BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12207

Length=723
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        387   1e-127   Nicotiana sylvestris
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        382   2e-125   Nicotiana tomentosiformis
ref|XP_012083473.1|  PREDICTED: probable methyltransferase PMT15 ...    378   3e-124   Jatropha curcas
ref|XP_012083474.1|  PREDICTED: probable methyltransferase PMT15 ...    378   4e-124   
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        378   4e-124   Sesamum indicum [beniseed]
ref|XP_002511797.1|  ATP binding protein, putative                      370   5e-121   Ricinus communis
ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...    369   1e-120   Solanum tuberosum [potatoes]
gb|KGN56550.1|  hypothetical protein Csa_3G123720                       360   5e-120   Cucumis sativus [cucumbers]
ref|XP_004229839.1|  PREDICTED: probable methyltransferase PMT15        366   2e-119   Solanum lycopersicum
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   365   3e-119   Citrus sinensis [apfelsine]
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             365   4e-119   Citrus clementina [clementine]
gb|KHN29409.1|  Putative methyltransferase PMT15                        357   1e-118   Glycine soja [wild soybean]
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  364   1e-118   Medicago truncatula
ref|XP_007139953.1|  hypothetical protein PHAVU_008G072500g             355   2e-118   Phaseolus vulgaris [French bean]
emb|CDP08881.1|  unnamed protein product                                362   7e-118   Coffea canephora [robusta coffee]
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        362   1e-117   Cucumis melo [Oriental melon]
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        360   3e-117   Prunus mume [ume]
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15        360   5e-117   Pyrus x bretschneideri [bai li]
ref|XP_010255519.1|  PREDICTED: probable methyltransferase PMT15 ...    353   5e-117   Nelumbo nucifera [Indian lotus]
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg             359   8e-117   Prunus persica
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             359   9e-117   
ref|XP_011650766.1|  PREDICTED: probable methyltransferase PMT16        359   1e-116   Cucumis sativus [cucumbers]
ref|XP_007051920.1|  S-adenosyl-L-methionine-dependent methyltran...    358   2e-116   
ref|XP_003533625.1|  PREDICTED: probable methyltransferase PMT15-...    357   4e-116   Glycine max [soybeans]
ref|XP_007139952.1|  hypothetical protein PHAVU_008G072400g             358   4e-116   Phaseolus vulgaris [French bean]
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...    356   1e-115   Populus euphratica
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...    356   1e-115   Populus euphratica
ref|XP_004510859.1|  PREDICTED: probable methyltransferase PMT15-...    356   2e-115   Cicer arietinum [garbanzo]
ref|XP_008383220.1|  PREDICTED: probable methyltransferase PMT15        353   7e-115   
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15        353   1e-114   
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    353   2e-114   Nelumbo nucifera [Indian lotus]
ref|XP_010662513.1|  PREDICTED: probable methyltransferase PMT15 ...    345   2e-114   
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15        352   5e-114   
ref|XP_002301329.1|  dehydration-responsive family protein              350   2e-113   Populus trichocarpa [western balsam poplar]
gb|KHG11272.1|  hypothetical protein F383_13094                         342   3e-113   Gossypium arboreum [tree cotton]
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        350   4e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011023413.1|  PREDICTED: probable methyltransferase PMT15        348   1e-112   Populus euphratica
ref|XP_004492680.1|  PREDICTED: probable methyltransferase PMT15-...    358   3e-112   
ref|XP_009609846.1|  PREDICTED: probable methyltransferase PMT15        348   4e-112   Nicotiana tomentosiformis
gb|KJB41226.1|  hypothetical protein B456_007G095700                    347   4e-112   Gossypium raimondii
ref|XP_004306838.1|  PREDICTED: probable methyltransferase PMT15        347   4e-112   Fragaria vesca subsp. vesca
ref|XP_003551650.1|  PREDICTED: probable methyltransferase PMT16-...    345   5e-112   Glycine max [soybeans]
ref|XP_008375906.1|  PREDICTED: probable methyltransferase PMT15        347   6e-112   
gb|KJB09867.1|  hypothetical protein B456_001G171500                    346   7e-112   Gossypium raimondii
ref|XP_004309222.1|  PREDICTED: probable methyltransferase PMT16        347   8e-112   Fragaria vesca subsp. vesca
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    346   2e-111   Vitis vinifera
gb|KHN04623.1|  Putative methyltransferase PMT15                        339   3e-111   Glycine soja [wild soybean]
ref|XP_010540274.1|  PREDICTED: probable methyltransferase PMT15        345   3e-111   Tarenaya hassleriana [spider flower]
gb|KHG14191.1|  hypothetical protein F383_16741                         344   5e-111   Gossypium arboreum [tree cotton]
ref|XP_006287263.1|  hypothetical protein CARUB_v10000453mg             344   8e-111   Capsella rubella
ref|XP_008377156.1|  PREDICTED: probable methyltransferase PMT16        343   2e-110   Malus domestica [apple tree]
emb|CDY01971.1|  BnaC02g27560D                                          335   3e-110   
ref|XP_010053660.1|  PREDICTED: probable methyltransferase PMT15        343   3e-110   Eucalyptus grandis [rose gum]
gb|KHM99141.1|  Putative methyltransferase PMT15                        335   3e-110   Glycine soja [wild soybean]
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        342   4e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    342   5e-110   
ref|XP_006396270.1|  hypothetical protein EUTSA_v10028512mg             342   6e-110   Eutrema salsugineum [saltwater cress]
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        342   1e-109   Sesamum indicum [beniseed]
ref|XP_009794887.1|  PREDICTED: probable methyltransferase PMT15        342   1e-109   Nicotiana sylvestris
ref|XP_010419631.1|  PREDICTED: probable methyltransferase PMT15        340   2e-109   Camelina sativa [gold-of-pleasure]
ref|NP_191984.1|  putative methyltransferase PMT15                      340   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523726.1|  PREDICTED: probable methyltransferase PMT16        342   2e-109   Tarenaya hassleriana [spider flower]
ref|XP_008234471.1|  PREDICTED: probable methyltransferase PMT16        339   3e-109   
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        340   3e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010427380.1|  PREDICTED: probable methyltransferase PMT15        340   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_007134966.1|  hypothetical protein PHAVU_010G090800g             340   3e-109   Phaseolus vulgaris [French bean]
ref|XP_003528883.1|  PREDICTED: probable methyltransferase PMT15-...    340   4e-109   Glycine max [soybeans]
ref|XP_010456248.1|  PREDICTED: probable methyltransferase PMT15        340   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010693482.1|  PREDICTED: probable methyltransferase PMT15        339   4e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002875017.1|  dehydration-responsive family protein              339   5e-109   
gb|KEH18956.1|  methyltransferase                                       339   6e-109   Medicago truncatula
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        339   9e-109   Nicotiana tomentosiformis
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        338   2e-108   Nicotiana sylvestris
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...    336   2e-108   
ref|XP_011041603.1|  PREDICTED: probable methyltransferase PMT16        337   6e-108   Populus euphratica
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        336   8e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010091548.1|  putative methyltransferase PMT15                   337   8e-108   Morus notabilis
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        336   9e-108   Elaeis guineensis
ref|XP_009128495.1|  PREDICTED: probable methyltransferase PMT15        336   2e-107   
ref|XP_003533217.1|  PREDICTED: probable methyltransferase PMT16-...    335   2e-107   Glycine max [soybeans]
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             336   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    335   2e-107   Nicotiana sylvestris
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        335   3e-107   
gb|ACN78962.1|  methyltransferase                                       338   3e-107   Glycine max [soybeans]
ref|XP_007220207.1|  hypothetical protein PRUPE_ppa002720mg             335   3e-107   Prunus persica
ref|XP_002510829.1|  ATP binding protein, putative                      335   4e-107   Ricinus communis
gb|KCW46397.1|  hypothetical protein EUGRSUZ_K00230                     333   4e-107   Eucalyptus grandis [rose gum]
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        334   5e-107   Eucalyptus grandis [rose gum]
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    333   7e-107   Glycine max [soybeans]
ref|XP_010919241.1|  PREDICTED: probable methyltransferase PMT15        333   9e-107   Elaeis guineensis
ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        333   1e-106   Solanum lycopersicum
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    333   3e-106   Solanum tuberosum [potatoes]
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...    332   3e-106   Setaria italica
gb|KFK37364.1|  hypothetical protein AALP_AA4G247100                    332   3e-106   Arabis alpina [alpine rockcress]
ref|XP_006421866.1|  hypothetical protein CICLE_v10004550mg             331   5e-106   Citrus clementina [clementine]
ref|XP_002321888.2|  hypothetical protein POPTR_0015s13580g             332   5e-106   
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15        332   5e-106   Populus euphratica
ref|NP_001053603.1|  Os04g0570800                                       332   5e-106   
ref|XP_006857883.1|  PREDICTED: probable methyltransferase PMT16        331   7e-106   Amborella trichopoda
ref|XP_007152322.1|  hypothetical protein PHAVU_004G120000g             331   7e-106   Phaseolus vulgaris [French bean]
ref|XP_006490342.1|  PREDICTED: probable methyltransferase PMT15-...    331   8e-106   Citrus sinensis [apfelsine]
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        331   8e-106   Sesamum indicum [beniseed]
gb|KEH17379.1|  methyltransferase PMT16, putative                       331   9e-106   Medicago truncatula
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    331   9e-106   Nicotiana sylvestris
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...    330   1e-105   Zea mays [maize]
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119              331   2e-105   
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                330   2e-105   Erythranthe guttata [common monkey flower]
gb|EPS68701.1|  hypothetical protein M569_06064                         330   2e-105   Genlisea aurea
emb|CDP05238.1|  unnamed protein product                                330   4e-105   Coffea canephora [robusta coffee]
ref|XP_010506552.1|  PREDICTED: probable methyltransferase PMT16        328   5e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006397756.1|  hypothetical protein EUTSA_v10001358mg             328   6e-105   Eutrema salsugineum [saltwater cress]
emb|CDY18904.1|  BnaC04g04460D                                          328   6e-105   Brassica napus [oilseed rape]
gb|KHN15675.1|  Putative methyltransferase PMT16                        322   7e-105   Glycine soja [wild soybean]
ref|XP_009142361.1|  PREDICTED: probable methyltransferase PMT16        328   8e-105   Brassica rapa
ref|XP_008663475.1|  PREDICTED: probable methyltransferase PMT15        328   9e-105   Zea mays [maize]
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15        328   9e-105   Phoenix dactylifera
ref|NP_001056669.2|  Os06g0128100                                       314   1e-104   
emb|CDY37061.1|  BnaA04g26390D                                          327   1e-104   Brassica napus [oilseed rape]
ref|XP_010055225.1|  PREDICTED: probable methyltransferase PMT15 ...    328   2e-104   Eucalyptus grandis [rose gum]
ref|XP_012090301.1|  PREDICTED: probable methyltransferase PMT16        328   2e-104   Jatropha curcas
gb|ABV72578.1|  dehydration-responsive family protein S51               327   3e-104   Brassica rapa
gb|EYU25067.1|  hypothetical protein MIMGU_mgv1a004954mg                323   3e-104   Erythranthe guttata [common monkey flower]
ref|XP_009143165.1|  PREDICTED: probable methyltransferase PMT16        327   3e-104   Brassica rapa
emb|CDX74761.1|  BnaA05g05070D                                          327   3e-104   
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    327   3e-104   Cicer arietinum [garbanzo]
dbj|BAJ87212.1|  predicted protein                                      327   4e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ84848.1|  predicted protein                                      326   4e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010518192.1|  PREDICTED: probable methyltransferase PMT16        326   5e-104   Camelina sativa [gold-of-pleasure]
ref|NP_182099.1|  putative methyltransferase PMT16                      326   6e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365768.1|  PREDICTED: probable methyltransferase PMT15-...    326   8e-104   Solanum tuberosum [potatoes]
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15        326   8e-104   Nicotiana tomentosiformis
ref|XP_010559094.1|  PREDICTED: probable methyltransferase PMT16        325   1e-103   Tarenaya hassleriana [spider flower]
ref|XP_010508116.1|  PREDICTED: probable methyltransferase PMT16        325   1e-103   Camelina sativa [gold-of-pleasure]
gb|ACN28194.1|  unknown                                                 311   2e-103   Zea mays [maize]
ref|XP_002269747.2|  PREDICTED: probable methyltransferase PMT15        324   3e-103   Vitis vinifera
dbj|BAJ95401.1|  predicted protein                                      323   5e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        323   6e-103   Phoenix dactylifera
ref|XP_006293834.1|  hypothetical protein CARUB_v10022818mg             323   6e-103   Capsella rubella
ref|XP_008439398.1|  PREDICTED: probable methyltransferase PMT15        322   7e-103   Cucumis melo [Oriental melon]
ref|XP_004228448.2|  PREDICTED: probable methyltransferase PMT15        323   7e-103   
ref|XP_010061323.1|  PREDICTED: probable methyltransferase PMT16        322   7e-103   Eucalyptus grandis [rose gum]
ref|XP_003555372.1|  PREDICTED: probable methyltransferase PMT16-...    322   9e-103   Glycine max [soybeans]
ref|XP_006340522.1|  PREDICTED: probable methyltransferase PMT15-...    323   9e-103   Solanum tuberosum [potatoes]
ref|XP_004140852.1|  PREDICTED: probable methyltransferase PMT15        322   2e-102   Cucumis sativus [cucumbers]
ref|XP_004240739.1|  PREDICTED: probable methyltransferase PMT15 ...    322   2e-102   Solanum lycopersicum
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  322   3e-102   Medicago truncatula
emb|CDY27362.1|  BnaC04g50430D                                          330   3e-102   Brassica napus [oilseed rape]
ref|XP_006648932.1|  PREDICTED: probable methyltransferase PMT15-...    320   5e-102   
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15        320   8e-102   
ref|XP_002880195.1|  dehydration-responsive family protein              320   1e-101   
ref|NP_001047721.1|  Os02g0675700                                       320   2e-101   
ref|XP_010321993.1|  PREDICTED: probable methyltransferase PMT15 ...    320   2e-101   
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15        320   2e-101   Brachypodium distachyon [annual false brome]
ref|XP_006656589.1|  PREDICTED: probable methyltransferase PMT15-...    317   3e-101   
gb|EEC73773.1|  hypothetical protein OsI_08448                          319   4e-101   Oryza sativa Indica Group [Indian rice]
ref|NP_001141030.1|  uncharacterized protein LOC100273109               309   1e-100   Zea mays [maize]
ref|XP_003570093.1|  PREDICTED: probable methyltransferase PMT15        317   2e-100   Brachypodium distachyon [annual false brome]
gb|AFW72783.1|  hypothetical protein ZEAMMB73_970285                    309   3e-100   
gb|EAZ35683.1|  hypothetical protein OsJ_19971                          316   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    316   3e-100   Cicer arietinum [garbanzo]
dbj|BAJ98046.1|  predicted protein                                      317   3e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAC24840.1|  dehydration-responsive protein-like                    314   1e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010692380.1|  PREDICTED: probable methyltransferase PMT15        314   2e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002452759.1|  hypothetical protein SORBIDRAFT_04g032010          314   5e-99    Sorghum bicolor [broomcorn]
emb|CDM86771.1|  unnamed protein product                                313   6e-99    Triticum aestivum [Canadian hard winter wheat]
gb|ACF85761.1|  unknown                                                 298   3e-98    Zea mays [maize]
ref|XP_008800812.1|  PREDICTED: probable methyltransferase PMT15        318   3e-98    
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g             306   2e-96    Phaseolus vulgaris [French bean]
gb|KDO82912.1|  hypothetical protein CISIN_1g0105922mg                  295   2e-95    Citrus sinensis [apfelsine]
ref|NP_001266897.1|  hypothetical protein                               296   2e-95    
gb|ABR16934.1|  unknown                                                 303   3e-95    Picea sitchensis
ref|XP_001778231.1|  predicted protein                                  300   3e-94    
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                  295   2e-93    Citrus sinensis [apfelsine]
gb|KJB18847.1|  hypothetical protein B456_003G072700                    291   3e-93    Gossypium raimondii
ref|XP_001779831.1|  predicted protein                                  297   1e-92    
ref|XP_008677769.1|  PREDICTED: hypothetical protein isoform X1         297   1e-92    
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             295   3e-92    Citrus clementina [clementine]
ref|XP_012067633.1|  PREDICTED: probable methyltransferase PMT2 i...    295   3e-92    Jatropha curcas
ref|XP_010110847.1|  putative methyltransferase PMT18                   282   4e-92    
ref|XP_010933740.1|  PREDICTED: probable methyltransferase PMT17        295   4e-92    Elaeis guineensis
gb|EEE61530.1|  hypothetical protein OsJ_15834                          292   5e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18        295   5e-92    Cucumis sativus [cucumbers]
gb|KHG10506.1|  hypothetical protein F383_11349                         294   8e-92    Gossypium arboreum [tree cotton]
gb|KJB60757.1|  hypothetical protein B456_009G324300                    294   9e-92    Gossypium raimondii
emb|CDP12267.1|  unnamed protein product                                294   2e-91    Coffea canephora [robusta coffee]
gb|KJB18849.1|  hypothetical protein B456_003G072700                    291   2e-91    Gossypium raimondii
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         293   2e-91    Elaeis guineensis
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    293   2e-91    
ref|XP_011624208.1|  PREDICTED: probable methyltransferase PMT17 ...    293   3e-91    Amborella trichopoda
ref|XP_006846537.2|  PREDICTED: probable methyltransferase PMT17 ...    293   3e-91    Amborella trichopoda
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        292   3e-91    Tarenaya hassleriana [spider flower]
gb|KHN06856.1|  Putative methyltransferase PMT2                         280   3e-91    Glycine soja [wild soybean]
ref|XP_004953430.1|  PREDICTED: probable methyltransferase PMT16-...    293   4e-91    Setaria italica
gb|ACF86888.1|  unknown                                                 280   5e-91    Zea mays [maize]
ref|XP_001782639.1|  predicted protein                                  292   9e-91    
gb|KHG23981.1|  hypothetical protein F383_09020                         291   9e-91    Gossypium arboreum [tree cotton]
gb|KJB18848.1|  hypothetical protein B456_003G072700                    291   1e-90    Gossypium raimondii
gb|KDO43766.1|  hypothetical protein CISIN_1g026623mg                   279   1e-90    Citrus sinensis [apfelsine]
ref|XP_012067632.1|  PREDICTED: probable methyltransferase PMT2 i...    291   1e-90    Jatropha curcas
ref|XP_010056104.1|  PREDICTED: probable methyltransferase PMT18        291   2e-90    Eucalyptus grandis [rose gum]
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        291   2e-90    Cucumis melo [Oriental melon]
ref|XP_008660000.1|  PREDICTED: probable methyltransferase PMT2 i...    283   2e-90    Zea mays [maize]
gb|KJB18860.1|  hypothetical protein B456_003G072700                    292   2e-90    Gossypium raimondii
ref|XP_012089660.1|  PREDICTED: probable methyltransferase PMT14        290   2e-90    Jatropha curcas
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         290   2e-90    
ref|NP_001170352.1|  uncharacterized protein LOC100384329               276   3e-90    
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    290   4e-90    
gb|KHG13750.1|  hypothetical protein F383_08462                         290   5e-90    Gossypium arboreum [tree cotton]
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    289   6e-90    Phoenix dactylifera
gb|EPS64080.1|  hypothetical protein M569_10695                         289   7e-90    Genlisea aurea
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         289   9e-90    Tarenaya hassleriana [spider flower]
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         289   9e-90    Eucalyptus grandis [rose gum]
gb|ABK94953.1|  unknown                                                 283   1e-89    Populus trichocarpa [western balsam poplar]
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        288   1e-89    Elaeis guineensis
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18        288   2e-89    Pyrus x bretschneideri [bai li]
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    289   2e-89    Phoenix dactylifera
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        288   2e-89    Phoenix dactylifera
emb|CBI31965.3|  unnamed protein product                                285   2e-89    Vitis vinifera
ref|XP_002528760.1|  ATP binding protein, putative                      288   2e-89    Ricinus communis
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         288   2e-89    Phoenix dactylifera
gb|EMS59423.1|  putative methyltransferase PMT2                         289   2e-89    Triticum urartu
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18        288   3e-89    Pyrus x bretschneideri [bai li]
ref|XP_001760613.1|  predicted protein                                  288   4e-89    
gb|ACN26954.1|  unknown                                                 278   5e-89    Zea mays [maize]
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         287   5e-89    Tarenaya hassleriana [spider flower]
ref|XP_002522425.1|  ATP binding protein, putative                      286   5e-89    
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    286   6e-89    
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         286   6e-89    Nelumbo nucifera [Indian lotus]
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        287   6e-89    
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                286   8e-89    Erythranthe guttata [common monkey flower]
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        286   8e-89    Populus euphratica
emb|CBI33946.3|  unnamed protein product                                283   8e-89    Vitis vinifera
ref|XP_003628359.1|  hypothetical protein MTR_8g055840                  280   1e-88    
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         286   1e-88    Vitis vinifera
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             286   1e-88    Phaseolus vulgaris [French bean]
gb|KJB80180.1|  hypothetical protein B456_013G084900                    286   2e-88    Gossypium raimondii
ref|XP_002298987.1|  dehydration-responsive family protein              283   2e-88    
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         285   2e-88    Nicotiana tomentosiformis
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        286   2e-88    Sesamum indicum [beniseed]
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        286   2e-88    Nelumbo nucifera [Indian lotus]
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   286   2e-88    Citrus sinensis [apfelsine]
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             285   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         285   2e-88    Nicotiana sylvestris
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    285   3e-88    Citrus sinensis [apfelsine]
ref|XP_010089758.1|  putative methyltransferase PMT2                    285   3e-88    Morus notabilis
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         285   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    285   3e-88    
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        285   4e-88    Solanum lycopersicum
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18        285   4e-88    Malus domestica [apple tree]
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         284   6e-88    Nelumbo nucifera [Indian lotus]
ref|NP_001065036.1|  Os10g0510400                                       285   6e-88    
ref|XP_010441570.1|  PREDICTED: probable methyltransferase PMT14        278   6e-88    
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18        285   6e-88    Pyrus x bretschneideri [bai li]
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         284   6e-88    Nicotiana sylvestris
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         284   8e-88    Cucumis melo [Oriental melon]
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        283   8e-88    Vitis vinifera
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         283   1e-87    Brassica rapa
gb|EEC67295.1|  hypothetical protein OsI_34283                          284   1e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_009397639.1|  PREDICTED: probable methyltransferase PMT17        284   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         283   1e-87    Brassica rapa
gb|EPS61626.1|  hypothetical protein M569_13168                         277   1e-87    Genlisea aurea
ref|XP_004979626.1|  PREDICTED: probable methyltransferase PMT2-like    283   1e-87    Setaria italica
emb|CDY70748.1|  BnaCnng69650D                                          278   1e-87    Brassica napus [oilseed rape]
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             283   1e-87    
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18        283   2e-87    
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18        283   2e-87    
ref|XP_006827213.1|  PREDICTED: probable methyltransferase PMT2         283   2e-87    
gb|AAX94055.2|  dehydration-induced protein                             283   2e-87    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    282   2e-87    Cicer arietinum [garbanzo]
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2         283   2e-87    Cucumis sativus [cucumbers]
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    283   2e-87    Solanum tuberosum [potatoes]
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             283   2e-87    
ref|XP_003628358.1|  hypothetical protein MTR_8g055840                  280   3e-87    
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         282   3e-87    Solanum lycopersicum
ref|XP_002893375.1|  dehydration-responsive family protein              282   3e-87    
ref|XP_012086578.1|  PREDICTED: probable methyltransferase PMT18 ...    283   3e-87    
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         282   3e-87    Brassica rapa
ref|XP_012086580.1|  PREDICTED: probable methyltransferase PMT18 ...    282   3e-87    Jatropha curcas
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             282   4e-87    Prunus persica
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         281   4e-87    
ref|XP_012086579.1|  PREDICTED: probable methyltransferase PMT18 ...    283   4e-87    
dbj|BAK03905.1|  predicted protein                                      284   4e-87    
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        282   4e-87    
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        282   4e-87    
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                281   4e-87    
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        283   5e-87    
gb|EMS63414.1|  putative methyltransferase PMT2                         279   5e-87    
gb|EEC68449.1|  hypothetical protein OsI_36659                          281   5e-87    
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         281   5e-87    
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        282   5e-87    
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             281   5e-87    
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         281   5e-87    
gb|KHN21029.1|  Putative methyltransferase PMT14                        280   6e-87    
gb|KHG27439.1|  hypothetical protein F383_15139                         282   6e-87    
ref|NP_564265.1|  putative methyltransferase PMT2                       281   6e-87    
dbj|BAH19504.1|  AT1G26850                                              281   7e-87    
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    281   7e-87    
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg             281   8e-87    
dbj|BAH20410.1|  AT4G18030                                              275   9e-87    
ref|XP_008373610.1|  PREDICTED: probable methyltransferase PMT14        272   9e-87    
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    282   9e-87    
ref|XP_002518966.1|  ATP binding protein, putative                      281   9e-87    
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             281   1e-86    
gb|EEE52366.1|  hypothetical protein OsJ_34430                          281   1e-86    
ref|XP_002317647.1|  dehydration-responsive family protein              281   1e-86    
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         280   1e-86    
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    280   1e-86    
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         280   1e-86    
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    280   1e-86    
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14        280   2e-86    
gb|ACJ85858.1|  unknown                                                 280   2e-86    
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  280   2e-86    
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         280   2e-86    
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg                280   2e-86    
gb|KHN16709.1|  Putative methyltransferase PMT18                        280   2e-86    
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    280   2e-86    
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        280   2e-86    
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        280   2e-86    
emb|CDX78823.1|  BnaA01g08900D                                          280   2e-86    
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         280   2e-86    
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18        280   2e-86    
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14        280   2e-86    
ref|NP_001068227.1|  Os11g0601600                                       281   3e-86    
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         280   3e-86    
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg             280   3e-86    
gb|KJB51709.1|  hypothetical protein B456_008G228900                    280   3e-86    
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         280   3e-86    
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    280   3e-86    
ref|XP_010542268.1|  PREDICTED: probable methyltransferase PMT17 ...    280   3e-86    
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         280   3e-86    
ref|XP_010542260.1|  PREDICTED: probable methyltransferase PMT17 ...    280   4e-86    
ref|XP_003530522.1|  PREDICTED: probable methyltransferase PMT18-...    280   4e-86    
gb|EMT05545.1|  hypothetical protein F775_20122                         279   4e-86    
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          279   4e-86    
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    279   4e-86    
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        280   4e-86    
ref|NP_001152470.1|  ankyrin protein kinase-like                        279   5e-86    
ref|XP_010542252.1|  PREDICTED: probable methyltransferase PMT17 ...    280   5e-86    
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    279   5e-86    
ref|XP_010542245.1|  PREDICTED: probable methyltransferase PMT17 ...    280   5e-86    
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2         279   6e-86    
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    279   6e-86    
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2         279   6e-86    
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         279   6e-86    
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             279   6e-86    
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    278   6e-86    
ref|NP_001152056.1|  methyltransferase                                  279   7e-86    
tpg|DAA42264.1|  TPA: methyltransferase isoform 1                       279   7e-86    
gb|KHN01216.1|  Putative methyltransferase PMT2                         275   8e-86    
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    278   9e-86    
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    278   9e-86    
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14        278   1e-85    
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         278   1e-85    
ref|XP_010542237.1|  PREDICTED: probable methyltransferase PMT17 ...    281   1e-85    
ref|XP_008668148.1|  PREDICTED: methyltransferase isoform X1            279   1e-85    
ref|XP_010542228.1|  PREDICTED: probable methyltransferase PMT17 ...    280   1e-85    
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             278   1e-85    
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...    278   1e-85    
gb|KHM99867.1|  Putative methyltransferase PMT18                        276   1e-85    
ref|NP_001280936.1|  uncharacterized protein LOC103402903               278   1e-85    
gb|EMT22301.1|  hypothetical protein F775_16518                         278   1e-85    
gb|ABO93008.1|  putative methyltransferase                              275   1e-85    
gb|EMT27426.1|  hypothetical protein F775_29617                         278   1e-85    
emb|CDP00327.1|  unnamed protein product                                278   1e-85    
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         278   2e-85    
emb|CBI15236.3|  unnamed protein product                                275   2e-85    
gb|EMS54302.1|  putative methyltransferase PMT17                        278   2e-85    
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    277   2e-85    
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         278   2e-85    
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg             278   2e-85    
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g             278   2e-85    
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         277   2e-85    
gb|EMS49438.1|  putative methyltransferase PMT2                         277   3e-85    
ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...    277   3e-85    
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17        277   3e-85    
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    277   3e-85    
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  277   3e-85    
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         277   3e-85    
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         277   3e-85    
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14        277   4e-85    
gb|ABR25450.1|  ankyrin protein kinase-like                             266   4e-85    
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18        277   4e-85    
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    276   4e-85    
gb|KEH21299.1|  methyltransferase PMT16, putative                       277   5e-85    
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    276   5e-85    
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2         276   5e-85    
gb|KHN17371.1|  Putative methyltransferase PMT2                         276   5e-85    
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         276   5e-85    
gb|EAZ09099.1|  hypothetical protein OsI_31366                          276   6e-85    
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    276   6e-85    
gb|KJB24074.1|  hypothetical protein B456_004G127200                    276   6e-85    
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    276   7e-85    
ref|NP_193537.2|  putative methyltransferase PMT14                      276   7e-85    
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         276   7e-85    
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        276   7e-85    
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    276   8e-85    
emb|CDX93797.1|  BnaA09g23970D                                          272   9e-85    
emb|CAA17146.1|  putative protein                                       276   9e-85    
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340          276   9e-85    
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    276   9e-85    
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    276   9e-85    
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    275   1e-84    
emb|CDX85977.1|  BnaC06g21570D                                          272   1e-84    
ref|XP_003525323.1|  PREDICTED: probable methyltransferase PMT18-...    276   1e-84    
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    275   1e-84    
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         275   1e-84    
ref|XP_010529687.1|  PREDICTED: probable methyltransferase PMT18 ...    276   1e-84    
ref|NP_001050233.1|  Os03g0379100                                       275   1e-84    
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    275   1e-84    
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    275   1e-84    
ref|XP_010529685.1|  PREDICTED: probable methyltransferase PMT18 ...    276   1e-84    
ref|XP_006398351.1|  hypothetical protein EUTSA_v10000856mg             273   1e-84    
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    275   2e-84    
ref|XP_002511570.1|  ATP binding protein, putative                      275   2e-84    
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    275   2e-84    
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          275   2e-84    
ref|NP_001063174.1|  Os09g0415700                                       275   2e-84    
ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         275   2e-84    
gb|EEC79826.1|  hypothetical protein OsI_21282                          275   2e-84    
ref|NP_001056546.2|  Os06g0103900                                       275   2e-84    
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    275   2e-84    
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         275   2e-84    
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2         275   3e-84    
gb|ABO92980.1|  putative methyltransferase                              275   3e-84    
ref|XP_002868016.1|  dehydration-responsive family protein              275   3e-84    
emb|CAH18000.1|  Ankyrin protein kinase-like                            275   3e-84    
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    274   3e-84    
emb|CDY50730.1|  BnaC05g50930D                                          271   3e-84    
emb|CDX99539.1|  BnaC09g24530D                                          275   4e-84    
ref|XP_011075499.1|  PREDICTED: probable methyltransferase PMT2         274   4e-84    
ref|XP_010110495.1|  putative methyltransferase PMT14                   274   4e-84    
ref|XP_006663417.1|  PREDICTED: probable methyltransferase PMT2-like    263   5e-84    
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18        275   5e-84    
emb|CDY44966.1|  BnaA08g06660D                                          274   5e-84    
dbj|BAH19630.1|  AT4G18030                                              274   5e-84    
emb|CDY46435.1|  BnaA08g19950D                                          273   6e-84    
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    274   6e-84    
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    273   7e-84    
gb|KHN12213.1|  Putative methyltransferase PMT2                         273   7e-84    
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14        273   8e-84    
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18        274   9e-84    
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...    273   1e-83    
emb|CDX84046.1|  BnaC08g07230D                                          273   1e-83    
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        273   1e-83    
ref|XP_009373685.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    266   1e-83    
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...    273   1e-83    
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg             273   1e-83    
emb|CDY45006.1|  BnaCnng12360D                                          272   1e-83    
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...    273   1e-83    
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    273   2e-83    
emb|CDY16198.1|  BnaA09g29320D                                          272   2e-83    
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18        273   2e-83    
ref|XP_009398109.1|  PREDICTED: probable methyltransferase PMT18        272   3e-83    
gb|EMS59429.1|  putative methyltransferase PMT17                        271   3e-83    
emb|CDY40268.1|  BnaA07g09320D                                          271   4e-83    
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    272   4e-83    
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...    272   4e-83    
ref|XP_003557272.1|  PREDICTED: probable methyltransferase PMT17        272   4e-83    
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...    272   5e-83    
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        271   5e-83    
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        271   6e-83    
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         271   8e-83    
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             270   8e-83    
ref|XP_010091504.1|  putative methyltransferase PMT2                    270   1e-82    
ref|NP_001148962.1|  ankyrin protein kinase-like                        271   1e-82    
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14        270   1e-82    
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18        271   2e-82    
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        269   3e-82    
gb|ABR16582.1|  unknown                                                 270   3e-82    
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             269   3e-82    
emb|CDY03207.1|  BnaC09g19490D                                          269   4e-82    
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14        269   4e-82    
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14        268   5e-82    
ref|XP_008393149.1|  PREDICTED: probable methyltransferase PMT2         268   5e-82    
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...    268   6e-82    
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        268   6e-82    
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g             268   6e-82    
ref|XP_006578576.1|  PREDICTED: probable methyltransferase PMT2-l...    261   7e-82    
ref|XP_004499422.1|  PREDICTED: probable methyltransferase PMT2-l...    265   8e-82    
emb|CDP12957.1|  unnamed protein product                                268   1e-81    
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         268   1e-81    
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    268   1e-81    
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         268   1e-81    
ref|XP_010478718.1|  PREDICTED: probable methyltransferase PMT18        268   1e-81    
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    267   1e-81    
ref|XP_007160205.1|  hypothetical protein PHAVU_002G301800g             268   1e-81    
gb|EPS59468.1|  hypothetical protein M569_15338                         267   2e-81    
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    267   2e-81    
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         267   2e-81    
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             267   2e-81    
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        267   2e-81    
gb|EMT25092.1|  hypothetical protein F775_32772                         261   2e-81    
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         266   3e-81    
emb|CDP12320.1|  unnamed protein product                                274   3e-81    
ref|XP_012080258.1|  PREDICTED: probable methyltransferase PMT2 i...    266   3e-81    
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             268   3e-81    
ref|XP_002874627.1|  dehydration-responsive family protein              267   4e-81    
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        266   4e-81    
ref|XP_012080255.1|  PREDICTED: probable methyltransferase PMT2 i...    266   4e-81    
emb|CDX94256.1|  BnaC02g29160D                                          266   4e-81    



