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN93362.1| hypothetical protein SERLA73DRAFT_97769 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO18743.1| hypothetical protein SERLADRAFT_364213 [Serpula lacrymans var. 
lacrymans S7.9]
Length=376

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 108/392 (28%), Positives = 189/392 (48%), Gaps = 49/392 (13%)
 Frame = -2

Query  1277  MAESQLPQIAILGSGIFVKTQYIPRLAEI-SQLFVLKAIWsrseesarsavelaRNHF--  1107
             M+  +    A+LG+GI+ K  ++P L  I +  F LKA++SR+E S+++           
Sbjct  1     MSTRKTSGFAMLGAGIYAKEAHVPALVSIGAAAFPLKAVYSRTESSSQALAREVALKLEV  60

Query  1106  -PNV-ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaacia  933
              P+V         L+ ++  + I  V +V+    Q ++ L+    GKHVL  KP A  ++
Sbjct  61    VPDVYHDNDPTKNLDSLLSRSDITAVNIVLPITLQPDIILKCFAAGKHVLSAKPIAPDVS  120

Query  932   eaenALMHYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGDMMNVQVIIE  768
             E+   +  Y +       KP   +W +AEN+  EP +    ++I +  IG ++   V   
Sbjct  121   ESMRLIKIYET-----QYKPKGLVWRIAENFESEPGYITAGQIIRDGKIGKVIFFHVRAV  175

Query  767   GsmnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPP  594
               M+  N ++ + WR   ++ GGF+LD GVH  A LR+++  ++T +S+  S   K LPP
Sbjct  176   NYMDKGNRWYKTPWRTIPDYQGGFLLDGGVHSTAALRVMLPGKMTHLSSFASLNKKYLPP  235

Query  593   PDNISALFQLENGCSGVFAMVVS------SRSPKIVWRVVGLNGTLEVERGNKDGKHG--  438
              D I+A+ ++++G  G+F M  +      S+  +I+  + G +G L VE+    G  G  
Sbjct  236   HDTINAIVKVDDGSHGIFEMSFAAPATSLSQGNRII--ITGTDGWLSVEQAKVLGTQGGI  293

Query  437   ----YSVSLYM--------GDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPR  294
                   ++L M        G  + +    P  GV+ EL +F + ++     G    G P 
Sbjct  294   EIPVLRINLRMVTKVNDKPGPERTEIIDEPVKGVEAELGSFFAAVAGTRDDG---LGSP-  349

Query  293   LSFVEGTRDIAVLEAMLESGKREGALVQVKKF  198
                V    D+A ++A L S   EG LV+++  
Sbjct  350   ---VGALEDVAFIQAALNS---EGCLVELQNM  375



>gb|KIW21209.1| hypothetical protein PV08_01789 [Exophiala spinifera]
Length=340

 Score = 88.2 bits (217),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 175/359 (49%), Gaps = 36/359 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AILG GIF + ++ P + E ++   LKA++SRS +SA++            +    G  
Sbjct  5     VAILGGGIFAREEHKPAV-EAAKDLTLKAVYSRSAKSAKTLEVDESKVDIYSDDSGAGKS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
             L++++  + I  + + +  + Q E   + L  GKHVL EKP A  + +A   +  Y S  
Sbjct  64    LDDLLSRSDIGALIIALPIKNQPEYIRKALLAGKHVLSEKPVAENVQDAVELIKWYRS--  121

Query  893   TNMTQKPI-WAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssS  729
               +  K + W VAEN R+  +F    + +   G  +     +Q +++G            
Sbjct  122   -EIAPKGVTWGVAENVRYTNSFLHAAEAVKPKGRQLTFRCRMQTMVQGGKYFETS-----  175

Query  728   WRR--NFFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLE  561
             WR+     GGF+LD GVH+ A LR+++G +  + S+SA ++ + + LPP D + A+ + +
Sbjct  176   WRKVPTHQGGFLLDGGVHFTAALRLMLGKDNPLVSISAHSALLQEHLPPVDTVEAIAKSK  235

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G  G  ++   + +    W V   NG + + R NK       V++   D ++       
Sbjct  236   KGAVGTISISFGTTAKGSEWTVAAENGFVSISR-NK-------VTI---DDKVDEIEDER  284