>ref|XP_009804054.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=636

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 180/222 (81%), Positives = 206/222 (93%), Gaps = 3/222 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN+++IAGG LANWPERLTAVPPRI+SGS++G+TAE FS+DTELWKKRVAHYK +DFQL
Sbjct  415  VSNVRDIAGGPLANWPERLTAVPPRIASGSIEGVTAEGFSKDTELWKKRVAHYKALDFQL  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRNILDMNA LGGFAAALVDDPVWVMNVVPVEA+VNTLGV+YERGLIGTY +WCE
Sbjct  475  AERGRYRNILDMNAWLGGFAAALVDDPVWVMNVVPVEAEVNTLGVIYERGLIGTYQSWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY+DRCE+EDILLEMDRILRPQGSV+ RDDVD++V+VKSI 
Sbjct  535  AMSTYPRTYDFIHADSVFSLYQDRCEMEDILLEMDRILRPQGSVIFRDDVDVLVNVKSII  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGS  67
            DGLQWD+RM DHE  PHVREK+LIA KQYWTA   DQ+++ S
Sbjct  595  DGLQWDSRMVDHEGGPHVREKLLIATKQYWTAPAPDQDKQLS  636



>ref|XP_009629797.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=636

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/222 (79%), Positives = 203/222 (91%), Gaps = 3/222 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI++ AGG LANWPERLTAVPPRI++G+++G+TAE FS+DTELWKKRVAHYK +DFQL
Sbjct  415  VSNIRDFAGGPLANWPERLTAVPPRIATGNIEGVTAEGFSKDTELWKKRVAHYKALDFQL  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRNILDMNA LGGFAAALVDDPVWVMNV+PVEA+VNTLGV+YERGLIGTY +WCE
Sbjct  475  AECGRYRNILDMNAWLGGFAAALVDDPVWVMNVIPVEAEVNTLGVIYERGLIGTYQSWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY+DRCE+EDILLEMDRILRPQGSV+ RDDVD++V+VKSI 
Sbjct  535  AMSTYPRTYDFIHADSVFSLYQDRCEMEDILLEMDRILRPQGSVIFRDDVDVLVNVKSIV  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGS  67
            DGLQWD+RM DHE  PHVREK+LIA KQYWT    DQ+++ S
Sbjct  595  DGLQWDSRMVDHEGGPHVREKLLIATKQYWTTPAPDQDKQPS  636



>ref|XP_012083473.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Jatropha 
curcas]
 gb|KDP28686.1| hypothetical protein JCGZ_14457 [Jatropha curcas]
Length=628

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 204/226 (90%), Gaps = 3/226 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI++IAGGEL  WPERLTA+PPRIS+GS++GITAE F+++TELWKKR+AHY+ +D+QL
Sbjct  403  VSNIRDIAGGELPKWPERLTAIPPRISNGSLEGITAEIFTKNTELWKKRIAHYRTIDYQL  462

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AEKGRYRN+LDMNA LGGFAAALVDDPVWVMNVVPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  463  AEKGRYRNLLDMNAYLGGFAAALVDDPVWVMNVVPVEAEVNTLGAIYERGLIGTYQNWCE  522

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD IF+LYKDRCE+EDILLEMDRILRP+GSV+IRDDVDI++ VK IA
Sbjct  523  AMSTYPRTYDFIHADSIFSLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDILLQVKKIA  582

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSNASS  55
            + +QW+ R+ADHE SPH REKIL A K+YWTA   +QNQ  SN SS
Sbjct  583  EVMQWNARIADHERSPHEREKILFAVKEYWTAPDPEQNQGESNKSS  628



>ref|XP_012083474.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Jatropha 
curcas]
Length=627

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 204/226 (90%), Gaps = 3/226 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI++IAGGEL  WPERLTA+PPRIS+GS++GITAE F+++TELWKKR+AHY+ +D+QL
Sbjct  402  VSNIRDIAGGELPKWPERLTAIPPRISNGSLEGITAEIFTKNTELWKKRIAHYRTIDYQL  461

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AEKGRYRN+LDMNA LGGFAAALVDDPVWVMNVVPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  462  AEKGRYRNLLDMNAYLGGFAAALVDDPVWVMNVVPVEAEVNTLGAIYERGLIGTYQNWCE  521

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD IF+LYKDRCE+EDILLEMDRILRP+GSV+IRDDVDI++ VK IA
Sbjct  522  AMSTYPRTYDFIHADSIFSLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDILLQVKKIA  581

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSNASS  55
            + +QW+ R+ADHE SPH REKIL A K+YWTA   +QNQ  SN SS
Sbjct  582  EVMQWNARIADHERSPHEREKILFAVKEYWTAPDPEQNQGESNKSS  627



>ref|XP_011091674.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=645

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 202/226 (89%), Gaps = 3/226 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE++GGELA WPERLT VPPRI +GSV G+T E F ++TE+WK+RVAHYK +DFQL
Sbjct  420  VSDVKEVSGGELAKWPERLTVVPPRILAGSVKGVTEESFVKNTEIWKERVAHYKSIDFQL  479

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAAALV+DPVW+MNVVPVEA+VNTLGV+YERGLIGTY +WCE
Sbjct  480  AEPGRYRNLLDMNAGLGGFAAALVNDPVWIMNVVPVEAEVNTLGVIYERGLIGTYQSWCE  539

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD IFTLYKDRCEIEDILLEMDRILRPQGSV+IRDDVD++V+VKSI 
Sbjct  540  AMSTYPRTYDFIHADSIFTLYKDRCEIEDILLEMDRILRPQGSVIIRDDVDVLVNVKSIV  599

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSNASS  55
            DGL W++RM DHE  PHVREK+LIA KQYWTA   DQ+Q+ S  +S
Sbjct  600  DGLAWESRMTDHEGGPHVREKLLIATKQYWTAPAPDQDQDVSKTAS  645



>ref|XP_002511797.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50466.1| ATP binding protein, putative [Ricinus communis]
Length=627

 Score =   370 bits (949),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 197/226 (87%), Gaps = 5/226 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI++IAGG+LANWPERLTA+PPRISSGS++GITAE F+ +TELWKKRV HYK VD QL
Sbjct  400  VSNIRDIAGGQLANWPERLTAIPPRISSGSLNGITAETFTENTELWKKRVDHYKAVDHQL  459

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRNILDMNA LGGFAAALVDDP WVMNVVPVE  +NTLGV+YERGLIGTY NWCE
Sbjct  460  AEQGRYRNILDMNAYLGGFAAALVDDPAWVMNVVPVETDINTLGVIYERGLIGTYQNWCE  519

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LYKDRC++ED+LLEMDRILRP+GSV+IRDDVD+++ VKSI 
Sbjct  520  AMSTYPRTYDLIHADSVFSLYKDRCDMEDLLLEMDRILRPEGSVIIRDDVDVLLKVKSIV  579

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD-----QNQEGSNA  61
            D +QWD R+ADHE SPH REKIL A KQYWTA      QNQE S  
Sbjct  580  DVMQWDARIADHERSPHEREKILFAVKQYWTAPAPAPHQNQEQSTT  625



>ref|XP_006339462.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=636

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 198/220 (90%), Gaps = 3/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++K++AGG LANWPERLTAVPPRI+S S++G+TAE FS DTELWKKRVAHYK +D QL
Sbjct  417  VSSVKDVAGGPLANWPERLTAVPPRIASSSIEGVTAEGFSEDTELWKKRVAHYKVLDSQL  476

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRNILDMNA LGGFAAALVDDPVWVMN+VP EA+VNTLGV++ERGLIGTY +WCE
Sbjct  477  AEHGRYRNILDMNAWLGGFAAALVDDPVWVMNIVPTEAEVNTLGVIFERGLIGTYQSWCE  536

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +FTLY+DRCE+EDILLEMDR+LRPQGS + RDDVD++V+VKSI 
Sbjct  537  AMSTYPRTYDFIHADSVFTLYQDRCEMEDILLEMDRVLRPQGSAIFRDDVDVLVNVKSIL  596

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQE  73
            DGLQW++RM DHE  PHVREK+LIA K YWTA   DQ+++
Sbjct  597  DGLQWESRMVDHEGGPHVREKLLIATKLYWTAPAPDQDKQ  636



>gb|KGN56550.1| hypothetical protein Csa_3G123720 [Cucumis sativus]
Length=396

 Score =   360 bits (923),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 196/226 (87%), Gaps = 4/226 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE AGG+L NWPERLT+VPPRISSGS+  IT ++F+ +TELW+KRVAHYK +D QL
Sbjct  169  VSDVKETAGGQLLNWPERLTSVPPRISSGSLKQITPQNFTENTELWRKRVAHYKALDGQL  228

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMN+ LGGFAAA+VDDP+WVMN+VPVEA  NTLGV+YERGLIGTY NWCE
Sbjct  229  AEPGRYRNLLDMNSFLGGFAAAIVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCE  288

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F++YK RCE+EDILLEMDRILRPQGSV++RDDVD++V VKSIA
Sbjct  289  AMSTYPRTYDFIHGDSVFSMYKGRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIA  348

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA----DQNQEGSNAS  58
            + +QW+ R+ADHE  PH REKIL+A KQYWTA    ++NQE   +S
Sbjct  349  EAMQWECRIADHEKGPHQREKILVATKQYWTASATEEENQEKQTSS  394



>ref|XP_004229839.1| PREDICTED: probable methyltransferase PMT15 [Solanum lycopersicum]
Length=636

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++K++AGG L NWPERLTAVPPRI+S S++G+TAE FS DTELWKKRVAHYK +D QL
Sbjct  417  VSSVKDVAGGPLENWPERLTAVPPRIASSSIEGVTAEGFSEDTELWKKRVAHYKALDSQL  476

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRNILDMNA LGGFAAALVDDPVWVMN++P EA+VNTLGV++ERG IGTY +WCE
Sbjct  477  AERGRYRNILDMNAWLGGFAAALVDDPVWVMNIIPAEAEVNTLGVIFERGFIGTYQSWCE  536

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +FTLY+DRCE+EDILLEMDR+LRPQGS + RDDVD++V+VKSI 
Sbjct  537  AMSTYPRTYDFIHADSVFTLYQDRCEVEDILLEMDRVLRPQGSAIFRDDVDVLVNVKSIL  596

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DGLQW++RM DHE  PHVREK+LIA K YWTA
Sbjct  597  DGLQWESRMVDHEGGPHVREKLLIATKLYWTA  628



>gb|KDO86012.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=637

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 194/224 (87%), Gaps = 3/224 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNIKEIAGG+L  WPERL A+PPR++ G+VDG+TAE F  DT LWKKRV +YK VD+QL
Sbjct  413  VSNIKEIAGGQLTKWPERLNAIPPRVNRGAVDGVTAEMFREDTALWKKRVTYYKSVDYQL  472

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVDDP+WVMN VPVEAK+NTLGV+YERGLIGTY NWCE
Sbjct  473  AQPGRYRNLLDMNAYLGGFAAALVDDPLWVMNTVPVEAKINTLGVIYERGLIGTYQNWCE  532

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD IF+LYKDRCE+ED+LLEMDRILRP+GSV+IRDDVDI+V +KSI 
Sbjct  533  AMSTYPRTYDLIHADSIFSLYKDRCEMEDVLLEMDRILRPEGSVIIRDDVDILVKIKSIT  592

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSNA  61
            DG++W+ R+ADHE+ P  REKIL ANK+YWTA   DQNQ    A
Sbjct  593  DGMEWEGRIADHENGPRQREKILFANKKYWTAPAPDQNQGTHTA  636



>ref|XP_006445150.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 ref|XP_006491016.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|ESR58390.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 gb|KDO86013.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=636

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 194/224 (87%), Gaps = 3/224 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNIKEIAGG+L  WPERL A+PPR++ G+VDG+TAE F  DT LWKKRV +YK VD+QL
Sbjct  412  VSNIKEIAGGQLTKWPERLNAIPPRVNRGAVDGVTAEMFREDTALWKKRVTYYKSVDYQL  471

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVDDP+WVMN VPVEAK+NTLGV+YERGLIGTY NWCE
Sbjct  472  AQPGRYRNLLDMNAYLGGFAAALVDDPLWVMNTVPVEAKINTLGVIYERGLIGTYQNWCE  531

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD IF+LYKDRCE+ED+LLEMDRILRP+GSV+IRDDVDI+V +KSI 
Sbjct  532  AMSTYPRTYDLIHADSIFSLYKDRCEMEDVLLEMDRILRPEGSVIIRDDVDILVKIKSIT  591

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSNA  61
            DG++W+ R+ADHE+ P  REKIL ANK+YWTA   DQNQ    A
Sbjct  592  DGMEWEGRIADHENGPRQREKILFANKKYWTAPAPDQNQGTHTA  635



>gb|KHN29409.1| Putative methyltransferase PMT15 [Glycine soja]
Length=410

 Score =   357 bits (915),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++I+E++GGEL+NWPERLT+VPPRISSGS+ GITAE F  + ELWKKRVA+YK +D+QL
Sbjct  186  VNDIREVSGGELSNWPERLTSVPPRISSGSLKGITAEMFKENNELWKKRVAYYKTLDYQL  245

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAAL+DDPVWVMN VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  246  AERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAEVNTLGAIYERGLIGTYMNWCE  305

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDF+H D +F+LY++RC++EDILLEMDRILRPQGSV++RDDVD+++ VKS  
Sbjct  306  AMSTYPRTYDFMHGDSVFSLYQNRCKMEDILLEMDRILRPQGSVILRDDVDVLLKVKSFT  365

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D +QWD+R+ADHE  PH REKIL+A KQYWTA
Sbjct  366  DAMQWDSRIADHEKGPHQREKILVAVKQYWTA  397



>ref|XP_003623835.1| hypothetical protein MTR_7g076170 [Medicago truncatula]
 gb|ABN08826.1| Generic methyltransferase [Medicago truncatula]
 gb|AES80053.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/217 (76%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++IKE++G  L+NWPERLT+VPPRISSGS+DGITAE F  +TELWKKRVA+YK +D+QL
Sbjct  416  VTDIKEVSGRGLSNWPERLTSVPPRISSGSLDGITAEMFKENTELWKKRVAYYKTLDYQL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAAA++DDPVWVMNVVPVEA++NTLGVVYERGLIGTY NWCE
Sbjct  476  AEPGRYRNLLDMNAYLGGFAAAMIDDPVWVMNVVPVEAEINTLGVVYERGLIGTYQNWCE  535

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +FTLY+DRC IEDIL+EMDRILRPQGSV++RDDVD+++ VK  A
Sbjct  536  AMSTYPRTYDFIHADSLFTLYEDRCNIEDILVEMDRILRPQGSVILRDDVDVLLKVKRFA  595

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            D +QWD R+ADHE  PH REKIL+A KQYWTA Q ++
Sbjct  596  DAMQWDARIADHEKGPHQREKILVAVKQYWTAPQPEQ  632



>ref|XP_007139953.1| hypothetical protein PHAVU_008G072500g, partial [Phaseolus vulgaris]
 gb|ESW11947.1| hypothetical protein PHAVU_008G072500g, partial [Phaseolus vulgaris]
Length=403

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 194/220 (88%), Gaps = 0/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N+ E++GGEL+NWP+RLT+VPPRISSGS+ GIT + F  +TELWKKRVA+YK +D+QL
Sbjct  184  VNNVSEVSGGELSNWPDRLTSVPPRISSGSLKGITVDMFKENTELWKKRVAYYKTLDYQL  243

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAAL+DDPVWVMN VPVEA++NTLG +YERGLIGTY NWCE
Sbjct  244  AERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAELNTLGSIYERGLIGTYQNWCE  303

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F+LY++RC++EDILLEMDRILRP+GSV++RDDVD+++ VK+ A
Sbjct  304  AMSTYPRTYDFIHGDSVFSLYQNRCKMEDILLEMDRILRPKGSVILRDDVDVLLKVKNFA  363

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            D +QWD+R+ADHE  PH REKI +A KQYWTA   Q+ S 
Sbjct  364  DAMQWDSRIADHEKGPHQREKIFVAVKQYWTALPPQQKST  403



>emb|CDP08881.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   362 bits (929),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  KE+AGG LA WPERLTAVPPRI SGS+DGITA  + +DT LWKKRV HYK +D QL
Sbjct  416  VSETKEMAGGLLAKWPERLTAVPPRIVSGSLDGITAATYDKDTYLWKKRVEHYKVLDSQL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAAALV+DP+WVMNVVP EAK+NTLG +YERGLIGTY NWCE
Sbjct  476  AEPGRYRNLLDMNAHLGGFAAALVNDPLWVMNVVPAEAKLNTLGAIYERGLIGTYQNWCE  535

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY+DRC++EDILLEMDRILRPQGSV+IRDDVDI+V VKS+ 
Sbjct  536  AMSTYPRTYDFIHADSLFSLYQDRCDMEDILLEMDRILRPQGSVIIRDDVDILVDVKSVI  595

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNAS  58
            D LQWD+RM DHE  PHVREK+LIA KQYWTA  + E  + S
Sbjct  596  DRLQWDSRMVDHEGGPHVREKLLIAVKQYWTAPASSEDQDGS  637



>ref|XP_008438092.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=635

 Score =   362 bits (928),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 197/226 (87%), Gaps = 4/226 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE AGG+L NWPERLT+VPPRI+SGS+  IT ++F+ +TELW+KRVAHYK +D QL
Sbjct  408  VSDVKETAGGQLLNWPERLTSVPPRINSGSLKQITPQNFTENTELWRKRVAHYKALDGQL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMN+ LGGFAAALVDDP+WVMN+VPVEA  NTLGV+YERGLIGTY NWCE
Sbjct  468  AEPGRYRNLLDMNSFLGGFAAALVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F++YKDRCE+EDILLEMDRILRPQGSV++RDDVD++V VKSIA
Sbjct  528  AMSTYPRTYDFIHGDSVFSMYKDRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIA  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA----DQNQEGSNAS  58
            + +QW+ R+ADHE  PH REKIL+A KQYWTA    ++NQE   +S
Sbjct  588  EAMQWECRIADHEKGPHQREKILVATKQYWTASATEEENQEKQTSS  633



>ref|XP_008232735.1| PREDICTED: probable methyltransferase PMT15 [Prunus mume]
Length=632

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 195/226 (86%), Gaps = 3/226 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKEIAGGELA WPERLT+VPPRISSGSV GITAE F  +TELWKKRVA+YK +D+QL
Sbjct  407  VNNIKEIAGGELAKWPERLTSVPPRISSGSVTGITAEMFRDNTELWKKRVAYYKTLDYQL  466

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAAALV DPVWVMN+VPVEA+VNTLGV+YERGLIGTY NWCE
Sbjct  467  AEPGRYRNLLDMNAYLGGFAAALVQDPVWVMNIVPVEAEVNTLGVIYERGLIGTYQNWCE  526

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH+D +F+LYKDRCE+EDILLEMDRILRP+GS++ RDDVD++V VKSI 
Sbjct  527  AMSTYPRTYDFIHSDSVFSLYKDRCEVEDILLEMDRILRPEGSIIFRDDVDVLVKVKSIM  586

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSNASS  55
            D +Q+D  + DHE+ P  REKIL+A KQYWTA    Q+Q  S   S
Sbjct  587  DAMQYDATIVDHENGPRHREKILLAAKQYWTAPAPSQDQGESQTDS  632



>ref|XP_009349944.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   360 bits (923),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 193/227 (85%), Gaps = 4/227 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKEIAGG+LA WPERL  VPPRISSG + GITAE F  +TELWKKRV +YK VD+QL
Sbjct  406  VNNIKEIAGGQLAKWPERLNTVPPRISSGRLTGITAESFRENTELWKKRVEYYKTVDYQL  465

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAA LV DPVWVMN+VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  466  AEPGRYRNLLDMNAYLGGFAAVLVHDPVWVMNIVPVEAEVNTLGAIYERGLIGTYQNWCE  525

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH+D +FTLYKDRCE EDILLEMDRILRP+GS++ RDDVD++V VKSI 
Sbjct  526  AMSTYPRTYDFIHSDSVFTLYKDRCEAEDILLEMDRILRPEGSIIFRDDVDVLVKVKSIL  585

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT----ADQNQEGSNASS  55
            D +Q+D R+ DHE+ P VREKIL+A KQYWT    A +NQE S ++S
Sbjct  586  DAMQYDARIVDHENGPKVREKILLAVKQYWTAPAPAQENQEHSKSTS  632



>ref|XP_010255519.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Nelumbo 
nucifera]
Length=419

 Score =   353 bits (905),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IKEIAGG+L  WP RL +VPPRISSGS+DG+TAE F  DTELWKKRVAHYK V  QL
Sbjct  194  VSDIKEIAGGQLEKWPNRLQSVPPRISSGSLDGVTAETFREDTELWKKRVAHYKAVSNQL  253

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+KGRYRN+LDMNA LGGFAAAL+DDPVWV+NVVP EAK+NTLG +YERGLIGTY +WCE
Sbjct  254  AQKGRYRNLLDMNAHLGGFAAALIDDPVWVINVVPTEAKINTLGAIYERGLIGTYQDWCE  313

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD + TLYKDRCEIEDILLEMDRILRP+G+V+ RDDVDI+V+ KSI 
Sbjct  314  AMSTYPRTYDLIHADSVLTLYKDRCEIEDILLEMDRILRPEGTVIFRDDVDILVTTKSIT  373

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DG+ WD+ + DHE  PH REK+L A K+YWTA
Sbjct  374  DGMNWDSHIVDHEKGPHQREKLLFAVKRYWTA  405



>ref|XP_007220534.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
 gb|EMJ21733.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
Length=632

 Score =   359 bits (922),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 194/226 (86%), Gaps = 3/226 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKEIAGGELA WPERLT+VPPRISSGSV GITAE F  +TELWK RVA+YK +D+QL
Sbjct  407  VNNIKEIAGGELAKWPERLTSVPPRISSGSVTGITAEMFRDNTELWKNRVAYYKTLDYQL  466

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAAALV DPVWVMN+VPVEA+VNTLGV+YERGLIGTY NWCE
Sbjct  467  AEPGRYRNLLDMNAYLGGFAAALVQDPVWVMNIVPVEAEVNTLGVIYERGLIGTYQNWCE  526

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH+D +F+LYKDRCE+EDILLEMDRILRP+GS++ RDDVD++V VKSI 
Sbjct  527  AMSTYPRTYDFIHSDSVFSLYKDRCEVEDILLEMDRILRPEGSIIFRDDVDVLVKVKSIM  586

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSNASS  55
            D +Q+D R+ DHE+ P  REKIL+A KQYW A    Q+Q  S   S
Sbjct  587  DAMQYDARIVDHENGPRHREKILLAAKQYWAAPAPSQDQGESQTDS  632



>ref|XP_002320758.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
 gb|EEE99073.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
Length=629

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 196/219 (89%), Gaps = 3/219 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI++IAGG+LA WPERL A+PPRIS GS++GITA +F  ++ELWK+RVA+YK++D+QL
Sbjct  406  VSNIRDIAGGQLAKWPERLNAIPPRISRGSLEGITAGNFIENSELWKRRVAYYKKIDYQL  465

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVDDP+WVMNVVPV+AK NTLGV++ERGLIGTY NWCE
Sbjct  466  AQTGRYRNLLDMNAHLGGFAAALVDDPLWVMNVVPVQAKTNTLGVIFERGLIGTYQNWCE  525

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY+DRC++EDILLEMDRILRP+GSVV+RDDVDI++ VKSI 
Sbjct  526  AMSTYPRTYDFIHADSVFSLYEDRCDVEDILLEMDRILRPEGSVVMRDDVDILMKVKSII  585

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD---QNQ  76
            D +QWD R+ADHE SPH REKIL A K+YWTA    QNQ
Sbjct  586  DVMQWDGRIADHESSPHQREKILFATKKYWTAPKPGQNQ  624



>ref|XP_011650766.1| PREDICTED: probable methyltransferase PMT16 [Cucumis sativus]
Length=635

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 196/226 (87%), Gaps = 4/226 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE AGG+L NWPERLT+VPPRISSGS+  IT ++F+ +TELW+KRVAHYK +D QL
Sbjct  408  VSDVKETAGGQLLNWPERLTSVPPRISSGSLKQITPQNFTENTELWRKRVAHYKALDGQL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMN+ LGGFAAA+VDDP+WVMN+VPVEA  NTLGV+YERGLIGTY NWCE
Sbjct  468  AEPGRYRNLLDMNSFLGGFAAAIVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F++YK RCE+EDILLEMDRILRPQGSV++RDDVD++V VKSIA
Sbjct  528  AMSTYPRTYDFIHGDSVFSMYKGRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIA  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA----DQNQEGSNAS  58
            + +QW+ R+ADHE  PH REKIL+A KQYWTA    ++NQE   +S
Sbjct  588  EAMQWECRIADHEKGPHQREKILVATKQYWTASATEEENQEKQTSS  633



>ref|XP_007051920.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX96077.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=635

 Score =   358 bits (919),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 192/221 (87%), Gaps = 3/221 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNIKEIAGG+LA WPERL A+PPRISSG + GIT + F  +TELWKKRV +YKRVD QL
Sbjct  410  VSNIKEIAGGQLAKWPERLNAIPPRISSGRLTGITEKMFVENTELWKKRVEYYKRVDHQL  469

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAAALVDDPVW MNVVP+EA++NTLG VYERGLIGTY +WCE
Sbjct  470  AETGRYRNLLDMNAHLGGFAAALVDDPVWTMNVVPIEAEINTLGAVYERGLIGTYQSWCE  529

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD IF+LY+DRCE+EDILLEMDRILRP+GSV+IRDDVD++V VK+I 
Sbjct  530  AMSTYPRTYDFIHADSIFSLYQDRCEMEDILLEMDRILRPEGSVIIRDDVDVLVKVKNII  589

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEG  70
            D +QWD R+ DHED PH REKIL A KQYWT    +Q+Q+G
Sbjct  590  DVMQWDGRIVDHEDGPHEREKILFAVKQYWTVPAPEQSQQG  630



>ref|XP_003533625.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=622

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++I+E++GGEL+NWPERLT+VPPRISSGS+ GITAE F  + ELWKKRVA+YK +D+QL
Sbjct  398  VNDIREVSGGELSNWPERLTSVPPRISSGSLKGITAEMFKENNELWKKRVAYYKTLDYQL  457

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAAL+DDPVWVMN VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  458  AERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAEVNTLGAIYERGLIGTYMNWCE  517

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDF+H D +F+LY++RC++EDILLEMDRILRPQGSV++RDDVD+++ VKS  
Sbjct  518  AMSTYPRTYDFMHGDSVFSLYQNRCKMEDILLEMDRILRPQGSVILRDDVDVLLKVKSFT  577

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D +QWD+R+ADHE  PH REKIL+A KQYWTA
Sbjct  578  DAMQWDSRIADHEKGPHQREKILVAVKQYWTA  609



>ref|XP_007139952.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
 gb|AER13155.1| putative methyltransferase [Phaseolus vulgaris]
 gb|ESW11946.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
Length=634

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+++ E++GGEL+NWPERLT+VPPRISSGS++GIT + F  ++ELWKKRVA+YK +D+QL
Sbjct  415  VNDVSEVSGGELSNWPERLTSVPPRISSGSLNGITVDMFKENSELWKKRVAYYKTLDYQL  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAAL+DDPVWVMN VPVEA++NTLG +YERGLIGTY NWCE
Sbjct  475  AERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAELNTLGAIYERGLIGTYQNWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F+LY++RC++EDILLEMDRILRPQGSV++RDDVD+++ VK+ A
Sbjct  535  AMSTYPRTYDFIHGDSVFSLYQNRCKMEDILLEMDRILRPQGSVILRDDVDVLLKVKNFA  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            D +QWD+R+ADHE  PH REKI +A KQYWTA   Q+ S 
Sbjct  595  DAMQWDSRIADHEKGPHQREKIFVAVKQYWTAPPPQQKST  634



>ref|XP_011035186.1| PREDICTED: probable methyltransferase PMT15 isoform X3 [Populus 
euphratica]
Length=628

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI++IAGG+LA WPERL A+PPRIS GS++GITA +F  ++ELWK+RVA+YK++D+QL
Sbjct  405  VSNIRDIAGGQLAKWPERLNAIPPRISRGSLEGITAGNFIENSELWKRRVAYYKKIDYQL  464

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVDDPVWVMNVVPV+AK NTLGV++ERGLIGTY NWCE
Sbjct  465  AQTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKTNTLGVIFERGLIGTYQNWCE  524

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY DRC+++DILLEMDRILRP+GSV++RDDVDI++ VKSI 
Sbjct  525  AMSTYPRTYDFIHADSVFSLYNDRCDMQDILLEMDRILRPEGSVIMRDDVDILMKVKSII  584

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D +QWD R+ADHE SPH REKIL A K+YWTA
Sbjct  585  DVMQWDGRIADHESSPHRREKILFATKKYWTA  616



>ref|XP_011035172.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Populus 
euphratica]
 ref|XP_011035179.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Populus 
euphratica]
Length=628

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI++IAGG+LA WPERL A+PPRIS GS++GITA +F  ++ELWK+RVA+YK++D+QL
Sbjct  405  VSNIRDIAGGQLAKWPERLNAIPPRISRGSLEGITAGNFIENSELWKRRVAYYKKIDYQL  464