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
              GV  E++ +    +LA  K  E +     S  E   D+ ++EAML SG++ GA V+++
Sbjct  285   TGVPPEVRAWGE--ALAAGKANEQQ-----SPEEALADLELVEAMLRSGEQGGAPVKLQ  336



>emb|CCT69021.1| related to dehydrogenases and related proteins [Fusarium fujikuroi 
IMI 58289]
Length=322

 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 132/265 (50%), Gaps = 23/265 (9%)
 Frame = -2

Query  986  LKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIA  807
            L  GKHVL EKP A  +A+ +  + +Y  L    T    +++AEN+R++P+F       +
Sbjct  75   LAAGKHVLAEKPLAPTVADGKKLIEYYRGLGGKAT----FSIAENFRYKPSFDYAAAEAS  130

Query  806  EIGDMMNVQVIIEGsmnssnpyfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCEVTSV  633
            ++G + +  V +   M+  + ++ ++WR    F GGF+LD GVH+ A  R L+      V
Sbjct  131  KLGKLQHFSVRVFFYMSEDSQWYGTAWRAKPEFQGGFLLDGGVHFSAATRQLLTDPAVDV  190

Query  632  SAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNK  453
            +A T+     L P D ++A+ +L+ G SG +     S+    V++     G++ V+ G+K
Sbjct  191  TAFTTQTQPHLAPIDTVNAVIRLKGGVSGTYQQSCGSKMSTSVFQFGYEKGSVVVD-GDK  249

Query  452  DGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGT  273
                  +V  + G+  +K F     GV EE++ +   ++       E K + R S  E  
Sbjct  250  -----VTVKPWDGEPAVKEFERT-SGVTEEVEAWAKALA-------EGKPDKRQSVEEAL  296

Query  272  RDIAVLEAMLESGKREGALVQVKKF  198
             D+  LE M ESG   G   Q KK+
Sbjct  297  ADLEFLELMFESGLNGG---QAKKY  318



>ref|XP_007674297.1| hypothetical protein BAUCODRAFT_22896 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC98052.1| hypothetical protein BAUCODRAFT_22896 [Baudoinia compniacensis 
UAMH 10762]
Length=353

 Score = 88.2 bits (217),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 107/366 (29%), Positives = 173/366 (47%), Gaps = 37/366 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +A++GSGIFVK +++P +     L  LKAI+SRS +SA+   E   N   ++        
Sbjct  7     VALIGSGIFVKEEHLPAVQACEHL-ELKAIYSRSLKSAKGVSEGLAN--VDLYSDDSERS  63

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
              +E++    +  V + +    Q +   + L  GKHV  EKP A  +A     L  Y+   
Sbjct  64    YKELLSRDDVQSVIIALPIPVQPDFIKQALSAGKHVFAEKPLAKDVASGLELLKWYHD--  121

Query  893   TNMTQKPIW----------AVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnp  744
              N+  K +            VAE +R+  +F    +     G ++  +V +  S+     
Sbjct  122   -NIDTKKVTFADFLTHGSSGVAEQWRYYNSFLFGAEKARSFGKVIGCRVKVSASIQPGMK  180

Query  743   yfssSWRRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISA  576
             Y  + WR+   + GGF+LD GVH++AG+R+L+G E  V   S  T+ +   L P D + A
Sbjct  181   YLETEWRKKPEYQGGFLLDGGVHFMAGMRLLLGEEAKVVKASGFTTQLQPYLLPIDTVDA  240

Query  575   LFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKS  396
             +F+L NG +G F+    +      W V   NG++ V         G  V++   DG  + 
Sbjct  241   VFKLANGSTGNFSASFGTTFKGGEWSVACENGSVTV--------SGQKVTINPKDGDEEV  292

Query  395   FFYPF--CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
                P    GV++E+  F    SL +      K EPR    +   D+ VLEAML SG++ G
Sbjct  293   VEKPDEQGGVKQEV--FAWAESLVS-----GKQEPRQLPEQALADLEVLEAMLTSGEKGG  345

Query  221   ALVQVK  204
               +++K
Sbjct  346   QPIELK  351



>ref|XP_006962588.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR51025.1| predicted protein, partial [Trichoderma reesei QM6a]
Length=325

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 121/260 (47%), Gaps = 18/260 (7%)
 Frame = -2

Query  992  RLLKGGKHVLQekpaaaciaeaenALMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKM  813
            R L  GKHVL EKP A  +A A   +  Y  L    ++  I+ +AE +RF   F   ++ 
Sbjct  75   RCLAAGKHVLCEKPIAKDVATARELIEDYKKLYA--SKGLIFNIAEQFRFMHEFERGREW  132

Query  812  IAE---IGDMMNVQVIIEGsmnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGC  648
            + +   IGD+    + I         ++ + WR+   + GGF+LD GVH  A LR + G 
Sbjct  133  VVDEQAIGDITQAHLRIWRHQPPEGKWYETPWRKVPEYQGGFLLDGGVHQTAMLRFISGQ  192

Query  647  EVTSVSAMTSHVDKTLPPPDNISALFQLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEV  468
            EV   +     V   LPP D ++A   L  G +G  +M  +S        ++G  G+  +
Sbjct  193  EVVETAGFARQVLPHLPPLDTLNAGILLSGGGTGTISMSFASIRRATELTIIGSKGSFSL  252

Query  467  ERGNKDGKHGYSVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLS  288
                 DG  G ++SL +  G+ +S      GV+ E+K FL  I     K G  K E R  
Sbjct  253  ----TDGPDGSTLSLDLATGERRSETIRSKGVELEIKAFLEAI-----KAG--KSEKRAG  301

Query  287  FVEGTRDIAVLEAMLESGKR  228
              E   D+A++E+M   G +
Sbjct  302  PEEALNDLAIIESMCSGGGK  321



>ref|XP_001227364.1| hypothetical protein CHGG_09437 [Chaetomium globosum CBS 148.51]
 gb|EAQ85423.1| hypothetical protein CHGG_09437 [Chaetomium globosum CBS 148.51]
Length=714

 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 105/364 (29%), Positives = 174/364 (48%), Gaps = 38/364 (10%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN------HFPNVEC  1092
             IA+LG+GIF + +++P + E +    LKA++SRS+ SA +    +++      +F N   
Sbjct  4     IALLGAGIFAREEHLPAI-EATPYLTLKAVYSRSQHSAETLAAASKDPSSVAIYFDNPTV  62

Query  1091  KWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALM  912
                G  L ++++   I  V V +    Q  +  + L+ GKHVL EKP A  I   +  + 
Sbjct  63    P--GKSLADLLQRADIGAVDVALPILQQPAVVEQALRAGKHVLSEKPVAGDIEGGKALIA  120

Query  911   HYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfs  735
              Y  L      KP+W VAEN+R+  +     + + E+G +++  ++   GS+ + N YF+
Sbjct  121   KYEGLGEG---KPLWGVAENWRYMESLRYAAERVREVGGELVTFKLHKYGSVKADNKYFN  177

Query  734   sSWRRN--FFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISALF  570
             ++WR+   + GGF+LD GVH+VAGLR L+   G E+  +   +  +D+ L P D + A+ 
Sbjct  178   TAWRKTPEYQGGFLLDGGVHFVAGLRFLLEAAGQEIKQLVGFSGLLDEKLIPVDTVQAVA  237

Query  569   QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYS---VSLYMGDGQIK  399
                N  SG   +   +                EVE     G   ++   V      G+ K
Sbjct  238   LTGNRKSGTIIITFGTE----------FKSGTEVEVVTTKGAVSWNPVEVKTVTSKGEEK  287

Query  398   SFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  219
               F    GV EE+  F   I+       +       S  E  +D+ +L+ +LESG  EGA
Sbjct  288   KEFPSSNGVTEEVAAFGEAINAGQINNLQ-------SPQEALKDLEILQRLLESGAGEGA  340

Query  218   LVQV  207
             +  V
Sbjct  341   VKSV  344



>ref|XP_003660926.1| oxidoreductase-like protein [Myceliophthora thermophila ATCC 
42464]
 gb|AEO55681.1| oxidoreductase-like protein [Myceliophthora thermophila ATCC 
42464]
Length=354