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVDDPVWVMNVVPV+AK NTLGV++ERGLIGTY NWCE
Sbjct  465  AQTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKTNTLGVIFERGLIGTYQNWCE  524

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY DRC+++DILLEMDRILRP+GSV++RDDVDI++ VKSI 
Sbjct  525  AMSTYPRTYDFIHADSVFSLYNDRCDMQDILLEMDRILRPEGSVIMRDDVDILMKVKSII  584

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D +QWD R+ADHE SPH REKIL A K+YWTA
Sbjct  585  DVMQWDGRIADHESSPHRREKILFATKKYWTA  616



>ref|XP_004510859.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=644

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKE+AGGEL+ WP+RLT++PPRISS S+ GITAE F  +TELWKKRVAHYK +D QL
Sbjct  427  VNNIKEVAGGELSKWPKRLTSIPPRISSESLKGITAEMFIENTELWKKRVAHYKTLDHQL  486

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMN+ LGGFAAAL+DDPVWVMNVVPVEA++NTLGV+YERGLIGTY NWCE
Sbjct  487  AESGRYRNLLDMNSYLGGFAAALIDDPVWVMNVVPVEAEINTLGVIYERGLIGTYQNWCE  546

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDF+H D +F+LY++RC +E+ILLEMDRILRPQGS+++RDDVD++  VKSIA
Sbjct  547  AMSTYPRTYDFLHGDSVFSLYQNRCSMENILLEMDRILRPQGSIILRDDVDVLTKVKSIA  606

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            D +QWD R+ DHE  P+ REKIL+A KQYWTA Q ++
Sbjct  607  DEMQWDARITDHEYGPYQREKILVAVKQYWTAPQTEQ  643



>ref|XP_008383220.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=583

 Score =   353 bits (905),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 190/227 (84%), Gaps = 4/227 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKEIAGG+LA WPERL  VPPRISSGS+ GITAE F  +TELWKKRV +YK VD+QL
Sbjct  357  VNNIKEIAGGQLAKWPERLNTVPPRISSGSLTGITAETFRENTELWKKRVEYYKTVDYQL  416

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAA LV DPVWVMN+VPVEA+VN LG +YERGLIGTY NWCE
Sbjct  417  AEAGRYRNLLDMNAYLGGFAAVLVHDPVWVMNIVPVEAEVNALGAIYERGLIGTYQNWCE  476

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IH+D +FTLYKDRCE EDILLEMDRILRP GS++ RDDVD++V VKSI 
Sbjct  477  AMSTYPRTYDLIHSDSVFTLYKDRCEAEDILLEMDRILRPXGSIIFRDDVDVLVKVKSIL  536

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD----QNQEGSNASS  55
            D +Q+D R+ DHE+ P VREKIL+A KQYWTA     + QE S ++S
Sbjct  537  DAMQYDARIVDHENGPKVREKILLAVKQYWTAPAXAXETQEQSKSNS  583



>ref|XP_008354467.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=628

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 190/227 (84%), Gaps = 4/227 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKEIAGG+LA WPERL  VPPRISSGS+ GITAE F  +TELWKKRV +YK VD+QL
Sbjct  402  VNNIKEIAGGQLAKWPERLNTVPPRISSGSLTGITAETFRENTELWKKRVEYYKTVDYQL  461

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAA LV DPVWVMN+VPVEA+VN LG +YERGLIGTY NWCE
Sbjct  462  AEAGRYRNLLDMNAYLGGFAAVLVHDPVWVMNIVPVEAEVNALGAIYERGLIGTYQNWCE  521

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IH+D +FTLYKDRCE EDILLEMDRILRP GS++ RDDVD++V VKSI 
Sbjct  522  AMSTYPRTYDLIHSDSVFTLYKDRCEAEDILLEMDRILRPXGSIIFRDDVDVLVKVKSIL  581

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD----QNQEGSNASS  55
            D +Q+D R+ DHE+ P VREKIL+A KQYWTA     + QE S ++S
Sbjct  582  DAMQYDARIVDHENGPKVREKILLAVKQYWTAPAXAXETQEQSKSNS  628



>ref|XP_010255518.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IKEIAGG+L  WP RL +VPPRISSGS+DG+TAE F  DTELWKKRVAHYK V  QL
Sbjct  420  VSDIKEIAGGQLEKWPNRLQSVPPRISSGSLDGVTAETFREDTELWKKRVAHYKAVSNQL  479

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+KGRYRN+LDMNA LGGFAAAL+DDPVWV+NVVP EAK+NTLG +YERGLIGTY +WCE
Sbjct  480  AQKGRYRNLLDMNAHLGGFAAALIDDPVWVINVVPTEAKINTLGAIYERGLIGTYQDWCE  539

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD + TLYKDRCEIEDILLEMDRILRP+G+V+ RDDVDI+V+ KSI 
Sbjct  540  AMSTYPRTYDLIHADSVLTLYKDRCEIEDILLEMDRILRPEGTVIFRDDVDILVTTKSIT  599

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DG+ WD+ + DHE  PH REK+L A K+YWTA
Sbjct  600  DGMNWDSHIVDHEKGPHQREKLLFAVKRYWTA  631



>ref|XP_010662513.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Vitis 
vinifera]
Length=389

 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 190/221 (86%), Gaps = 2/221 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  +E+AGGELA WPERL  +PPRISSGS++G+TAE F  ++ELWKKR+++YK V+ QL
Sbjct  169  VSYSQELAGGELAKWPERLNVIPPRISSGSINGVTAEIFQLNSELWKKRMSYYKAVNNQL  228

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAAALV+DPVWVMNVVPV+AK+NTLGV+YERGLIGTY NWCE
Sbjct  229  RQPGRYRNLLDMNAYLGGFAAALVEDPVWVMNVVPVDAKINTLGVIYERGLIGTYQNWCE  288

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LYKDRCE+EDILLEMDRILRP+GSV++RDDVD++V +K I 
Sbjct  289  AMSTYPRTYDLIHADSVFSLYKDRCEMEDILLEMDRILRPEGSVILRDDVDVLVKIKRIT  348

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD--QNQEGS  67
            DGL W +R+ DHED PH REK+L A K YWTA    +QEGS
Sbjct  349  DGLNWMSRIVDHEDGPHQREKLLFAVKSYWTAPAAADQEGS  389



>ref|XP_009343539.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   352 bits (903),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKEIAGGEL+ WP+RL +VPPRISSGS+ G+TA+ F  +TELW KRVA+YK +D+QL
Sbjct  406  VNNIKEIAGGELSKWPKRLNSVPPRISSGSLTGVTAQTFRENTELWNKRVAYYKTMDYQL  465

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMNA LGGFAAALV DPVWVMN+VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  466  AEPGRYRNLLDMNAYLGGFAAALVHDPVWVMNIVPVEAEVNTLGAIYERGLIGTYQNWCE  525

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH+D +FTLYKDRCE+EDILLEMDRILRP+GS++ RDDVD++V VKSI 
Sbjct  526  AMSTYPRTYDFIHSDSVFTLYKDRCEVEDILLEMDRILRPEGSIIFRDDVDVLVKVKSIM  585

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D +Q+D R+ DHED P  REKI++A KQYWTA
Sbjct  586  DAMQYDARIVDHEDGPIEREKIMLAVKQYWTA  617



>ref|XP_002301329.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE80602.1| dehydration-responsive family protein [Populus trichocarpa]
Length=622

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++I++IAGG+LA WPERL A+PPRISSG ++G+ A  F  ++ELWKKRVA+YK++D+QL
Sbjct  405  VASIRDIAGGQLAKWPERLNAIPPRISSGGLEGLAANSFVENSELWKKRVAYYKKIDYQL  464

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVDDPVWVMNVVPV+AK+NTLGV+++RGLIGTY NWCE
Sbjct  465  AKTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKMNTLGVIFQRGLIGTYQNWCE  524

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY++RC +EDILLEMDRILRP+GSV+IRDDVDI+++VK+I 
Sbjct  525  AMSTYPRTYDFIHADSLFSLYENRCGVEDILLEMDRILRPEGSVIIRDDVDILLNVKAIM  584

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
            D +QWD R+ DHE SPH REKIL A K+YWTA +
Sbjct  585  DAMQWDGRITDHESSPHEREKILFATKKYWTAPR  618



>gb|KHG11272.1| hypothetical protein F383_13094 [Gossypium arboreum]
Length=379

 Score =   342 bits (876),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 185/213 (87%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS IKEIAGG+L  WP+RL A+PPRISSGS+ G+T  +F  +TELWK+RVA+YK++D+QL
Sbjct  158  VSEIKEIAGGQLPKWPQRLNAIPPRISSGSLTGVTGNNFVENTELWKERVAYYKKIDYQL  217

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEA-KVNTLGVVYERGLIGTYHNWC  367
            A+ GRYRN+LDMNA LGGFAAALVDDPVWVMN VPVEA ++NTLGV+YERGLIGTY NWC
Sbjct  218  AQTGRYRNLLDMNAYLGGFAAALVDDPVWVMNAVPVEADQLNTLGVIYERGLIGTYQNWC  277

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYDFIHAD IF+LYKD C+ EDILLEMDR+LRP+G V+IRDDVD+++ +K I
Sbjct  278  EAMSTYPRTYDFIHADTIFSLYKDSCDTEDILLEMDRVLRPEGGVIIRDDVDVLLKIKKI  337

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
             D +QW+ R+ADHE  PH REKIL A KQYWTA
Sbjct  338  IDVMQWEGRIADHEKGPHEREKILFAVKQYWTA  370



>ref|XP_009384529.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=635

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+ I+E AGGEL  WPERLTAVPPRI+SGS DG+T E F +DTELWKKR+ +Y+ V  QL
Sbjct  412  VTGIRETAGGELKKWPERLTAVPPRIASGSPDGVTPETFRQDTELWKKRLGYYRTVINQL  471

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNAK GGFAAAL+DDPVWVMNVVP  A  NTLGV+YERGLIGTY +WCE
Sbjct  472  GQKGRYRNLLDMNAKFGGFAAALIDDPVWVMNVVPTAANTNTLGVIYERGLIGTYQDWCE  531

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +F+LYK RCE+EDILLEMDRILRP+G+V++RDDVD+++ +KS+ 
Sbjct  532  AMSTYPRTYDLLHADWVFSLYKGRCEMEDILLEMDRILRPEGTVIVRDDVDVLIKIKSVT  591

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQEGSNASS  55
            DG++WD+ +ADHED PH REK+L+  K YWTA DQNQE  N S+
Sbjct  592  DGMRWDSEIADHEDGPHQREKLLVVVKTYWTAPDQNQEQPNGSA  635



>ref|XP_011023413.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=623

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++I++IAGG+LA WPERL A+PPRISSGS++G+TA  F  ++ELWKKRVA+YK++D QL
Sbjct  406  VASIRDIAGGQLAKWPERLNAIPPRISSGSLEGLTANSFVENSELWKKRVAYYKKIDCQL  465

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVDDPVWVMNVVPV+AK+NTLGV+++RGL GTY NWCE
Sbjct  466  AKTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKMNTLGVIFQRGLTGTYQNWCE  525

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY++RC +EDILLEMDRILRP+GSV+IRDDV I+++VK+I 
Sbjct  526  AMSTYPRTYDFIHADSLFSLYENRCGVEDILLEMDRILRPEGSVIIRDDVVILLNVKAIV  585

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            D +QWD R+ DHE SPH REKIL A K+YWTA + ++
Sbjct  586  DAMQWDGRITDHESSPHEREKILFATKKYWTAPRPEQ  622



>ref|XP_004492680.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=1073

 Score =   358 bits (919),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++IK+++GG L+NWPERLT++PPRISSGS++GITAE F+ ++ELWKKRVA+YK +D+QL
Sbjct  427  VNDIKDVSGGGLSNWPERLTSIPPRISSGSLEGITAEKFNENSELWKKRVAYYKTLDYQL  486

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAAL+D PVWVMNVVPVEA++NTLG V+ERGLIGTY NWCE
Sbjct  487  AERGRYRNLLDMNAYLGGFAAALIDYPVWVMNVVPVEAEINTLGAVFERGLIGTYQNWCE  546

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D IF+LY+DRC IEDILLEMDRILRPQGSV++RDDVD+++ VK   
Sbjct  547  AMSTYPRTYDFIHGDSIFSLYQDRCNIEDILLEMDRILRPQGSVILRDDVDVLLKVKKFV  606

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D +QWD R+ADHE  PH REKILIA KQYWTA
Sbjct  607  DSMQWDARIADHEKGPHQREKILIAVKQYWTA  638



>ref|XP_009609846.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=657

 Score =   348 bits (892),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E+AGG+L  WP+RL A+PPRISSG+V+G+TAE F +D++LW+KRV++YK VD +L
Sbjct  430  VSSEEEVAGGQLEKWPKRLHAIPPRISSGTVNGVTAESFEKDSQLWQKRVSYYKSVDNKL  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA+ VDDPVWVMNVVPVEA+VNTLGV+YERGL+GTY NWCE
Sbjct  490  NQPGRYRNLLDMNAYLGGFAASWVDDPVWVMNVVPVEAEVNTLGVIYERGLVGTYQNWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD IFT+YKDRCE+EDILLEMDRILRP+GSV+IR+DVDI+V VK IA
Sbjct  550  AMSTYPRTYDLIHADSIFTMYKDRCEMEDILLEMDRILRPEGSVIIREDVDILVEVKKIA  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            DGL+WD  + DHED P  REK+L A K YWTA   Q+ +N S+
Sbjct  610  DGLKWDTLIVDHEDGPMEREKLLFAVKSYWTAPATQDSNNTSA  652



>gb|KJB41226.1| hypothetical protein B456_007G095700 [Gossypium raimondii]
Length=629

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 187/220 (85%), Gaps = 4/220 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNIKEIAGG+LA WPERL A+PPRISSGS+ GIT   F  ++ELWKKRV +YK +D QL
Sbjct  410  VSNIKEIAGGQLAKWPERLNAIPPRISSGSLPGITETVFVENSELWKKRVEYYKTIDHQL  469

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEA-KVNTLGVVYERGLIGTYHNWC  367
            AE GRYRN+LDMNA LGGFAAALVDDPVWVMN+VPVEA ++NTLGVVYERGLIG Y NWC
Sbjct  470  AETGRYRNLLDMNAYLGGFAAALVDDPVWVMNIVPVEADQINTLGVVYERGLIGAYQNWC  529

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYDFIH D IF+LYKDRCE+EDI+LEMDRILRP+ SV+IRDDVD+++ +K++
Sbjct  530  EAMSTYPRTYDFIHGDAIFSLYKDRCEMEDIVLEMDRILRPESSVIIRDDVDVLMKLKNM  589

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQ  76
             DG+QWD R+ DHED PH R KIL A KQYW A    QNQ
Sbjct  590  MDGMQWDGRIVDHEDGPHERTKILFAVKQYWVASPLSQNQ  629



>ref|XP_004306838.1| PREDICTED: probable methyltransferase PMT15 [Fragaria vesca subsp. 
vesca]
Length=627

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N+++ AGGELA WP RLT VPPRISSGS++GIT E F  +T LWK+RVAHYK +D+QL
Sbjct  402  VNNLRDTAGGELAKWPARLTTVPPRISSGSLEGITDEMFRENTALWKQRVAHYKTLDYQL  461

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMN+ LG FAAALVDDPVWVMN+VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  462  ADPGRYRNLLDMNSYLGSFAAALVDDPVWVMNIVPVEAEVNTLGAIYERGLIGTYQNWCE  521

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH+D +FTLYKDRCE+ DILLEMDRILRPQGS++ RDDVD++V  K + 
Sbjct  522  AMSTYPRTYDFIHSDSVFTLYKDRCEMVDILLEMDRILRPQGSIIFRDDVDMVVKAKGLL  581

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            D +Q+D R+ DHE+ PH REKIL+A KQYWTA +  +    SS
Sbjct  582  DAMQYDARIVDHEEGPHHREKILLAAKQYWTAPEPNQNEGESS  624



>ref|XP_003551650.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=561

 Score =   345 bits (884),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++I+E++GGEL  WP+RL +VPPRISSGS+ GIT + F  + ELWKKRVA+YK +D+QL
Sbjct  344  VNDIREVSGGELPKWPQRLKSVPPRISSGSLKGITGKMFKENNELWKKRVAYYKTLDYQL  403

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAAL+DDPVWVMN VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  404  AERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAEVNTLGAIYERGLIGTYMNWCE  463

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F+LY++RC++EDILLEMDRILRP+GSV++RDDVD+++ VKS  
Sbjct  464  AMSTYPRTYDFIHGDSVFSLYQNRCKVEDILLEMDRILRPEGSVILRDDVDVLLKVKSFT  523

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D +QW++R+ADHE  PH REKIL A KQYWTA
Sbjct  524  DAMQWESRIADHEKGPHQREKILFAVKQYWTA  555



>ref|XP_008375906.1| PREDICTED: probable methyltransferase PMT15 [Malus domestica]
Length=632

 Score =   347 bits (889),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 190/225 (84%), Gaps = 3/225 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+NIKEIAGGEL  WP+RL +VPPRISSGS+ G+TA+ F  +TELW KRVA+YK +D+QL
Sbjct  406  VNNIKEIAGGELTKWPKRLNSVPPRISSGSLTGVTAQTFRENTELWNKRVAYYKTMDYQL  465

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LD NA LGGFAAALV DPVWVMN+VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  466  AEPGRYRNLLDTNAYLGGFAAALVHDPVWVMNIVPVEAEVNTLGAIYERGLIGTYQNWCE  525

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH+D +FTLYKDRCE+E ILLEMDRILRP+GS++ RDDVD++V VKSI 
Sbjct  526  AMSTYPRTYDFIHSDSVFTLYKDRCEVEYILLEMDRILRPEGSIIFRDDVDVLVKVKSIM  585

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD---QNQEGSNAS  58
            D +Q+D R+ DHE+ P  REKI++A KQYWTA    Q  EG + +
Sbjct  586  DAMQYDVRIVDHENGPREREKIMLAVKQYWTAPAPAQQDEGQSKT  630



>gb|KJB09867.1| hypothetical protein B456_001G171500 [Gossypium raimondii]
Length=628

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 187/213 (88%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS IKEIAGG+L  WP+RL A+PPRISSGS+ G+T  +F  +TELWK+R+A+YK +D+QL
Sbjct  407  VSEIKEIAGGQLPKWPQRLNAIPPRISSGSLTGVTGNNFVENTELWKERIAYYKNIDYQL  466

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEA-KVNTLGVVYERGLIGTYHNWC  367
            A+ GRYRN+LDMNA LGGFAAALVDDPVWVMN VPVEA ++NTLGV+YERGLIGTY NWC
Sbjct  467  AQTGRYRNLLDMNAYLGGFAAALVDDPVWVMNAVPVEADQLNTLGVIYERGLIGTYQNWC  526

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYDFIHAD IF+LYKDRC++EDILLEMDR+LRP+GSV+IRDDVD+++ +K I
Sbjct  527  EAMSTYPRTYDFIHADSIFSLYKDRCDMEDILLEMDRVLRPEGSVIIRDDVDVLLKIKKI  586

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
             D +QW+ R+ADHE  PH REKIL A KQYWTA
Sbjct  587  IDVMQWEGRIADHEKGPHEREKILFAVKQYWTA  619



>ref|XP_004309222.1| PREDICTED: probable methyltransferase PMT16 [Fragaria vesca subsp. 
vesca]
Length=646

 Score =   347 bits (889),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 160/222 (72%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG+LA WP+RLTAVPPRIS G+V G+TA +F +D+ELW+KRV HYK V+ QL
Sbjct  425  VSSEDDVAGGKLAKWPQRLTAVPPRISRGTVKGVTAANFQQDSELWRKRVTHYKTVNNQL  484

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAALVD PVWVMN+VPV+ KVNTLGV+YERGLIG+Y NWCE
Sbjct  485  AQPGRYRNLLDMNAYLGGFAAALVDLPVWVMNMVPVDVKVNTLGVIYERGLIGSYQNWCE  544

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LYKDRCEIEDILLEMDRILRP+GSV+IRDDVD++V +KSI 
Sbjct  545  AMSTYPRTYDLIHADTVFSLYKDRCEIEDILLEMDRILRPEGSVIIRDDVDVLVKIKSII  604

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD-QNQEGSNA  61
            D + WD+++ADHED PH REK+L A K+YWTA    +EGSN+
Sbjct  605  DHMDWDSQIADHEDGPHEREKLLFAVKKYWTAPAPAEEGSNS  646



>ref|XP_002279420.2| PREDICTED: probable methyltransferase PMT15 isoform X1 [Vitis 
vinifera]
 emb|CBI31829.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   346 bits (888),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 190/221 (86%), Gaps = 2/221 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  +E+AGGELA WPERL  +PPRISSGS++G+TAE F  ++ELWKKR+++YK V+ QL
Sbjct  436  VSYSQELAGGELAKWPERLNVIPPRISSGSINGVTAEIFQLNSELWKKRMSYYKAVNNQL  495

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAAALV+DPVWVMNVVPV+AK+NTLGV+YERGLIGTY NWCE
Sbjct  496  RQPGRYRNLLDMNAYLGGFAAALVEDPVWVMNVVPVDAKINTLGVIYERGLIGTYQNWCE  555