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 112/367 (31%), Positives = 190/367 (52%), Gaps = 40/367 (11%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN------HF--PNV  1098
             IA+LG+GIF + +++P + E +    LKA++SRS++SA +    +R+      +F  P V
Sbjct  5     IALLGAGIFAREEHLPAI-EAAPSLTLKAVYSRSQKSAEALAAASRDPSSVAVYFDSPAV  63

Query  1097  ECKWGGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenA  918
             E    G  L+++++   +  V+VV+    Q  +  + ++ GKHVL EKP A+ +A+A   
Sbjct  64    E----GRSLDDLLRRDDVAAVSVVLPILQQPAVVEKAIRAGKHVLSEKPVASTVADAVRL  119

Query  917   LMHYNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpy  741
             +  Y SL+    + P+W VAEN+R+  +     + + EIG +++  ++ + GS+   N Y
Sbjct  120   IGWYESLAD---RPPLWGVAENWRYLESLRYAAQRVREIGGELVAFRLQMYGSIKPDNKY  176

Query  740   fssSWRR--NFFGGFILDMGVHYVAGLRMLV---GCEVTSVSAMTSHVDKTLPPPDNISA  576
             F++ WR+     GGF+LD GVH+VAGLR L+   G EV  ++  ++ ++K L P D + A
Sbjct  177   FNTEWRKVPQHQGGFLLDGGVHFVAGLRFLLAAAGQEVKKLAGFSALLNKALIPVDTVHA  236

Query  575   LFQLENGCSGV----FAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDG  408
                   G SG     F M   S +   +    G+      E     GK   S     GD 
Sbjct  237   AAVTGGGQSGTIVISFGMQFKSGTEVEIVTTKGVVSWSPTEVRTVAGKGDGS-----GDK  291

Query  407   QIKSFFYPF-CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGK  231
               +   +P+  GV +E+  F   ++       +    PR    E  +D+ +L+A+LESG 
Sbjct  292   VEERKEFPYSSGVTKEVAAFADGLAAGKLDAFQS---PR----EALKDLEILQALLESGD  344

Query  230   REGALVQ  210
               GA+V+
Sbjct  345   -GGAIVK  350



>gb|ERS96910.1| hypothetical protein HMPREF1624_06237 [Sporothrix schenckii ATCC 
58251]
 gb|KJR86096.1| hypothetical protein SPSK_02598 [Sporothrix schenckii 1099-18]
Length=351

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 103/377 (27%), Positives = 180/377 (48%), Gaps = 56/377 (15%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWG---  1083
             +A+LG+GIF K +++P + E ++   L A++SRS+ SA +    A  H P  +  +    
Sbjct  4     VALLGAGIFAKEEHLPAV-EAAESLTLGAVYSRSKVSAEALAAAA-THGPKPDVYYDSPA  61

Query  1082  --GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMH  909
               G  L +++    I  V V +    Q  +  + L  GKHVL EKP A  +A A+  +  
Sbjct  62    TTGKSLTDLLARADIGAVIVCLPILVQPAVIRQALAAGKHVLSEKPIAKDVAAAKALIAS  121

Query  908   YNSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIG-DMMNVQVIIEGsmnssnpyfss  732
             ++  +      P+WAVAEN+RF          + ++G ++    + +   +   + +F++
Sbjct  122   HSKATL-----PLWAVAENFRFLEVIQYAAARVGQMGGEVTTFHMTMNTLIGDDDKFFNT  176

Query  731   SWRR--NFFGGFILDMGVHYVAGLRMLVGC-----EVTSVSAMTSHVDKTLPPPDNISAL  573
              WR+   + GGF+LD GVH++AGLR L+G      ++  VSA T+ +   L P D + ++
Sbjct  177   EWRKVPGYQGGFLLDGGVHFIAGLRHLLGATAAKHDIAKVSAFTTLLQPKLAPVDTVQSI  236

Query  572   FQLENGCSGVFAM-------------VVSSRSPKIVWRVVGLNGTLEVERGN-KDGKHGY  435
                + G  G F +             VV+++    +      +  +E   GN K+ K  +
Sbjct  237   LATDKGAIGTFCVSFGTEFKSAFEIEVVTTKGAVTLTPTAVTSTWVEAAGGNKKEDKKEF  296

Query  434   SVSLYMGDGQIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVL  255
             S S                GV+ E+  F + ++    KG     +PR S  E  +D+A+L
Sbjct  297   SFS---------------SGVKPEVVAFGASLA----KGAV---DPRQSAEEALKDLAIL  334

Query  254   EAMLESGKREGALVQVK  204
             EA+L S  + GA + V+
Sbjct  335   EALLTSADQGGAPLAVE  351



>ref|XP_007911759.1| putative oxidoreductase nad-binding rossmann fold protein [Togninia 
minima UCRPA7]
 gb|EOO03539.1| putative oxidoreductase nad-binding rossmann fold protein [Togninia 
minima UCRPA7]
Length=358

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 167/353 (47%), Gaps = 26/353 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             IA++G GIF+K Q++P +   + L  LKAI+SRS +SA+S ++L       V+     +G
Sbjct  7     IALVGGGIFIKEQHLPAVL-ATPLLSLKAIYSRSLKSAQSTLDLVPKEHSPVDLYSDDSG  65

Query  1073  LEEIIKDtsiigvav----vvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
               +  KD             +  + Q E     L  GKHV  EKP       A+  +  Y
Sbjct  66    AGKSYKDLLTREDIYGVIIALPIKNQPEFIEAALLAGKHVFAEKPVGPTAEAAKKQIDWY  125

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGsmnssnpyfssSW  726
             +S++    ++  WA+AE  RF P F        ++G ++     +   +   N Y ++ W
Sbjct  126   HSIADE--KRVTWAIAEQVRFVPKFAWAAAEARKLGKVIGFHFKVFFHIGLDNKYLATEW  183

Query  725   RRNFFG--GFILDMGVHYVAGLRMLVGCEVT-SVSAMTSHVDKTLPPPDNISALFQLENG  555
             R++     GFILD GVH++A  R+L+G +   SV A +S     LPP D +S + + ++G
Sbjct  184   RKSPTHPYGFILDGGVHWIASARLLLGDDTPQSVIAYSSLAQDYLPPVDTVSGVIKTKSG  243

Query  554   CSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC-  378
               G F     +      + V   NG++ +E     G  G+   +   DG+ +     F  
Sbjct  244   AIGTFNASCGTTLSSNEYSVACENGSVTIE-----GDKGW---IRYKDGRKEERELEFVG  295

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGA  219
             GV+EE+  +      A T G   K  P  +  E  +D+ +LEAML+SG   GA
Sbjct  296   GVKEEIAAWAE----ALTSG---KPNPLQTPEEALKDLELLEAMLKSGDANGA  341



>gb|KIM99483.1| hypothetical protein OIDMADRAFT_89802, partial [Oidiodendron 
maius Zn]
Length=339

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 102/353 (29%), Positives = 167/353 (47%), Gaps = 24/353 (7%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRN-HFPNVEC---KW  1086
             IAILG+GIF   +++P LA       LKAI+SRS+ +A   +  A+N  + + +      
Sbjct  2     IAILGAGIFATEEHLPALAAAKA--NLKAIYSRSKATASILLTEAKNLGYADADLYSEDT  59

Query  1085  GGAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
              G  L++++K   I  V +V+    Q ++  R L  GKHVL EKP A  +  A   +  Y
Sbjct  60    SGRTLDDLLKRVDIDAVVIVLPILVQPDVIRRCLTAGKHVLSEKPVAQDVHTARLLIDDY  119

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAE---IGDMMNVQVIIEGsmnssnpyfs  735
                    ++  I+++AE +RF   F   +K + E   IGD+  + + +  +      Y+ 
Sbjct  120   RK--HYASKGIIFSIAEQFRFMTEFELGRKWVVEEKAIGDITQLHLKLWRNQPPGGKYYE  177

Query  734   sSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQLE  561
             + WRR   + GGF+LD GVH+ A +R + G EV         V   LPP D I+A   L 
Sbjct  178   TPWRRVPGYQGGFLLDGGVHHAAMVRYVSGQEVVETHGYARQVAAHLPPLDTINAGILLS  237