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LYKDRCE+EDILLEMDRILRP+GSV++RDDVD++V +K I 
Sbjct  556  AMSTYPRTYDLIHADSVFSLYKDRCEMEDILLEMDRILRPEGSVILRDDVDVLVKIKRIT  615

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD--QNQEGS  67
            DGL W +R+ DHED PH REK+L A K YWTA    +QEGS
Sbjct  616  DGLNWMSRIVDHEDGPHQREKLLFAVKSYWTAPAAADQEGS  656



>gb|KHN04623.1| Putative methyltransferase PMT15 [Glycine soja]
Length=441

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 190/213 (89%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGE-LANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQ  547
            V NIKE++GG  LANWP RLT++PPRI S S++GITAE F+ +T+LWKKR+A+YK++D Q
Sbjct  220  VKNIKEVSGGGGLANWPNRLTSIPPRIRSESLEGITAEMFTENTKLWKKRLAYYKKLDHQ  279

Query  546  LAEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWC  367
            LAE+GRYRN+LDMNA LGGFAAALVDDPVWVMN+VPVEA++NTLGVVYERGLIGTY NWC
Sbjct  280  LAERGRYRNLLDMNAYLGGFAAALVDDPVWVMNIVPVEAEINTLGVVYERGLIGTYQNWC  339

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYDFIH D +F+LY++RC++ DILLEMDRILRPQGSV++RDDVD++  VK I
Sbjct  340  EAMSTYPRTYDFIHGDSVFSLYQNRCDMVDILLEMDRILRPQGSVILRDDVDVLTKVKII  399

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            AD +QWD R+ DHE+ P+ R+KIL+A K+YWT+
Sbjct  400  ADEMQWDARITDHEEGPYERQKILVAVKEYWTS  432



>ref|XP_010540274.1| PREDICTED: probable methyltransferase PMT15 [Tarenaya hassleriana]
Length=630

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            SN+KE+AGG LA WPERL  VPPRISSGS+ GIT +DF+ ++E W+KRV++YKR D QLA
Sbjct  413  SNVKEVAGGALAKWPERLNVVPPRISSGSLKGITPDDFAGNSETWEKRVSYYKRFDHQLA  472

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E+GRYRN+LDMNA LGGFAAALV+DPVWVMNVVPVEA VNTLGV+YERGL+GTY NWCEA
Sbjct  473  ERGRYRNLLDMNAHLGGFAAALVNDPVWVMNVVPVEASVNTLGVIYERGLVGTYQNWCEA  532

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYK RCE++DILLEMDR+LRP+GSV+IRDDVD++V VK I D
Sbjct  533  MSTYPRTYDFIHADSVFSLYKGRCEMQDILLEMDRVLRPKGSVIIRDDVDVLVRVKEITD  592

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWT  91
            G+QW+ R+ DHE  P  REK+L A KQYWT
Sbjct  593  GMQWEARIGDHEGGPLEREKVLYAVKQYWT  622



>gb|KHG14191.1| hypothetical protein F383_16741 [Gossypium arboreum]
Length=629

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 187/220 (85%), Gaps = 4/220 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNIKEIAGG+LA WPERL A+PPRISSGS+  IT   F  ++ELWKKRV +YK +D QL
Sbjct  410  VSNIKEIAGGQLAKWPERLNAIPPRISSGSLLRITETVFVENSELWKKRVEYYKTIDHQL  469

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEA-KVNTLGVVYERGLIGTYHNWC  367
            AE GRYRN+LDMNA LGGFAAALVDDPVWVMN+VPVEA ++NTLGVVYERGLIGTY NWC
Sbjct  470  AETGRYRNLLDMNAYLGGFAAALVDDPVWVMNIVPVEADQINTLGVVYERGLIGTYQNWC  529

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYDFIH D IF+LYKDRCE+EDI+LEMDRILRP+ SV+IRDDVD+++ +K++
Sbjct  530  EAMSTYPRTYDFIHGDAIFSLYKDRCEMEDIVLEMDRILRPESSVIIRDDVDVLMKLKNM  589

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQ  76
             DG+QWD R+ DHED PH R KIL A KQYW A    QNQ
Sbjct  590  MDGMQWDGRIVDHEDGPHERTKILFAVKQYWVASPLSQNQ  629



>ref|XP_006287263.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
 gb|EOA20161.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
Length=634

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            S IKE AGG+LA WPERL AVPPRI SGS++GIT +DF  +TE W++RV++YKR D QLA
Sbjct  414  SEIKEEAGGKLARWPERLNAVPPRIKSGSLEGITEDDFVSNTETWQRRVSYYKRFDQQLA  473

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN+LDMNA LGGFA+ALVDDPVWVMNVVP+EA VNTLGV+YERGLIGTY NWCEA
Sbjct  474  ETGRYRNLLDMNAHLGGFASALVDDPVWVMNVVPMEASVNTLGVIYERGLIGTYQNWCEA  533

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +FT+YKDRC++EDILLEMDRILRP+GSVVIRDDVD++  VK I D
Sbjct  534  MSTYPRTYDFIHADSVFTMYKDRCDMEDILLEMDRILRPKGSVVIRDDVDVLTKVKKITD  593

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             +QW+ R+ DHE+ P  REKIL   K+YWTA    + S+
Sbjct  594  AMQWEGRIGDHENGPLEREKILFLVKEYWTAPAPDQSSS  632



>ref|XP_008377156.1| PREDICTED: probable methyltransferase PMT16 [Malus domestica]
Length=647

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 189/222 (85%), Gaps = 0/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E+AGG+LANWP RL A+PPRIS G+V G+TA+ F +D+ELWKKRV++YK V+ QL
Sbjct  426  VSDNEEVAGGKLANWPHRLNAIPPRISKGTVKGVTADVFKQDSELWKKRVSYYKSVNNQL  485

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNILDMNA+LGGFAAALVD PVWVMNVVPVE K NTLGV+YERGLIGTY NWCE
Sbjct  486  GNPGRYRNILDMNAQLGGFAAALVDLPVWVMNVVPVEVKSNTLGVIYERGLIGTYQNWCE  545

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDF+HAD +F+LYKDRCE EDILLEMDRILRP+GSVV+RDDVD++V +KSI 
Sbjct  546  AMSTYPRTYDFLHADSVFSLYKDRCEAEDILLEMDRILRPEGSVVMRDDVDVLVKIKSIV  605

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNAS  58
            DG++WD+++ DHED P  REK+L A K+YWTA    E   +S
Sbjct  606  DGMEWDSQIVDHEDGPLEREKLLFAVKKYWTAPAAAEDKPSS  647



>emb|CDY01971.1| BnaC02g27560D [Brassica napus]
Length=416

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            + IKE+AGG+LA WPERL AVPPRI SGS+ GIT +DF  +TE W+ RV++YK  D QLA
Sbjct  201  TEIKEVAGGKLARWPERLNAVPPRIKSGSLQGITVDDFVSNTETWQTRVSYYKIFDQQLA  260

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN+LDMNA LGGFA+ALVDDPVWVMNVVPVEA VNTLGV+YERGLIGTY NWCEA
Sbjct  261  ETGRYRNLLDMNAYLGGFASALVDDPVWVMNVVPVEASVNTLGVIYERGLIGTYQNWCEA  320

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYK RC++EDILLEMDRILRP+GSV+IRDD+D++  VK + D
Sbjct  321  MSTYPRTYDFIHADSVFSLYKHRCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKVTD  380

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            G+QW+ R+ DHE  P  REKIL   K+YWTA
Sbjct  381  GMQWEGRIGDHEKGPLEREKILFLVKEYWTA  411



>ref|XP_010053660.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
 gb|KCW78011.1| hypothetical protein EUGRSUZ_D02245 [Eucalyptus grandis]
Length=650

 Score =   343 bits (880),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 192/223 (86%), Gaps = 1/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IK+IAGGELA WP+RLTAVPPRI+SGSV G+TAE F  +T+LW+ RV++YK +D QL
Sbjct  429  VSDIKDIAGGELAKWPQRLTAVPPRIASGSV-GVTAETFKENTDLWRSRVSYYKSLDHQL  487

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+KGRYRN+LDMNA LGGFAAALVDDPVWVMNVVPVEA  NTLGV+YERGLIGTY +WCE
Sbjct  488  AQKGRYRNLLDMNANLGGFAAALVDDPVWVMNVVPVEATTNTLGVIYERGLIGTYQSWCE  547

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A+STYPRTYDFIHAD +FTLY +RC+++DILLEMDRILRP+G ++ RDDVDI+  +K + 
Sbjct  548  AVSTYPRTYDFIHADSVFTLYSERCDMDDILLEMDRILRPEGGIIFRDDVDILEKIKRMT  607

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            D +Q+++R+ DHE  PH REKIL+A KQYWTA    EG++ +S
Sbjct  608  DAMQYESRIIDHEKGPHEREKILLAYKQYWTAPAPTEGTDTAS  650



>gb|KHM99141.1| Putative methyltransferase PMT15 [Glycine soja]
Length=406

 Score =   335 bits (859),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E AGG L NWPERL A PPRIS G++ G+T+E FS+D ELWKKR+A+YK+V+ QL
Sbjct  187  VSSKDETAGGALKNWPERLKATPPRISKGTIKGVTSETFSKDNELWKKRIAYYKKVNNQL  246

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+L+MNA LGGFAA LVD PVWVMNVVPV+AKV+TLG +YERGLIGTYHNWCE
Sbjct  247  GKAGRYRNLLEMNAYLGGFAAVLVDLPVWVMNVVPVQAKVDTLGAIYERGLIGTYHNWCE  306

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY DRCE+EDILLEMDRILRP+GSV+IRDDVDI+V VKSI 
Sbjct  307  AMSTYPRTYDLIHADSVFSLYSDRCELEDILLEMDRILRPEGSVIIRDDVDILVKVKSIV  366

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G+ WD ++ DHED P  REK+L A K YWTA
Sbjct  367  NGMDWDCQIVDHEDGPLEREKLLFAVKNYWTA  398



>ref|XP_010693483.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=642

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 188/225 (84%), Gaps = 2/225 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  KE+AGG LA WP+RLT +PPRI SG+ +G+T + F  D +LWK+RV++YK V+ QL
Sbjct  418  VSEEKEVAGGHLAKWPKRLTEIPPRIRSGTTEGVTPKIFQEDMKLWKRRVSYYKTVNNQL  477

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNAKLGGFAA LVDDPVWVMNVVPVEAKVNTLGV+YERGLIGTY +WCE
Sbjct  478  GQLGRYRNLLDMNAKLGGFAAGLVDDPVWVMNVVPVEAKVNTLGVIYERGLIGTYQSWCE  537

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD IFTLYKDRCE+EDILLEMDRILRP+GS++ RDDVDI+V +K I 
Sbjct  538  AMSTYPRTYDFIHADSIFTLYKDRCEMEDILLEMDRILRPEGSIIFRDDVDILVKIKKIT  597

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD--QNQEGSNASS  55
            D LQWD+++ DHED P  REK+L A K YWTA    +Q+ SN ++
Sbjct  598  DALQWDSQIVDHEDGPLQREKLLFAVKSYWTAPNTSDQQDSNTAA  642



>ref|XP_007038610.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=642

 Score =   342 bits (877),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +EIAGGELA WP+RL A+PPRI +G+V+GITAE F +D+++WK+R+++YK ++ QL
Sbjct  420  VSHDQEIAGGELAKWPQRLNAIPPRIRNGTVNGITAEIFMQDSDVWKRRLSYYKTLNHQL  479

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFA AL+DDPVWVMNV+P EAKVNTLGV+YERGLIGTY NWCE
Sbjct  480  GQNGRYRNILDMNAYLGGFATALIDDPVWVMNVIPAEAKVNTLGVIYERGLIGTYQNWCE  539

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LYKDRCE+EDILLEMDRILRP+GSVV RDDVDI+V +K I 
Sbjct  540  AMSTYPRTYDFIHADSVFSLYKDRCEMEDILLEMDRILRPEGSVVFRDDVDILVKIKKIT  599

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            DGL WD+++ DHED P  REK+L   K YWTA    E ++ +S
Sbjct  600  DGLNWDSQIVDHEDGPLNREKLLFGVKVYWTAPATVETASTTS  642



>ref|XP_006396270.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
 gb|ESQ37723.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
Length=633

 Score =   342 bits (876),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 186/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            S IKE+AGG+LA WPERL AVPPRI SGS+ GIT +DF  +TE W++RV++YK  D QLA
Sbjct  409  SEIKEVAGGKLARWPERLNAVPPRIRSGSLQGITEDDFVSNTETWQRRVSYYKSFDQQLA  468

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN+LDMNA LGGFA+ALVDDPVWVMNVVPVEA VNTLGV+YERGLIGTY NWCEA
Sbjct  469  ETGRYRNLLDMNAHLGGFASALVDDPVWVMNVVPVEATVNTLGVIYERGLIGTYQNWCEA  528

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDF+HAD +F++YKD+C++EDILLEMDRILRP+GSV+IRDD+D++  VK I D
Sbjct  529  MSTYPRTYDFVHADSVFSMYKDKCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKITD  588

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
             +QW+ R+ DHE+ P  REKIL   K+YWTA    + S++ S
Sbjct  589  AMQWEGRIVDHENGPLEREKILFLVKEYWTAPAPDQSSDSGS  630



>ref|XP_011076214.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=658

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E+AGG+L  WPERL  +PPRIS G+V+G+TAE F +DT+LWKKRV++YK+V+ QL
Sbjct  433  VSNKEEVAGGQLEKWPERLNTIPPRISRGTVNGVTAETFQQDTQLWKKRVSYYKKVNNQL  492

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA L+DDP+WVMNVVPVEAKVNTLGV+YERGLIGTY +WCE
Sbjct  493  GQAGRYRNILDMNAFLGGFAANLIDDPLWVMNVVPVEAKVNTLGVIYERGLIGTYQSWCE  552

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLYKDRCE+EDI+LEMDRILRP+GS++IRDDVDI+V VK IA
Sbjct  553  AMSTYPRTYDLIHADSVFTLYKDRCEMEDIMLEMDRILRPEGSLIIRDDVDILVKVKRIA  612

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            D L W++++ DHED P  REK+L A K YWTA
Sbjct  613  DALNWESQIVDHEDGPLEREKLLFAVKLYWTA  644



>ref|XP_009794887.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=657

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E+AGG+L  WP+RL A+PPRIS G+V+G+TAE F +D++LW+KRV++YK VD +L
Sbjct  430  VSSEEEVAGGQLEKWPKRLHAIPPRISRGTVNGVTAESFEKDSQLWQKRVSYYKSVDNKL  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA+ VDDPVWVMNVVPVEA+VNTLGV+YERGL+GTY +WCE
Sbjct  490  NQPGRYRNLLDMNAYLGGFAASWVDDPVWVMNVVPVEAEVNTLGVIYERGLVGTYQSWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD IFT+YKDRCE+EDILLEMDRILRP+GSV+IR+DVDI+V VK IA
Sbjct  550  AMSTYPRTYDLIHADSIFTMYKDRCEMEDILLEMDRILRPEGSVIIREDVDILVEVKKIA  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            DGL+WD  + DHED P  R K+L A K YWTA   Q+ +N S+
Sbjct  610  DGLKWDTLIVDHEDGPMERGKLLFAVKSYWTAPATQDSNNTST  652



>ref|XP_010419631.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=630

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 184/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            S+IKE+AGG+LA WPERL AVPPRI SGS++GI  +DF  +TE W++RV +YKR D QLA
Sbjct  411  SDIKEVAGGKLARWPERLNAVPPRIKSGSLEGINEDDFVSNTETWQRRVTYYKRFDQQLA  470

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN LDMNA LGGFA+ALVDDPVWVMNVVP+EA VNTLGV+YERGLIGTY NWCEA
Sbjct  471  ETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPMEASVNTLGVIYERGLIGTYQNWCEA  530

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYKDRC++EDILLEMDRILRP+G V+IRDD+D++  VK I D
Sbjct  531  MSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKGGVIIRDDIDVLTKVKKITD  590

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             +QW+ R+ DHE+ P  REKIL   K+YWTA  + + S+
Sbjct  591  AMQWEGRIGDHENGPLEREKILFLVKEYWTAPASDQSSD  629



>ref|NP_191984.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
 sp|Q9ZPH9.1|PMTF_ARATH RecName: Full=Probable methyltransferase PMT15 [Arabidopsis thaliana]
 gb|AAD17339.1| F15P23.1 gene product [Arabidopsis thaliana]
 emb|CAB80884.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81929.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
Length=633

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            S IKE+AGG+LA WPERL A+PPRI SGS++GIT ++F  +TE W++RV++YK+ D QLA
Sbjct  414  SEIKEVAGGQLARWPERLNALPPRIKSGSLEGITEDEFVSNTEKWQRRVSYYKKYDQQLA  473

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN LDMNA LGGFA+ALVDDPVWVMNVVPVEA VNTLGV+YERGLIGTY NWCEA
Sbjct  474  ETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPVEASVNTLGVIYERGLIGTYQNWCEA  533

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYKDRC++EDILLEMDRILRP+GSV+IRDD+D++  VK I D
Sbjct  534  MSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKITD  593

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             +QW+ R+ DHE+ P  REKIL   K+YWTA    + S+
Sbjct  594  AMQWEGRIGDHENGPLEREKILFLVKEYWTAPAPDQSSD  632



>ref|XP_010523726.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=684

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 185/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
              +I+ +AGG+L  WP RL A+PPRISSG+V+GITAE F  +TELWK RV+HYK +D QL
Sbjct  462  TGDIEAVAGGKLEKWPARLNAIPPRISSGTVEGITAEMFLENTELWKNRVSHYKTLDHQL  521

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAALVDDPVWVMNVVPVEA VNTLGVVYERGLIGTY NWCE
Sbjct  522  AERGRYRNLLDMNAYLGGFAAALVDDPVWVMNVVPVEASVNTLGVVYERGLIGTYQNWCE  581

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDF+HAD +F+LY+D+CE E+ILLEMDRILRP G V+IRDDVDI+V VK I 
Sbjct  582  AMSTYPRTYDFVHADSVFSLYQDQCEPEEILLEMDRILRPGGGVMIRDDVDILVKVKRII  641

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
             GLQW+ R+ DHE  PH REKIL A KQYWTA      +++ S
Sbjct  642  KGLQWEGRIFDHEKGPHEREKILYAVKQYWTAPSPNVANSSLS  684



>ref|XP_008234471.1| PREDICTED: probable methyltransferase PMT16, partial [Prunus 
mume]
Length=601

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGG+LA WP+RL A+PPRI+ G+V G+TAE F +D+ELWKKRV++YK V+ QL
Sbjct  379  VSDNEQVAGGKLAKWPQRLNAIPPRINKGTVKGVTAEVFKQDSELWKKRVSYYKSVNNQL  438

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRN+LDMNA LGGFAAALVD PVWVMNVVPV+ K NTLGV+YERGLIGTY NWCE
Sbjct  439  GNPGRYRNLLDMNAYLGGFAAALVDLPVWVMNVVPVDVKANTLGVIYERGLIGTYQNWCE  498

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLY+DRCE++DILLEMDRILRP+GSV+IRDDVD++V +KSI 
Sbjct  499  AMSTYPRTYDLIHADSVFTLYEDRCEMDDILLEMDRILRPEGSVIIRDDVDMLVKIKSII  558

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            D ++WD+++ DHED PH REK+L A K+YWTA    E   ASS
Sbjct  559  DEMEWDSQIVDHEDGPHEREKLLFAVKKYWTAPAAPEDEEASS  601



>ref|XP_010278559.1| PREDICTED: probable methyltransferase PMT15 [Nelumbo nucifera]
Length=633

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 187/226 (83%), Gaps = 4/226 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
             S+IKEIAGG+L  WPERL +VPPRISSGS++GITAE F  DTELW++RV +YK V+ QL
Sbjct  408  ASDIKEIAGGQLDKWPERLYSVPPRISSGSLEGITAESFREDTELWRRRVGYYKSVNNQL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA LGGFAAAL+DDPVWVMNVVP EAK+NTLG +YERGLIGTY NWCE
Sbjct  468  GQKGRYRNLLDMNAHLGGFAAALIDDPVWVMNVVPTEAKLNTLGAIYERGLIGTYQNWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +F+LYK RCE+EDILLEMDRILRP+G+V+ RDDVD+++ +KSI 
Sbjct  528  AMSTYPRTYDLLHADSVFSLYKGRCEMEDILLEMDRILRPEGTVIFRDDVDVLLEIKSIT  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA----DQNQEGSNAS  58
            DG+ W++++ DHE  P  REK+L A K YWTA     + +E   AS
Sbjct  588  DGMNWESKIVDHEKGPLEREKLLFAVKTYWTASAPVSEKRESKTAS  633



>ref|XP_010427380.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=633

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            S+IKE+AGG+LA WPERL AVPPRI SGS++GI  +DF  +TE W++RV +YKR D QLA
Sbjct  414  SDIKEVAGGKLARWPERLNAVPPRIKSGSLEGINEDDFVSNTETWQRRVTYYKRFDQQLA  473

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN LDMNA LGGFA+ALVDDPVWVMNVVP+EA VNTLGV+YERGLIGTY NWCEA
Sbjct  474  ETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPMEASVNTLGVIYERGLIGTYQNWCEA  533

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYKDRC++EDILLEMDRILRP+G V+IRDD+D++  VK I D
Sbjct  534  MSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKGGVIIRDDIDVLTKVKKITD  593

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             +QW+ R+ DHE+ P  REKIL   K+YWTA    + S+
Sbjct  594  AMQWEGRIGDHENGPLEREKILFLVKEYWTAPAPDQSSD  632