Query  560   NGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPF  381
              G +G  +M  +S      + ++G  G+  +     DG +G+ + L    G+ +      
Sbjct  238   GGGTGTISMSFASTKRATEFTIIGTQGSFFL----TDGPNGFILKLSQLSGETREETIKS  293

Query  380   CGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREG  222
              GVQ E+  FL  +          K + R    E   D+A++E++   G + G
Sbjct  294   NGVQLEIDAFLEAVKTG-------KAQSRSGPEEAMNDLAIIESLCSGGGKVG  339



>ref|XP_012048661.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus neoformans 
var. grubii H99]
 gb|AFR94284.1| NAD-binding Rossmann fold oxidoreductase [Cryptococcus neoformans 
var. grubii H99]
Length=358

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 109/368 (30%), Positives = 171/368 (46%), Gaps = 30/368 (8%)
 Frame = -2

Query  1256  QIAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGA  1077
              +A+LG GIF    ++P LA+   L  L+A+WSRSE S+  A E  ++       K+   
Sbjct  4     NVALLGGGIFAVDAHLPALAKSGALASLEAVWSRSESSSTKAAEAWKSLTGKEIAKYSET  63

Query  1076  G---LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHY  906
             G   L++++    I  V + +   +Q E+  + LK GKHVL EKP +  +  A   L  Y
Sbjct  64    GYDNLDKLLSREDIGAVIIALPILSQPEIITKALKAGKHVLSEKPVSQDVTSATKMLKDY  123

Query  905   NSLSTNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMNVQVIIEGs----mnssnpyf  738
                     Q  +W VAEN+  EPA     + + + G + N+      S        N YF
Sbjct  124   QK--NYQPQGLVWRVAENWEVEPAHIFAAEAL-KAGRIGNLNAFSTSSVLFVDKEDNKYF  180

Query  737   ssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMTSHVDKTLPPPDNISALFQL  564
              + WR+     GG++LD GVH    LR ++   +T +SA T+  ++ LPP D +S + + 
Sbjct  181   ETEWRKRPQHQGGYLLDAGVHNAGVLRTVLPSPITHLSAHTALNNEHLPPYDWLSVITRS  240

Query  563   E-NGCSGVFAMVVSSRSPKIVW--RVVGLNGTLEVERGNKDGKHGYSVSLYMG-----DG  408
             E N   G   +   +R  + +W  R+ G  G +  E  + +G     V +  G     + 
Sbjct  241   EPNNIHGQILIDYGARGREPMWELRLTGSEGEIYSEDIDDNGVDSIRVQVRSGKFGRTNR  300

Query  407   QIKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKR  228
             +IK F  P  GV EE + F   I+    + G  +G           D+A+L+A L S   
Sbjct  301   EIKIF--PKTGVYEEQRRFFEAIAGKPDEYGSVQG--------ALNDVALLQAALTSNGN  350

Query  227   EGALVQVK  204
             E AL  +K
Sbjct  351   EVALNTLK  358



>gb|KIL66602.1| hypothetical protein M378DRAFT_74962 [Amanita muscaria Koide 
BX008]
Length=377

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 118/389 (30%), Positives = 179/389 (46%), Gaps = 56/389 (14%)
 Frame = -2

Query  1268  SQLPQI--AILGSGIFVKTQYIPRLAEISQLFV------LKAIWsrseesarsavelaRN  1113
             S  PQI  AILG+GIF    +IP    IS  FV      LKA++SRSE+SA+     A  
Sbjct  2     SSSPQIGLAILGAGIFATEAWIP---AISAAFVQHPHYHLKAVYSRSEKSAQELSSKATQ  58

Query  1112  HF-------PNVECKWG--GAGLEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQ  960
                      P V    G     L+ ++  + I  V VV+    Q ++ L++L  GKHVL 
Sbjct  59    ALKPRLAPSPTVYHDSGDESCNLDALLARSDIQAVIVVLPITLQPKIILKVLGAGKHVLS  118

Query  959   ekpaaaciaeaenALMHYNSLSTNMTQKP---IWAVAENYRFEPAFTECKKMIAE--IGD  795
             EKP AA + +    +  YN        KP   IW VAEN+  EP + +  +++ E  IGD
Sbjct  119   EKPVAADVKQGIELIRAYND-----KYKPRGLIWKVAENFEAEPGYRKAAELVREGRIGD  173

Query  794   MMNVQVIIEGsmnssnpyfssSWRR--NFFGGFILDMGVHYVAGLRMLVGCEVTSVSAMT  621
             ++  + +IE  +   + Y+ + WR   ++ GGF+LD GVH  A +R+++   +T +S+  
Sbjct  174   LIQFKAVIEAHVTQESKYYKTPWRTVPDYQGGFLLDGGVHAAAVIRIVLPSAITHISSFA  233

Query  620   SHVDKTLPPPDNISALF----QLENGCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNK  453
             S   + L P D+  A+     Q+    S  FA    S +    +   G  G L + +G +
Sbjct  234   SLNKEYLAPHDSFHAIVKAGPQIHGTASFTFAWPTKSAASSEDFIFTGTKGWLSITKGTE  293

Query  452   DGKHGYSVSLYMGDGQ------IKSFFYPFCGVQEELKTFLSDISLANTKGGECKGEPRL  291
               K G  + +     +       +     F GV  EL  FL        K  E K E  L
Sbjct  294   --KRGVKLKIVTRKSENSDEETEEVIEEAFNGVTAELVNFL--------KAVEGKDELGL  343

Query  290   SFVEGT-RDIAVLEAMLESGKREGALVQV  207
                 G  +D+A +EA L S    GA++ +
Sbjct  344   GDPAGALKDVAFIEAALNS---NGAVINI  369



>gb|KIW33724.1| hypothetical protein PV07_00552 [Cladophialophora immunda]
Length=339

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 100/358 (28%), Positives = 174/358 (49%), Gaps = 34/358 (9%)
 Frame = -2

Query  1253  IAILGSGIFVKTQYIPRLAEISQLFVLKAIWsrseesarsavelaRNHFPNVECKWGGAG  1074
             +AILG GIF + ++ P + E S+   LKA++SRS +SA++            +    G  
Sbjct  4     VAILGGGIFAREEHKPAV-EASKDLTLKAVYSRSLKSAKTLEVDESKVDLYSDDSGAGKS  62

Query  1073  LEEIIKDtsiigvavvvagqtqVEMSLRLLKGGKHVLQekpaaaciaeaenALMHYNSLS  894
             L++++  + I  V V +  + Q +   ++L  GKHVL EKP A  + EA   +  Y+S  
Sbjct  63    LDDLLARSDIQAVIVALPIKNQPDYIRKVLLAGKHVLSEKPVAENVKEAAELIKWYHS--  120

Query  893   TNMTQKPIWAVAENYRFEPAFTECKKMIAEIGDMMN----VQVIIEGsmnssnpyfssSW  726
                 +K  WAVAEN R+  +F    +++   G  +     +Q ++EG            W
Sbjct  121   EIEPKKVTWAVAENVRYTNSFIRAAEVVKTKGRQLTFRCRLQTLVEGGKYFETE-----W  175

Query  725   RRN--FFGGFILDMGVHYVAGLRMLVGCE--VTSVSAMTSHVDKTLPPPDNISALFQLEN  558
             R++    GGF+LD GVH+ AGLR+++G +  + S+SA ++ + + LPP D + A  + + 
Sbjct  176   RKSPTHQGGFLLDGGVHFTAGLRLMMGKDNPLVSLSAHSAQLQEHLPPVDTVEATAKSKK  235

Query  557   GCSGVFAMVVSSRSPKIVWRVVGLNGTLEVERGNKDGKHGYSVSLYMGDGQIKSFFYPFC  378
             G  G  ++   +      W V    G++ +  GNK             D + +       
Sbjct  236   GSVGTISISFGTTHKGSEWAVGCEKGSVSLS-GNK----------VTYDEKTEEVQDERT  284

Query  377   GVQEELKTFLSDISLANTKGGECKGEPRLSFVEGTRDIAVLEAMLESGKREGALVQVK  204
             GV  E++ +    +LA  K  E +     S  E   D+ ++EAML SG++ G  ++++
Sbjct  285   GVPGEVRAWGE--ALAAGKVNESQ-----SPEEALADLELIEAMLRSGEQGGVPIKLE  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4061725961934