>ref|XP_007134966.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
 gb|ESW06960.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
Length=640

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 198/223 (89%), Gaps = 3/223 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +IKEI+GG L+NWP+RLT++PPRI S S++GITA+ F+ +T+LW+KRVA+YK++D QL
Sbjct  418  VKDIKEISGGGLSNWPDRLTSIPPRIRSESLEGITAKMFTENTQLWEKRVAYYKKLDHQL  477

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAALVD P+WVMN+VPVEA++NTLGVVYERGLIGTY NWCE
Sbjct  478  AERGRYRNVLDMNAYLGGFAAALVDYPLWVMNIVPVEAEINTLGVVYERGLIGTYQNWCE  537

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F+LY++RC++ DILLEMDRILRPQG+V++RDDVD++  VKSIA
Sbjct  538  AMSTYPRTYDFIHGDSVFSLYQNRCDMVDILLEMDRILRPQGTVILRDDVDVLTKVKSIA  597

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA---DQNQEGSN  64
            D +QWD ++ DHE+ P+ R+KILIA K+YWTA   ++NQ+ ++
Sbjct  598  DEMQWDAKITDHEEGPYERQKILIAVKEYWTAPPPERNQQSNH  640



>ref|XP_003528883.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=641

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 193/222 (87%), Gaps = 1/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGE-LANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQ  547
            V NIKE++GG  LANWP RLT++PPRI S S++GITAE F+ +T+LWKKR+A+YK++D Q
Sbjct  420  VKNIKEVSGGGGLANWPNRLTSIPPRIRSESLEGITAEMFTENTKLWKKRLAYYKKLDHQ  479

Query  546  LAEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWC  367
            LAE+GRYRN+LDMNA LGGFAAALVDDPVWVMN+VPVEA++NTLGVVYERGLIGTY NWC
Sbjct  480  LAERGRYRNLLDMNAYLGGFAAALVDDPVWVMNIVPVEAEINTLGVVYERGLIGTYQNWC  539

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYDFIH D +F+LY++RC++ DILLEMDRILRPQGSV++RDDVD++  VK I
Sbjct  540  EAMSTYPRTYDFIHGDSVFSLYQNRCDMVDILLEMDRILRPQGSVILRDDVDVLTKVKII  599

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNA  61
            AD +QWD R+ DHE+ P+ R+KIL+A K+YWT+   +   ++
Sbjct  600  ADEMQWDARITDHEEGPYERQKILVAVKEYWTSPPPERNQHS  641



>ref|XP_010456248.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=644

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            S+IKE+AGG+LA WPERL AVPPRI SGS++GI  +DF  +TE W++RV +YKR D QLA
Sbjct  425  SDIKEVAGGKLARWPERLNAVPPRIKSGSLEGINEDDFVSNTETWQRRVTYYKRFDQQLA  484

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN LDMNA LGGFA+ALVDDPVWVMNVVP+EA VNTLGV+YERGLIGTY NWCEA
Sbjct  485  ETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPMEASVNTLGVIYERGLIGTYQNWCEA  544

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYKDRC++EDILLEMDRILRP+G V+IRDD+D++  VK I D
Sbjct  545  MSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKGGVIIRDDIDVLTKVKKITD  604

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             +QW+ R+ DHE+ P  REKIL   K+YWTA    + S+
Sbjct  605  AMQWEGRIGDHENGPLEREKILFLVKEYWTAPAPDQSSD  643



>ref|XP_010693482.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS   ++AGG+LA WP+RLT +PPRISSGS+ G+T + F  D ++WK+RV+HYK V+ QL
Sbjct  413  VSENHKVAGGQLAKWPKRLTEIPPRISSGSIKGVTPKIFQEDMKIWKRRVSHYKAVNNQL  472

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             E GRYRN+LDMNAK+GGFAA LVDDPVWVMNVVPVEA+VNTLGV+YERGLIGTYH+WCE
Sbjct  473  GEPGRYRNLLDMNAKMGGFAAGLVDDPVWVMNVVPVEAEVNTLGVIYERGLIGTYHSWCE  532

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD IF+LYKDRCE+EDILLEMDRILRP+GSV+ RDDVD++V +K I 
Sbjct  533  AMSTYPRTYDFIHADSIFSLYKDRCEMEDILLEMDRILRPEGSVMFRDDVDLLVQIKKII  592

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            D  QWD+ + +HED P  REK+L A K YWTA +  E
Sbjct  593  DAFQWDSHIVNHEDGPLQREKLLFAVKSYWTAPKPTE  629



>ref|XP_002875017.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51276.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   339 bits (870),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 184/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            S IKE+AGG+LA WPERL AVPPRI SGS++GIT +D   +TE W++RV++YK+ D QLA
Sbjct  414  SEIKEVAGGQLARWPERLNAVPPRIKSGSLEGITEDDLVSNTETWQRRVSYYKKYDQQLA  473

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN+LDMNA LGGFA+ALVDDPVWVMNVVPVEA VNTLGV+YERGLIGTY NWCE+
Sbjct  474  ETGRYRNLLDMNAHLGGFASALVDDPVWVMNVVPVEASVNTLGVIYERGLIGTYQNWCES  533

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYKDRC++EDILLEMDRILRP+GSV+IRDD+D++   K I D
Sbjct  534  MSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKGSVIIRDDIDVLTKAKKITD  593

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             +QW+ R+ DHE+ P  REKIL   K+YWTA    + S+
Sbjct  594  AMQWEGRIGDHENGPLEREKILFLVKEYWTAPAPDQSSD  632



>gb|KEH18956.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   339 bits (869),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N+KE+AGGE++ WP+RLT++PPRIS  S+ GIT E F  +TELWKKR ++YK +D QL
Sbjct  421  VNNVKEVAGGEISKWPKRLTSIPPRISGESLKGITPEMFKENTELWKKRESYYKTLDSQL  480

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE GRYRN+LDMN+ LGGFAAALVDDPVWVMN+VPVEA++NTLGV+YERGLIGTY NWCE
Sbjct  481  AETGRYRNLLDMNSYLGGFAAALVDDPVWVMNIVPVEAEINTLGVIYERGLIGTYQNWCE  540

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F+LY+ RC +E+ILLEMDRILRPQGSV++RD+VD++  VKSIA
Sbjct  541  AMSTYPRTYDFIHGDSVFSLYQHRCSMENILLEMDRILRPQGSVILRDNVDVLTKVKSIA  600

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            D +QWD ++ DHE+ P+ +EKIL+A KQYWTA   ++
Sbjct  601  DEMQWDAKIRDHEEGPYQKEKILVAVKQYWTAPPTEQ  637



>ref|XP_009610423.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=651

 Score =   339 bits (869),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ + +AGG L  WP+RL A+PPRIS G+V+G+TA+ F +D++LWK+R+++YK V+ QL
Sbjct  431  VSSEERVAGGHLEKWPKRLHAIPPRISRGTVNGVTADTFKKDSQLWKRRISYYKTVNNQL  490

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA LVDDPVWVMN+VPVEAKVNTLGV+YERGLIGTY NWCE
Sbjct  491  GQPGRYRNLLDMNANLGGFAANLVDDPVWVMNIVPVEAKVNTLGVIYERGLIGTYQNWCE  550

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLYKDRCE+EDILLEMDRILRP+GSV+IRDDVD +V VK I 
Sbjct  551  AMSTYPRTYDLIHADSVFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDTLVKVKRIV  610

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNA  61
            DGL WD+++ DHE+ P  REK+L A K YWTA   QE   +
Sbjct  611  DGLNWDSQIVDHENGPLEREKLLFAVKSYWTAPATQESETS  651



>ref|XP_009770932.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=653

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+   +AGG+L  WP+RL A+PPRIS G+V+GITA+ F +D++LWK+R+++YK V+ QL
Sbjct  433  VSSEDRVAGGQLEKWPKRLHAIPPRISRGTVEGITADTFKKDSQLWKRRMSYYKTVNNQL  492

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA LVDDPVWVMN+VPVEAKVNTLGV+YERGLIGTY +WCE
Sbjct  493  GQPGRYRNLLDMNANLGGFAANLVDDPVWVMNIVPVEAKVNTLGVIYERGLIGTYQSWCE  552

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IH D +FTLY+DRCE+EDILLEMDRILRP+GSV+IRDDVDI+V VK IA
Sbjct  553  AMSTYPRTYDLIHGDSVFTLYEDRCEMEDILLEMDRILRPEGSVIIRDDVDILVKVKRIA  612

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DGL WD+++ DHED P  REK+L A K YWTA   QE
Sbjct  613  DGLNWDSQIVDHEDGPLEREKLLFAVKSYWTAPATQE  649



>ref|XP_006653692.1| PREDICTED: probable methyltransferase PMT15-like, partial [Oryza 
brachyantha]
Length=592

 Score =   336 bits (862),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IKEIAGGEL  WPERLTAVPPRI+SGS++G+T E F  DTELWKKRV HYK V  Q 
Sbjct  376  VSDIKEIAGGELKKWPERLTAVPPRIASGSIEGVTDEIFMEDTELWKKRVGHYKSVISQF  435

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+ GGFAAALVDDPVWVMN+VP      TLGV+YERGLIG+Y +WCE
Sbjct  436  GQKGRYRNLLDMNARFGGFAAALVDDPVWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCE  495

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLYKDRCE+++ILLEMDRILRP+G+V+IRDDVD++V +KSI 
Sbjct  496  GMSTYPRTYDLIHADSVFTLYKDRCEMDNILLEMDRILRPEGTVIIRDDVDMLVKIKSIT  555

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W++++ DHED P VREK+L+  K YWT +++++
Sbjct  556  DGMKWNSQIVDHEDGPLVREKLLLVVKTYWTLEEDKQ  592



>ref|XP_011041603.1| PREDICTED: probable methyltransferase PMT16 [Populus euphratica]
Length=631

 Score =   337 bits (863),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 186/224 (83%), Gaps = 2/224 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  +++AGGEL  WPERL AVPPRIS G+++GITAE F +DT LW +RV++YK V+ QL
Sbjct  408  VSTNQDVAGGELPKWPERLNAVPPRISRGTLEGITAETFQKDTALWNRRVSYYKAVNNQL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL++DP+WVMNVVPV+A  NTLGV+YERGLIGTY +WCE
Sbjct  468  EKPGRYRNILDMNAYLGGFAAALINDPLWVMNVVPVQASANTLGVIYERGLIGTYQDWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F LY DRCE+EDILLEMDRILRP+G+V++RDDVD++V +K I 
Sbjct  528  AMSTYPRTYDFIHADSVFNLYDDRCEMEDILLEMDRILRPEGNVILRDDVDVLVKIKKIT  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT--ADQNQEGSNAS  58
            D L WD+R+ DHED PH REK+L A K YWT  AD  +E + +S
Sbjct  588  DRLNWDSRIVDHEDGPHQREKLLFAVKSYWTAPADHQKESTTSS  631



>ref|XP_009400717.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=631

 Score =   336 bits (862),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 184/218 (84%), Gaps = 1/218 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V  ++EI+GGEL  WPERLTAVPPRI+ GS+DG T E F +DTELWK RV +YK V  QL
Sbjct  414  VVRVEEISGGELKKWPERLTAVPPRIARGSIDGATPEVFLQDTELWKNRVGYYKTVINQL  473

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNAK GGFAAAL+DDP+WVMN+VP  A VNTLGV+YERGLIGTY +WCE
Sbjct  474  GQKGRYRNLLDMNAKFGGFAAALIDDPLWVMNIVPTAADVNTLGVIYERGLIGTYQDWCE  533

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +FTLYKDRCE+EDILLEMDRILRP+G+V+IRDDVD +V +KSIA
Sbjct  534  AMSTYPRTYDLLHADSVFTLYKDRCEMEDILLEMDRILRPEGTVIIRDDVDALVKIKSIA  593

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQE  73
            DG++W++R+ DHED P  REK+L+  K YWTA   NQE
Sbjct  594  DGMRWNSRIMDHEDGPLQREKLLLVVKTYWTAPGPNQE  631



>ref|XP_010091548.1| putative methyltransferase PMT15 [Morus notabilis]
 gb|EXB44733.1| putative methyltransferase PMT15 [Morus notabilis]
Length=647

 Score =   337 bits (863),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 191/228 (84%), Gaps = 5/228 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++++E+AGGELA WPERLT+VPPRISSGS+ GITA+ F  +T++WKKRV +YK  D QL
Sbjct  420  VTDLREVAGGELAKWPERLTSVPPRISSGSLSGITAKIFLENTQIWKKRVEYYKSYDSQL  479

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRY N+LDMN+ LGGFAAAL+DDPVWVMN +PVEA+ NTLGV+YERGLIGTY NWCE
Sbjct  480  AERGRYWNLLDMNSYLGGFAAALIDDPVWVMNAIPVEAQSNTLGVIYERGLIGTYQNWCE  539

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LYK RCE+EDI+LEMDRILRP+GSV+IRDDVD++V ++ I 
Sbjct  540  AMSTYPRTYDFIHADSVFSLYKHRCEMEDIVLEMDRILRPEGSVIIRDDVDLIVKIRPII  599

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-----ADQNQEGSNASS  55
            + +Q+   + DHED P  REKIL+A KQYWT     + + Q G+ +SS
Sbjct  600  EAMQYSTSIVDHEDGPKWREKILLARKQYWTPPDPASRKKQRGTQSSS  647



>ref|XP_010933874.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=640

 Score =   336 bits (862),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +I++IAGGEL  WPERL AVPPRISSGS+ G+T + F +DTE+WKKRV +YK++ F L
Sbjct  418  VDSIQDIAGGELKKWPERLMAVPPRISSGSLSGVTGDMFFQDTEMWKKRVGYYKKL-FNL  476

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+ GGFAAA++D+PVWVMN VP  A VNTLGV+YERGLIGTY +WCE
Sbjct  477  GQKGRYRNLLDMNARFGGFAAAMIDEPVWVMNAVPTAANVNTLGVIYERGLIGTYQDWCE  536

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +FTLY DRCE+EDILLEMDRILRP+G+V+IRDD+D++V +KSIA
Sbjct  537  AMSTYPRTYDLLHADLVFTLYSDRCEMEDILLEMDRILRPEGTVIIRDDIDVLVKIKSIA  596

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQNQEGSNASS  55
            DG++W +++ADHED P  REKI++A K YWT  DQ QE  N ++
Sbjct  597  DGMRWKSQIADHEDGPLKREKIMLAVKDYWTLTDQYQEQRNGAA  640



>ref|XP_009128495.1| PREDICTED: probable methyltransferase PMT15 [Brassica rapa]
Length=665

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            + IKE+AGG+LA WPERL AVPPRI SGS+ GIT +DF  +TE W+ RV++YK  D QLA
Sbjct  450  TEIKEVAGGKLARWPERLNAVPPRIKSGSLQGITVDDFVSNTETWQTRVSYYKIFDQQLA  509

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN+LDMNA LGGFA+ALVDDPVWVMNVVPVEA VNTLGV+YERGL+GTY NWCEA
Sbjct  510  ETGRYRNLLDMNAYLGGFASALVDDPVWVMNVVPVEASVNTLGVIYERGLVGTYQNWCEA  569

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYDFIHAD +F+LYK RC++EDILLEMDRILRP+GSV+IRDD+D++  VK + D
Sbjct  570  MSTYPRTYDFIHADSVFSLYKHRCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKVTD  629

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            G+QW+ R+ DHE  P  REKIL   K+YWTA
Sbjct  630  GMQWEGRIGDHEKGPLEREKILFLVKEYWTA  660



>ref|XP_003533217.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=633

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E AGG L NWPERL A PPRIS G++ G+T+E FS+D ELWKKR+A+YK+V+ QL
Sbjct  414  VSSKDETAGGALKNWPERLKATPPRISKGTIKGVTSETFSKDNELWKKRIAYYKKVNNQL  473

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+L+MNA LGGFAA LVD PVWVMNVVPV+AKV+TLG +YERGLIGTYHNWCE
Sbjct  474  GKAGRYRNLLEMNAYLGGFAAVLVDLPVWVMNVVPVQAKVDTLGAIYERGLIGTYHNWCE  533

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY DRCE+EDILLEMDRILRP+GSV+IRDDVDI+V VKSI 
Sbjct  534  AMSTYPRTYDLIHADSVFSLYSDRCELEDILLEMDRILRPEGSVIIRDDVDILVKVKSIV  593

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G+ WD ++ DHED P  REK+L A K YWTA
Sbjct  594  NGMDWDCQIVDHEDGPLEREKLLFAVKNYWTA  625



>ref|XP_002318832.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
 gb|EEE97052.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
Length=655

 Score =   336 bits (861),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 186/223 (83%), Gaps = 2/223 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +++AGGEL  WPERL AVPPRIS G++ GITAE F +DT LW +RV++YK V+ QL
Sbjct  432  VSNKEDVAGGELPKWPERLNAVPPRISRGTLKGITAETFQKDTALWNRRVSYYKAVNNQL  491

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL +DP+WVMNVVP++AKVNTLGV+YERGLIGTY +WCE
Sbjct  492  EQAGRYRNILDMNAYLGGFAAALTEDPLWVMNVVPIQAKVNTLGVIYERGLIGTYQDWCE  551

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY  RCE+EDILLEMDRILRP+GSV+ RDDVD++V +K I+
Sbjct  552  AMSTYPRTYDLIHADSVFSLYDGRCEMEDILLEMDRILRPEGSVIFRDDVDVLVKIKKIS  611

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            DGL WD+++ DHED PH REK+L A K YWTA    EG + S+
Sbjct  612  DGLNWDSQIVDHEDGPHQREKLLFAIKTYWTAP--AEGRHEST  652



>ref|XP_009801989.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Nicotiana 
sylvestris]
Length=647

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 185/216 (86%), Gaps = 0/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E+AGG+L  WP+RL A+PPRIS G+V+G+T EDF +D++LWK+RV++YK V+ QL
Sbjct  430  VSNEQEVAGGQLEKWPKRLHAIPPRISRGTVNGVTEEDFQKDSQLWKRRVSYYKSVNNQL  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + G+YRNILDMNA LGGFAA LVDDPVWVMN+ P EAKVNTLGV+YERGLIGTY +WCE
Sbjct  490  GQPGQYRNILDMNAFLGGFAANLVDDPVWVMNIAPAEAKVNTLGVIYERGLIGTYQSWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLY++RCE+EDI+LE+DRILRP+GSV+IRDDVDI++ VK IA
Sbjct  550  AMSTYPRTYDLIHADSVFTLYENRCEMEDIMLELDRILRPEGSVIIRDDVDILIKVKRIA  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            DGL WD+++ DHED P  REK+L A K YWTA   Q
Sbjct  610  DGLNWDSQIIDHEDGPLEREKLLFAVKSYWTAPAAQ  645



>ref|XP_009399379.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=644

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +E AGG    WPERLTAVPPRI+SGSV G+TAE F +DTELWKKRV +YK+V  QL
Sbjct  414  VASPEETAGGAPKRWPERLTAVPPRIASGSVVGVTAETFLQDTELWKKRVGYYKKVIGQL  473

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA  GGFAAAL+DDP+WVMN+VP  ++VNTLGV+YERGLIGTY +WCE
Sbjct  474  GQAGRYRNLLDMNANFGGFAAALIDDPLWVMNIVPTTSQVNTLGVIYERGLIGTYQDWCE  533

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +F LYKDRCE+EDILLEMDRILRP+G+V+IRDDVDI+V +KSIA
Sbjct  534  AMSTYPRTYDLLHADSVFNLYKDRCEMEDILLEMDRILRPEGTVIIRDDVDILVKIKSIA  593

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W++R+ADHED P  REK+L+  K YWT  + +E
Sbjct  594  DGMRWNSRIADHEDGPLQREKLLLVVKTYWTVGEEEE  630



>gb|ACN78962.1| methyltransferase [Glycine max]
Length=759

 Score =   338 bits (867),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++I+E++GGEL  WP+RL +VPPRISSGS+ GIT + F  + ELWKKRVA+YK +D+QL
Sbjct  405  VNDIREVSGGELPKWPQRLKSVPPRISSGSLKGITGKMFKENNELWKKRVAYYKTLDYQL  464

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAAL+DDPVWVMN VPVEA+VNTLG +YERGLIGTY NWCE
Sbjct  465  AERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAEVNTLGAIYERGLIGTYMNWCE  524

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +F+LY++RC++EDILLEMDRILRP+GSV++RDDVD+++ VKS  
Sbjct  525  AMSTYPRTYDFIHGDSVFSLYQNRCKVEDILLEMDRILRPEGSVILRDDVDVLLKVKSFT  584

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQ  100
            D +QW++R+ADHE  PH REKIL A KQ
Sbjct  585  DAMQWESRIADHEKGPHQREKILFAVKQ  612



>ref|XP_007220207.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
 gb|EMJ21406.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
Length=640

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 186/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +++AGG+LA WP+RL A+PPRI+ G+V G+TAE F +D+ELWKKRV++YK V+ QL
Sbjct  418  VADNEQVAGGKLAKWPQRLNAIPPRINKGTVKGVTAEVFKQDSELWKKRVSYYKSVNNQL  477

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRN+LDMNA LGGFAAALVD PVWVMNVVPV+ K NTLGV+YERGLIGTY NWCE
Sbjct  478  GNPGRYRNLLDMNAYLGGFAAALVDLPVWVMNVVPVDVKANTLGVIYERGLIGTYQNWCE  537

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLY DRCE++DILLEMDRILRP+GSV+IRDDVD++V +KSI 
Sbjct  538  AMSTYPRTYDLIHADSVFTLYADRCEMDDILLEMDRILRPEGSVIIRDDVDMLVKIKSII  597

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            D ++WD+++ DHED P  REK+L A K+YWTA    E    SS
Sbjct  598  DAMEWDSQIVDHEDGPQEREKLLFAVKKYWTAPAAPEDDETSS  640



>ref|XP_002510829.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51431.1| ATP binding protein, putative [Ricinus communis]
Length=649

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +EIAGG+L  WPERL AVPPRIS GSV G+TAE+F +D +LW KRV +YK V+ QL
Sbjct  426  VSNNQEIAGGKLKKWPERLNAVPPRISRGSVKGLTAENFQKDIKLWTKRVQYYKTVNNQL  485

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA+LGGFAAAL+D PVW MNV+PV+AKVNTLGV+YERGLIGTY +WCE
Sbjct  486  GQAGRYRNLLDMNAQLGGFAAALIDLPVWAMNVIPVQAKVNTLGVIYERGLIGTYQDWCE  545

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY+ RCE+EDILLEMDRILRP+GSV+ RDDVD++V +K I 
Sbjct  546  AMSTYPRTYDLIHADLVFSLYQGRCEMEDILLEMDRILRPEGSVIFRDDVDMLVKIKRIT  605

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD--QNQEGSNAS  58
            DGL W++++ DHED P  REK+L A K YWTA    +Q GSN+S
Sbjct  606  DGLNWESQIVDHEDGPLEREKLLFAVKSYWTAPAAADQNGSNSS  649



>gb|KCW46397.1| hypothetical protein EUGRSUZ_K00230 [Eucalyptus grandis]
Length=603

 Score =   333 bits (855),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  +E+AGG++A WP RL AVPPRIS G+V GITAE F  D ELWK+RV++YK V+ QL
Sbjct  379  VSGDEEVAGGQVAKWPARLNAVPPRISGGTVPGITAETFQTDAELWKRRVSYYKTVNNQL  438

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAAALV+DPVWVMNVVPVEA VNTLGVVYERGLIGTY +WCE
Sbjct  439  GQAGRYRNLLDMNAHLGGFAAALVEDPVWVMNVVPVEAPVNTLGVVYERGLIGTYQSWCE  498

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +FTLYKDRC+ +DILLEMDRILRP+GSV++RDDVD++V +K + 
Sbjct  499  AMSTYPRTYDFIHADSLFTLYKDRCDADDILLEMDRILRPEGSVILRDDVDVLVKLKRML  558

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA--DQNQEGSNASS  55
            DG+ +D+++ DHED P VR+K+L A K YWTA    N   S+ SS
Sbjct  559  DGMNYDSQIVDHEDGPLVRQKLLFAVKSYWTAPSTSNHRRSSTSS  603



>ref|XP_010035103.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
Length=643

 Score =   334 bits (857),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  +E+AGG++A WP RL AVPPRIS G+V GITAE F  D ELWK+RV++YK V+ QL
Sbjct  419  VSGDEEVAGGQVAKWPARLNAVPPRISGGTVPGITAETFQTDAELWKRRVSYYKTVNNQL  478

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAAALV+DPVWVMNVVPVEA VNTLGVVYERGLIGTY +WCE
Sbjct  479  GQAGRYRNLLDMNAHLGGFAAALVEDPVWVMNVVPVEAPVNTLGVVYERGLIGTYQSWCE  538

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +FTLYKDRC+ +DILLEMDRILRP+GSV++RDDVD++V +K + 
Sbjct  539  AMSTYPRTYDFIHADSLFTLYKDRCDADDILLEMDRILRPEGSVILRDDVDVLVKLKRML  598

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA--DQNQEGSNASS  55
            DG+ +D+++ DHED P VR+K+L A K YWTA    N   S+ SS
Sbjct  599  DGMNYDSQIVDHEDGPLVRQKLLFAVKSYWTAPSTSNHRRSSTSS  643



>ref|XP_003548213.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=632

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E AGG L  WPERL A PPRIS G++ G+  E FS+D ELWKKRVA+YK+ + QL
Sbjct  413  VSSKEETAGGALKKWPERLKATPPRISRGTIKGVNPETFSKDNELWKKRVAYYKKANNQL  472

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAAALVD PVWVMNVVPV+AKV+TLG +YERGLIGTYHNWCE
Sbjct  473  GKAGRYRNLLDMNAYLGGFAAALVDLPVWVMNVVPVQAKVDTLGAIYERGLIGTYHNWCE  532

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY DRCE+EDILLEMDRILRP+GSV+IRDDVDI+V VKSI 
Sbjct  533  AMSTYPRTYDLIHADSLFSLYNDRCELEDILLEMDRILRPEGSVIIRDDVDILVKVKSIV  592

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G+ WD+++ DHED P  REK+L A K YWTA
Sbjct  593  NGMDWDSQIVDHEDGPLEREKLLFAVKNYWTA  624



>ref|XP_010919241.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=637

 Score =   333 bits (855),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 187/224 (83%), Gaps = 2/224 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +I+++AGGEL  WPERL AVPPRI+ GS+DG+T E F +D+ELWKKRV HYK++   L
Sbjct  415  VDSIRDVAGGELKKWPERLMAVPPRIARGSLDGVTGEVFLQDSELWKKRVGHYKKL-VNL  473

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+ GGFAAAL D PVWVMN+VP  A VNTLGV+YERGLIGTY +WCE
Sbjct  474  GQKGRYRNLLDMNARFGGFAAALADIPVWVMNIVPTAANVNTLGVIYERGLIGTYQDWCE  533

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLYKDRCE+EDILLEMDRILRP+ +V+ RDDVD++V +KSI 
Sbjct  534  AMSTYPRTYDLIHADSLFTLYKDRCEMEDILLEMDRILRPESTVIFRDDVDVLVKIKSIT  593

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQNQEGSNASS  55
            DG++W +++ADHED P  REKIL+A K YWT +D+ QE  N ++
Sbjct  594  DGMRWKSQIADHEDGPLQREKILLAVKDYWTVSDEKQEQQNGAA  637



>ref|XP_004234366.1| PREDICTED: probable methyltransferase PMT16 [Solanum lycopersicum]
Length=650

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGG+L  WP+RL A+PPRIS G+V+G+T++ F+ D++LWK+RV++YK V+ QL
Sbjct  433  VSSEEKVAGGQLEKWPKRLHAIPPRISRGTVNGVTSDTFNEDSQLWKRRVSYYKTVNNQL  492

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA LVDDPVWVMN+VP EAKVNTLG++YERGLIGTY +WCE
Sbjct  493  GQPGRYRNLLDMNAYLGGFAANLVDDPVWVMNIVPPEAKVNTLGIIYERGLIGTYQSWCE  552

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLYKDRCE+EDILLEMDRILRP+GSV+IRDDVD ++ VK I 
Sbjct  553  AMSTYPRTYDLIHADSVFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDTLIKVKRIT  612

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DGL WD+++ DHED P  REK+L A K YWTA   QE
Sbjct  613  DGLNWDSQIVDHEDGPLEREKLLFAVKSYWTAPSIQE  649



>ref|XP_006353348.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=647

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGG+L  WP+RL A+PPRIS G+++G+T++ F++D++LWK+RV++YK V+ QL
Sbjct  430  VSSEEKVAGGQLEKWPKRLHAIPPRISRGTLNGVTSDTFNKDSQLWKRRVSYYKTVNNQL  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA LVDDPVWVMN+VP EA VNTLGV+YERGLIGTY +WCE
Sbjct  490  GQPGRYRNLLDMNAYLGGFAANLVDDPVWVMNIVPAEANVNTLGVIYERGLIGTYQSWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLYKDRCE+EDILLEMDRILRP+GSV+IRDDVD ++ VK I 
Sbjct  550  AMSTYPRTYDLIHADSVFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDTLIKVKRIT  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DGL WD+++ DHED P  REK+L A K YWTA   QE
Sbjct  610  DGLNWDSQIVDHEDGPLEREKLLFAVKSYWTAPSIQE  646



>ref|XP_004976536.1| PREDICTED: probable methyltransferase PMT15-like [Setaria italica]
Length=640

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE+AGG+L  WPERLTAVPPRI+SGS++G+T E F  DTELWKKR+ HYK V  QL
Sbjct  424  VSDLKEVAGGKLKKWPERLTAVPPRIASGSLEGVTEEMFVEDTELWKKRIGHYKSVIPQL  483

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+KGRYRN+LDMNAK GGFAAALV+DPVWVMN+VP      TLGV+YERGLIG+Y +WCE
Sbjct  484  AQKGRYRNLLDMNAKFGGFAAALVNDPVWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCE  543

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLY  RCE+E++LLEMDRILRP+G+V+IRDDVD++V +KSIA
Sbjct  544  GMSTYPRTYDLIHADSVFTLYHGRCEMENVLLEMDRILRPEGTVIIRDDVDLLVKIKSIA  603

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W++++ DHED P VREK+L+  K YWT   N++
Sbjct  604  DGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLGDNKQ  640



>gb|KFK37364.1| hypothetical protein AALP_AA4G247100 [Arabis alpina]
Length=628

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 179/220 (81%), Gaps = 0/220 (0%)
 Frame = -1

Query  714  IKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAEK  535
            +K +AGG +  WP RL AVPPR+S G +  +T E F  DT+LWK+RV++YKR+D+QL EK
Sbjct  406  LKTVAGGNVEKWPVRLNAVPPRVSRGDLGEVTPEGFLEDTKLWKQRVSYYKRLDYQLGEK  465

Query  534  GRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAMS  355
            GRYRN+LDMNA LGGFA+AL DDPVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAMS
Sbjct  466  GRYRNLLDMNAYLGGFASALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAMS  525

Query  354  TYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADGL  175
            TYPRTYDFIHAD +FTLY+D+CE EDILLEMDR+LRP G V+IRDDVD+++ +K +  GL
Sbjct  526  TYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKIKELTKGL  585

Query  174  QWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            QW+ R+ADHE  PH R KI  A KQYWT    +E  N +S
Sbjct  586  QWEGRIADHEKGPHERVKIYYAVKQYWTVPAVEEDKNNTS  625



>ref|XP_006421866.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
 gb|ESR35106.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
Length=626

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 181/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E AGGELA WP+RL AVPPRIS G+V GIT E F +++ELWKKR+++YK ++ QL
Sbjct  405  VSSNRETAGGELAKWPQRLNAVPPRISKGTVKGITPEIFQQNSELWKKRLSYYKAMNNQL  464

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL+D PVWVMNVVP EAK+NTLGV+YERGLIGTY NWCE
Sbjct  465  GQSGRYRNILDMNAHLGGFAAALIDFPVWVMNVVPAEAKINTLGVIYERGLIGTYTNWCE  524

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LYKDRCE EDILLEMDRILRP+G V+ RDDVD +V VK I 
Sbjct  525  AMSTYPRTYDLIHADSVFSLYKDRCETEDILLEMDRILRPEGGVIFRDDVDELVKVKRII  584

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNAS  58
            D L+W +++ DHED P  REK+L A K YWTA   +  S +S
Sbjct  585  DALKWQSQIVDHEDGPLEREKLLFAVKLYWTAPAEETASESS  626



>ref|XP_002321888.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
 gb|EEF06015.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
Length=631

 Score =   332 bits (850),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 184/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
             S+ +++AGGEL  WPERL AVPPRIS G+++GITAE F +DT LW +RV++YK V+ QL
Sbjct  408  ASSNQDVAGGELPKWPERLNAVPPRISRGTLEGITAETFQKDTALWNRRVSYYKAVNNQL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL++DP+WVMNVVPV+A  NTLGV+YERGLIGTY +WCE
Sbjct  468  EKPGRYRNILDMNAYLGGFAAALINDPLWVMNVVPVQASANTLGVIYERGLIGTYQDWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY  RCE+EDILLEMDRILRP+G+V+ RDDVD++V +K I 
Sbjct  528  AMSTYPRTYDFIHADSVFSLYDGRCEMEDILLEMDRILRPEGNVIFRDDVDVLVKIKKIT  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            D L WD+R+ DHED PH REK+L A K YWTA  + +  + +S
Sbjct  588  DILNWDSRIVDHEDGPHQREKLLFAVKAYWTAPADHQKESTTS  630



>ref|XP_011030063.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=655

 Score =   332 bits (851),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 184/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N +++AGGEL  WPERL AVPPRIS G+++GITAE F +DT LW +RV++YK V+ QL
Sbjct  432  VANKEDVAGGELPKWPERLNAVPPRISRGTLEGITAETFQKDTVLWNRRVSYYKAVNNQL  491

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILD NA LGGFAAAL +DPVWVMNVVP++AKVNTLGV+YERGLIGTY +WCE
Sbjct  492  EQAGRYRNILDTNAYLGGFAAALSEDPVWVMNVVPIQAKVNTLGVIYERGLIGTYQDWCE  551

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY  RCE+EDILLEMDRILRP+GSV+ RDDVD++V +K I+
Sbjct  552  AMSTYPRTYDLIHADSVFSLYDGRCEMEDILLEMDRILRPEGSVIFRDDVDMLVKIKKIS  611

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            DGL WD+++ DHED PH REK+L A K YWTA       + +S
Sbjct  612  DGLNWDSQIIDHEDGPHQREKLLFAIKTYWTAPAGGRHESTTS  654



>ref|NP_001053603.1| Os04g0570800 [Oryza sativa Japonica Group]
 emb|CAD41579.3| OSJNBa0088I22.11 [Oryza sativa Japonica Group]
 dbj|BAF15517.1| Os04g0570800 [Oryza sativa Japonica Group]
 gb|EAY95218.1| hypothetical protein OsI_17036 [Oryza sativa Indica Group]
 dbj|BAG91550.1| unnamed protein product [Oryza sativa Japonica Group]
Length=646

 Score =   332 bits (850),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IKEIAGG+L  WPERLTAVPPRI+SGS++G+T E F  DT+LW+KRV HYK V  Q 
Sbjct  430  VSDIKEIAGGQLKKWPERLTAVPPRIASGSIEGVTDEMFVEDTKLWQKRVGHYKSVISQF  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+ GGFAAALVDDPVWVMN+VP      TLGV+YERGLIG+Y +WCE
Sbjct  490  GQKGRYRNLLDMNARFGGFAAALVDDPVWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLYKDRC++++ILLEMDRILRP+G+V+IRDDVD++V +KSI 
Sbjct  550  GMSTYPRTYDLIHADSVFTLYKDRCQMDNILLEMDRILRPEGTVIIRDDVDMLVKIKSIT  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W++++ DHED P VREK+L+  K YWT  + +E
Sbjct  610  DGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLGEEKE  646



>ref|XP_006857883.1| PREDICTED: probable methyltransferase PMT16 [Amborella trichopoda]
 gb|ERN19350.1| hypothetical protein AMTR_s00069p00110310 [Amborella trichopoda]
Length=639

 Score =   331 bits (849),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++IKE+AGGEL  WPERL AVPPR+  GSV+GI  E F +DTE WKKRV++YK V +QL
Sbjct  409  VNDIKEVAGGELKRWPERLMAVPPRVLGGSVEGINGEAFIKDTEDWKKRVSYYKMVVYQL  468

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KG YRNILDMNA LGGFAAAL++DPVWVMNVVP +AKV+TLGVVYERG IGTYH+WCE
Sbjct  469  GQKGLYRNILDMNAHLGGFAAALIEDPVWVMNVVPPQAKVDTLGVVYERGFIGTYHDWCE  528

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HA+G+FT+ ++RC++EDILLEMDRILRP+G+V++RDDVD++  +K IA
Sbjct  529  AMSTYPRTYDLLHANGVFTINQNRCDMEDILLEMDRILRPEGTVILRDDVDLLFKIKEIA  588

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT  91
            D LQWD +M DHE+ PH+REKIL+  K YWT
Sbjct  589  DALQWDTQMIDHEEGPHIREKILVGVKLYWT  619



>ref|XP_007152322.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
 gb|ESW24316.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
Length=627

 Score =   331 bits (848),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E AGG L NWP+RL A PPRIS G++ G+T E FS D +LWKKRV++YK V+ QL
Sbjct  408  VSSKEETAGGALKNWPDRLKATPPRISMGTIKGVTPETFSNDNKLWKKRVSYYKNVNNQL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAAAL+D PVWVMNVVPV+AKV+TLG ++ERGLIGTYHNWCE
Sbjct  468  GKAGRYRNLLDMNAYLGGFAAALIDSPVWVMNVVPVQAKVDTLGAIFERGLIGTYHNWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY DRCE+EDI+LEMDRILRP+GSV+IRDDVDI+V VKSI 
Sbjct  528  AMSTYPRTYDLIHADSVFSLYNDRCELEDIVLEMDRILRPEGSVIIRDDVDILVKVKSIV  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G+ WD+++ DHED P  REK+L A K YWT+
Sbjct  588  NGMDWDSQIVDHEDGPLEREKLLFAVKNYWTS  619



>ref|XP_006490342.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|KDO60066.1| hypothetical protein CISIN_1g006905mg [Citrus sinensis]
Length=626

 Score =   331 bits (848),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 181/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E AGGELA WP+RL AVPPRIS G+V GIT E F +++ELWKKR+++YK ++ QL
Sbjct  405  VSSDRETAGGELAKWPQRLNAVPPRISKGTVKGITPEIFQQNSELWKKRLSYYKTMNNQL  464

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL+D PVWVMNVVP EAK+NTLGV+YERGL+GTY NWCE
Sbjct  465  GQSGRYRNILDMNAHLGGFAAALIDFPVWVMNVVPAEAKINTLGVIYERGLVGTYTNWCE  524

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LYKDRCE EDILLEMDRILRP+G V+ RDDVD +V VK I 
Sbjct  525  AMSTYPRTYDLIHADSVFSLYKDRCETEDILLEMDRILRPEGGVIFRDDVDELVKVKRII  584

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNAS  58
            D L+W +++ DHED P  REK+L A K YWTA   +  S +S
Sbjct  585  DALKWQSQIVDHEDGPLEREKLLFAVKLYWTAPAEETASESS  626



>ref|XP_011101180.1| PREDICTED: probable methyltransferase PMT16 [Sesamum indicum]
Length=645

 Score =   331 bits (849),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E+AGG+L  WP+RL A+PPRIS G+++G+T + F +D +LW +RV++YK V+ QL
Sbjct  426  VSNNEEVAGGKLEKWPKRLNAIPPRISKGTINGVTPDTFQQDLQLWNRRVSYYKTVNNQL  485

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA LV DP+WVMNVVPVEAK+NTLGV+YERGLIGTY +WCE
Sbjct  486  GQAGRYRNILDMNAFLGGFAANLVGDPLWVMNVVPVEAKINTLGVIYERGLIGTYQSWCE  545

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD IFTLYKDRCE++DI+LEMDRILRP+GS++IRDDVDI+V VK IA
Sbjct  546  AMSTYPRTYDLIHADSIFTLYKDRCEMDDIMLEMDRILRPEGSLIIRDDVDILVKVKRIA  605

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DGL WD+++ DHED P  REK+L A K YWTA
Sbjct  606  DGLNWDSQIVDHEDGPLEREKLLFAVKLYWTA  637



>gb|KEH17379.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=636

 Score =   331 bits (848),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +EI+GGEL NWP+RL + PPRIS G++ G+T + FS+D +LW KRV++YK+V+ QL
Sbjct  417  VSNKEEISGGELNNWPQRLKSTPPRISKGTIKGVTPQTFSKDNQLWNKRVSYYKKVNNQL  476

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA+LV  P+WVMNVVP++AKV+TLG +YERGLIG YHNWCE
Sbjct  477  EKAGRYRNLLDMNAYLGGFAASLVKYPIWVMNVVPIQAKVDTLGAIYERGLIGMYHNWCE  536

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY DRCE+EDILLEMDRILRP+GSV+IRDDVDI+V VKSI 
Sbjct  537  AMSTYPRTYDLIHADSVFSLYNDRCELEDILLEMDRILRPEGSVIIRDDVDILVKVKSII  596

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
            +GL+W++++ DHED P  REK+L A K+YWT+  + + +
Sbjct  597  NGLEWESQIVDHEDGPLEREKLLFAVKKYWTSPASNDNT  635



>ref|XP_009801988.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nicotiana 
sylvestris]
Length=648

 Score =   331 bits (849),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E+AGG+L  WP+RL A+PPRIS G+V+G+T EDF +D++LWK+RV++YK V+ QL
Sbjct  430  VSNEQEVAGGQLEKWPKRLHAIPPRISRGTVNGVTEEDFQKDSQLWKRRVSYYKSVNNQL  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + G+YRNILDMNA LGGFAA LVDDPVWVMN+ P EAKVNTLGV+YERGLIGTY +WCE
Sbjct  490  GQPGQYRNILDMNAFLGGFAANLVDDPVWVMNIAPAEAKVNTLGVIYERGLIGTYQSWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKD-RCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            AMSTYPRTYD IHAD +FTLY++ RCE+EDI+LE+DRILRP+GSV+IRDDVDI++ VK I
Sbjct  550  AMSTYPRTYDLIHADSVFTLYENSRCEMEDIMLELDRILRPEGSVIIRDDVDILIKVKRI  609

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            ADGL WD+++ DHED P  REK+L A K YWTA   Q
Sbjct  610  ADGLNWDSQIIDHEDGPLEREKLLFAVKSYWTAPAAQ  646



>ref|XP_008668482.1| PREDICTED: uncharacterized protein LOC100384329 isoform X1 [Zea 
mays]
Length=638

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE+AGG L  WPERLTAVPPRI+SGS++G+T E F  DTELWKKRV HYK V  QL
Sbjct  422  VSDLKEVAGGSLKKWPERLTAVPPRIASGSIEGVTEEMFVEDTELWKKRVGHYKSVIAQL  481

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNAK GGFAAALV+DP+WVMN+VP      TLGV+YERGLIG+Y +WCE
Sbjct  482  GQKGRYRNLLDMNAKFGGFAAALVNDPLWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCE  541

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLY  RCE E+ILLEMDRILRP+G+V+IRDDVD++V +KS+A
Sbjct  542  GMSTYPRTYDLIHADTVFTLYNGRCEAENILLEMDRILRPEGTVIIRDDVDLLVKIKSMA  601

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W++++ DHED P VREK+L+  K YWT D +++
Sbjct  602  DGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLDGSEQ  638



>tpg|DAA36414.1| TPA: hypothetical protein ZEAMMB73_585119 [Zea mays]
Length=651

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 182/217 (84%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE+AGG L  WPERLTAVPPRI+SGS++G+T E F  DTELWKKRV HYK V  QL
Sbjct  435  VSDLKEVAGGSLKKWPERLTAVPPRIASGSIEGVTEEMFVEDTELWKKRVGHYKSVIAQL  494

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNAK GGFAAALV+DP+WVMN+VP      TLGV+YERGLIG+Y +WCE
Sbjct  495  GQKGRYRNLLDMNAKFGGFAAALVNDPLWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCE  554

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLY  RCE E+ILLEMDRILRP+G+V+IRDDVD++V +KS+A
Sbjct  555  GMSTYPRTYDLIHADTVFTLYNGRCEAENILLEMDRILRPEGTVIIRDDVDLLVKIKSMA  614

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W++++ DHED P VREK+L+  K YWT D +++
Sbjct  615  DGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLDGSEQ  651



>gb|EYU19524.1| hypothetical protein MIMGU_mgv1a002864mg [Erythranthe guttata]
Length=629

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS  +E+AGGEL  WP+RL A+PPRIS G+++G+T E F +D +LW +RV++YK V+ QL
Sbjct  413  VSRSEEVAGGELEKWPKRLNAIPPRISKGTINGVTPETFEQDLKLWNRRVSYYKTVNNQL  472

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA L++DP+WVMNVVPVEAKVNTLGV+YERGLIGTY +WCE
Sbjct  473  GQAGRYRNILDMNAFLGGFAANLIEDPLWVMNVVPVEAKVNTLGVIYERGLIGTYQSWCE  532

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLYKDRCE+EDI+LEMDRILRP+GSV+IRDDVD +V VK IA
Sbjct  533  AMSTYPRTYDLIHADSVFTLYKDRCEMEDIMLEMDRILRPEGSVIIRDDVDTLVKVKRIA  592

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DG+ WD+++ DHED P  REK+L A K YWT+
Sbjct  593  DGMNWDSQIVDHEDGPLEREKLLFAVKLYWTS  624



>gb|EPS68701.1| hypothetical protein M569_06064, partial [Genlisea aurea]
Length=638

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 186/217 (86%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V + +++AGGE+ NWP+R TAVPPRIS G+V+GIT+E F +D +LWK+R+++YK V+ QL
Sbjct  422  VESAEDVAGGEVENWPKRATAVPPRISRGTVNGITSETFEQDHKLWKRRISYYKTVNNQL  481

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA L++DP+WVMNVVPV+AK+NTLG++YERGLIGTY NWCE
Sbjct  482  GQAGRYRNILDMNAFLGGFAANLIEDPLWVMNVVPVDAKINTLGIIYERGLIGTYQNWCE  541

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LYK+RCE+EDI+LEMDRILRP+GS++IRDDVD++V VK IA
Sbjct  542  AMSTYPRTYDLIHADSVFSLYKNRCEMEDIMLEMDRILRPEGSLIIRDDVDVLVQVKRIA  601

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            D L WDN++ DHED P  REK+L A K YWTA  + +
Sbjct  602  DALNWDNQIVDHEDGPLEREKLLFAVKTYWTAPPSSD  638



>emb|CDP05238.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   330 bits (845),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +EIAGG L  WP+RL A+PPRIS+G+V+GIT + F +D++LW++R+++YK V+ QL
Sbjct  432  VSDGEEIAGGRLEKWPKRLNAMPPRISTGTVNGITPQTFQKDSQLWERRISYYKTVNNQL  491

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA+LV+DPVWVMNV+PVEAKVNTLGV+YERGLIGTY +WCE
Sbjct  492  GQAGRYRNLLDMNAFLGGFAASLVEDPVWVMNVIPVEAKVNTLGVIYERGLIGTYQSWCE  551

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD + TLYKDRCE+EDILLEMDRILRP+GS++IRDDVD +V  K IA
Sbjct  552  AMSTYPRTYDLIHADSVLTLYKDRCEMEDILLEMDRILRPEGSLIIRDDVDTLVKAKRIA  611

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            D L WD+++ DHED P  REK+L A K YWTA  + +  ++ +
Sbjct  612  DALNWDSQIVDHEDGPLEREKLLFAVKSYWTAPASSDQDDSKT  654



>ref|XP_010506552.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG+L  WP RL AVPPR++ G ++ IT E F  +T+LWK+RV++YK++D+QL E
Sbjct  408  DLKTVAGGKLEKWPARLYAVPPRVNKGDLEEITPEAFLDNTKLWKQRVSYYKKLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN++DMNA LGGFAAAL DDPVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAM
Sbjct  468  SGRYRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+ +CE E ILLEMDRILRP G V+IRDDVDI++ VK +  G
Sbjct  528  STYPRTYDFIHADSVFTLYQGKCEPEKILLEMDRILRPGGGVIIRDDVDILIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            LQW+ R+ADHE  PH REKI  A KQYWT    +E  N +S
Sbjct  588  LQWEGRIADHEKGPHEREKIYYAVKQYWTVAAPEEDKNNTS  628



>ref|XP_006397756.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
 gb|ESQ39209.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
Length=632

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPR++SG ++ IT E F  +T+LWK+RV +YK++D+ L E
Sbjct  409  DLKTVAGGKVEKWPARLNAVPPRVNSGDLEEITPEAFLENTKLWKQRVNYYKQLDYHLGE  468

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN+LDMNA LGGFAAAL DDPVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAM
Sbjct  469  TGRYRNLLDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAM  528

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +F+LY+D+CE EDILLEMDRILRP G V+IRDDVDI++ VK +  G
Sbjct  529  STYPRTYDFIHADSVFSLYQDKCEPEDILLEMDRILRPGGGVIIRDDVDILIKVKELTKG  588

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            LQW+ R+ADHE  PH R KI  A KQYWT    +E  N +S
Sbjct  589  LQWEGRIADHEKGPHERVKIYYAVKQYWTVPAPEEDKNNTS  629



>emb|CDY18904.1| BnaC04g04460D [Brassica napus]
Length=633

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG+L  WP RL AVPPR+++G +  IT E F  DTELWK+RV++YK++D+QL E
Sbjct  410  DLKTVAGGKLEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKKLDYQLGE  469

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN+LDMNA LGGFAAAL D+PVWVMNVVPVEAK NTLGV+YERGLIGTY NWCEAM
Sbjct  470  TGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCEAM  529

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+D+CE EDILLEMDR+LRP G V+IRDDVD+++ VK ++ G
Sbjct  530  STYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELSKG  589

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             QW  R+ADHE  PH R KI  A KQYWT    +E  N
Sbjct  590  FQWQGRIADHEKGPHERVKIYYAVKQYWTVPAPEEDKN  627



>gb|KHN15675.1| Putative methyltransferase PMT16 [Glycine soja]
Length=422

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E AGG + NWP+RL ++PPRI  G+++G+TAE +S++ ELWKKRV+HYK V+  L
Sbjct  204  VSSKEETAGGVVDNWPKRLKSIPPRIYKGTIEGVTAETYSKNYELWKKRVSHYKTVNNLL  263

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              + RYRN+LDMNA LGGFAAAL++DPVWVMNVVPV+AKVNTLG +YERGLIG YH+WCE
Sbjct  264  GTE-RYRNLLDMNAYLGGFAAALIEDPVWVMNVVPVQAKVNTLGAIYERGLIGIYHDWCE  322

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY +RCE+EDILLEMDRILRP+G V+IRDD DI+V VKSI 
Sbjct  323  AMSTYPRTYDLIHADSVFSLYSNRCELEDILLEMDRILRPEGCVIIRDDADILVKVKSIV  382

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            +GL+WD+ + DHED P  REK+L A K+YWTA    E +N
Sbjct  383  NGLEWDSIIVDHEDGPLQREKLLFAMKKYWTAPAASEKTN  422



>ref|XP_009142361.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   328 bits (841),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPRI++G +  IT E F  DT+LWK+RV++YK +D+QL E
Sbjct  408  DLKTVAGGKVEKWPARLNAVPPRINNGDLKEITPEGFLGDTKLWKQRVSYYKTLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRNILDMNA +GGFAAAL D+PVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAM
Sbjct  468  TGRYRNILDMNAYVGGFAAALADEPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+D+CE EDILLEMDRILRP G V+IRDDVD+++ VK +  G
Sbjct  528  STYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRILRPGGGVIIRDDVDVLIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            LQW+ R+ADHE SPH R KI  A KQYWT    +E    S+
Sbjct  588  LQWEGRIADHEKSPHERVKIYYAVKQYWTVTAPEEEDKNST  628



>ref|XP_008663475.1| PREDICTED: probable methyltransferase PMT15 [Zea mays]
 gb|AFW59147.1| hypothetical protein ZEAMMB73_843401 [Zea mays]
Length=641

 Score =   328 bits (842),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 181/217 (83%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS++KE+AGG L  WPERLTAVPPRI+SGS++G+T E F  DTELWKKRV HYK V  QL
Sbjct  425  VSDLKEVAGGALKKWPERLTAVPPRIASGSIEGVTEEMFVEDTELWKKRVGHYKSVIAQL  484

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNAK GGFAAALV+DP+WVMN+VP      TLG +YERGLIG+Y +WCE
Sbjct  485  GQKGRYRNLLDMNAKFGGFAAALVNDPLWVMNMVPTVGNSTTLGAIYERGLIGSYQDWCE  544

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLY  RCE ++ILLEMDRILRP+G+V+IRDDVD++V +KSI 
Sbjct  545  GMSTYPRTYDLIHADSLFTLYNGRCEADNILLEMDRILRPEGTVIIRDDVDMLVKIKSIT  604

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W++++ DHED P VREK+L+A K YWT D +++
Sbjct  605  DGMRWNSQIVDHEDGPLVREKLLLAVKTYWTLDDSKQ  641



>ref|XP_008799521.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=639

 Score =   328 bits (841),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 185/222 (83%), Gaps = 2/222 (1%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            +I+++AGGEL  WP RL AVP RI+SGS+DG+T+E F +D+ELWKKRV HYK++   L +
Sbjct  419  SIRDVAGGELKKWPGRLMAVPQRIASGSLDGVTSEMFLQDSELWKKRVEHYKKL-VNLGQ  477

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
            KGRYRN+LDMNA+ GGFAAAL D+ VWVMNVVP  A  NTLGV+YERGLIGTY +WCEAM
Sbjct  478  KGRYRNLLDMNARFGGFAAALADESVWVMNVVPTAANANTLGVIYERGLIGTYQDWCEAM  537

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYD IHAD +FTLYKDRCE+EDILLEMDRILRP+ +V+ RDDVD++V +KSI DG
Sbjct  538  STYPRTYDLIHADSVFTLYKDRCEMEDILLEMDRILRPESTVIFRDDVDVLVKIKSITDG  597

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQEGSNASS  55
            ++W +++ADHED P  REKIL+A K YWTA DQ QE  N ++
Sbjct  598  MRWKSQIADHEDGPLRREKILLAVKDYWTASDQKQEQQNGAA  639



>ref|NP_001056669.2| Os06g0128100 [Oryza sativa Japonica Group]
 dbj|BAF18583.2| Os06g0128100 [Oryza sativa Japonica Group]
Length=230

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 177/213 (83%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSV-DGITAEDFSRDTELWKKRVAHYKRVDFQ  547
            VS   ++AGGE+  WPERLT+ PPRI+ GS+   +T + F +D+E+W++RV  YK V   
Sbjct  18   VSGPGDVAGGEVKRWPERLTSPPPRIAGGSLGSSVTVDTFIKDSEMWRRRVDRYKGVSGG  77

Query  546  LAEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWC  367
            LAEKGRYRN+LDMNA LGGFAAALVDDPVWVMNVVP  A  NTLGV+YERGLIGTY +WC
Sbjct  78   LAEKGRYRNLLDMNAGLGGFAAALVDDPVWVMNVVPTAAVANTLGVIYERGLIGTYQDWC  137

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYD IHA  +FT+YKDRCE+EDILLEMDR+LRP+G+V+ RDDVD++V +K+I
Sbjct  138  EAMSTYPRTYDLIHAYSLFTMYKDRCEMEDILLEMDRVLRPEGTVIFRDDVDVLVKIKNI  197

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            ADG++W++R+ DHED P  REKIL++ K YWTA
Sbjct  198  ADGMRWESRIVDHEDGPMQREKILVSVKSYWTA  230



>emb|CDY37061.1| BnaA04g26390D [Brassica napus]
Length=628

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 178/215 (83%), Gaps = 0/215 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPRI++G +  IT E F  DT+LWK+RV++YK +D+QL E
Sbjct  408  DLKTVAGGKVEKWPTRLNAVPPRINTGDLKEITPEGFLGDTKLWKQRVSYYKTLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRNILDMNA +GGFAAAL D+PVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAM
Sbjct  468  TGRYRNILDMNAYVGGFAAALADEPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+D+CE EDILLEMDRILRP G V+IRDDVD+++ VK +  G
Sbjct  528  STYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRILRPGGGVIIRDDVDVLIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            LQW+ R+ADHE SPH R KI  A KQYWT    +E
Sbjct  588  LQWEGRIADHEKSPHERVKIYYAVKQYWTVTAPEE  622



>ref|XP_010055225.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Eucalyptus 
grandis]
 gb|KCW71693.1| hypothetical protein EUGRSUZ_E00212 [Eucalyptus grandis]
Length=637

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 181/211 (86%), Gaps = 0/211 (0%)
 Frame = -1

Query  720  SNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLA  541
            +NIK +AGG L  WPERL +VPPRISSGS++GIT + F  +T  WK RV HYK +D QLA
Sbjct  420  NNIKVVAGGGLVRWPERLMSVPPRISSGSLEGITEKTFIENTAAWKTRVLHYKSLDSQLA  479

Query  540  EKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEA  361
            E GRYRN+LDMN+ LGGFAAALVDDPVWVMN+VPVEA+VNTLGV+YERGLIGTY +WCEA
Sbjct  480  ELGRYRNLLDMNSYLGGFAAALVDDPVWVMNIVPVEARVNTLGVIYERGLIGTYQSWCEA  539

Query  360  MSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIAD  181
            MSTYPRTYD IHA+ +FTLY+DRCE+EDILLEMDRILRP+GS++ RDD+D++V +K   D
Sbjct  540  MSTYPRTYDLIHANSVFTLYRDRCEMEDILLEMDRILRPEGSIIFRDDMDVLVKIKDAID  599

Query  180  GLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            G+Q+D+++ DHE+ P  REKIL+A KQYWT+
Sbjct  600  GMQYDSKITDHENGPLEREKILLAVKQYWTS  630



>ref|XP_012090301.1| PREDICTED: probable methyltransferase PMT16 [Jatropha curcas]
 gb|KDP22318.1| hypothetical protein JCGZ_26149 [Jatropha curcas]
Length=652

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E+AGG+L  WPERL A+PPRIS+G+V+G+T E F  + +LW KR+ +YK V+ QL
Sbjct  429  VSNSQEVAGGKLRKWPERLNAIPPRISTGNVEGVTPEIFENEIQLWNKRMEYYKAVNNQL  488

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRN+LDMNA LGGFAAAL+DDPVWVMNVVPV+AKVNTLG++Y+RGLIGTY +WCE
Sbjct  489  AQAGRYRNLLDMNAYLGGFAAALIDDPVWVMNVVPVQAKVNTLGIIYDRGLIGTYQDWCE  548

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHA+ +F+LY+ RCE+EDILLEMDRILRP+GSV++RDDVD++V++K I 
Sbjct  549  AMSTYPRTYDLIHANSVFSLYQGRCEMEDILLEMDRILRPEGSVILRDDVDVLVNIKKIT  608

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT--ADQNQEGSNAS  58
            DGL W++++ DHED P  REK+  A K YWT  A+ +Q GS +S
Sbjct  609  DGLNWESQIVDHEDGPLQREKLFFAVKSYWTAPAEHDQIGSISS  652



>gb|ABV72578.1| dehydration-responsive family protein S51 [Brassica rapa]
Length=632

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPR+++G +  IT E F  DTELWK+RV++YK++D+QL E
Sbjct  409  DLKTVAGGKVEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKKLDYQLGE  468

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN+LDMNA LGGFAAAL D+PVWVMNVVPVEAK NTLGV+YERGLIGTY NWCEAM
Sbjct  469  TGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCEAM  528

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+D+CE EDILLEMDR+LRP G V+IRDDVD+++ VK ++ G
Sbjct  529  STYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELSKG  588

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             QW  R+ADHE  PH R KI  A KQYWT    +E  N
Sbjct  589  FQWQGRIADHEKGPHERVKIYYAVKQYWTVPAPEEDKN  626



>gb|EYU25067.1| hypothetical protein MIMGU_mgv1a004954mg [Erythranthe guttata]
Length=503

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN  EIAGGEL  WP RL  VPPRI  G++ G+T E F +D +LWKKRV++YK V+ QL
Sbjct  288  VSNNDEIAGGELEKWPRRLNTVPPRIIRGTIQGVTPEIFQQDLQLWKKRVSYYKTVNNQL  347

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA LV DP+WVMN+VPVEAKVNTLGV+YERGLIGTY +WCE
Sbjct  348  GQAGRYRNILDMNAFLGGFAANLVKDPLWVMNIVPVEAKVNTLGVIYERGLIGTYQSWCE  407

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLYK+RCE+EDI+LEMDRILRP+GS++IRDDVD +V  K IA
Sbjct  408  AMSTYPRTYDLIHADSVFTLYKERCEMEDIMLEMDRILRPEGSLIIRDDVDELVKAKRIA  467

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DGL W++++ DHED P  REK+L A K YWTA
Sbjct  468  DGLNWESQIVDHEDGPLEREKLLFAVKLYWTA  499



>ref|XP_009143165.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPR+++G +  IT E F  DTELWK+RV++YK++D+QL E
Sbjct  409  DLKTVAGGKVEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKKLDYQLGE  468

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN+LDMNA LGGFAAAL D+PVWVMNVVPVEAK NTLGV+YERGLIGTY NWCEAM
Sbjct  469  TGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCEAM  528

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+D+CE EDILLEMDR+LRP G V+IRDDVD+++ VK ++ G
Sbjct  529  STYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELSKG  588

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             QW  R+ADHE  PH R KI  A KQYWT    +E  N
Sbjct  589  FQWQGRIADHEKGPHERVKIYYAVKQYWTVPAPEEDKN  626



>emb|CDX74761.1| BnaA05g05070D [Brassica napus]
Length=632

 Score =   327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 177/218 (81%), Gaps = 0/218 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPR+++G +  IT E F  DTELWK+RV++YK++D+QL E
Sbjct  409  DLKTVAGGKVEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKKLDYQLGE  468

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN+LDMNA LGGFAAAL D+PVWVMNVVPVEAK NTLGV+YERGLIGTY NWCEAM
Sbjct  469  TGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCEAM  528

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+D+CE EDILLEMDR+LRP G V+IRDDVD+++ VK ++ G
Sbjct  529  STYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELSKG  588

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             QW  R+ADHE  PH R KI  A KQYWT    +E  N
Sbjct  589  FQWQGRIADHEKGPHERVKIYYAVKQYWTVPAPEEDKN  626



>ref|XP_004515722.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=649

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 184/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E AGG L+NWP+RL + PPRIS G++ G+T + FS+D ELW KRV++YK+V+ QL
Sbjct  430  VSNKEETAGGALSNWPQRLKSTPPRISKGTIKGVTPQTFSKDNELWNKRVSYYKKVNNQL  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMN  LGGFAA+LV+ P+WVMNVVP++AKV+TLG +YERGLIG YHNWCE
Sbjct  490  GKAGRYRNLLDMNGYLGGFAASLVNYPIWVMNVVPIQAKVDTLGAIYERGLIGMYHNWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY DRCE+EDILLEMDRILRP+GSV+IRDDVDI+V VKSI 
Sbjct  550  AMSTYPRTYDLIHADYVFSLYNDRCELEDILLEMDRILRPEGSVIIRDDVDILVKVKSII  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
            +G+ W++++ DHED P  REK+L A K+YWT+  + + +
Sbjct  610  NGMNWESQIVDHEDGPLEREKLLFAVKKYWTSPLSNDNT  648



>dbj|BAJ87212.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   327 bits (837),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 181/217 (83%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IKE+AGGEL  WP+RLTAVPPRI+SGS +G+TAE F+ DT+LWKKRV HYK V  Q 
Sbjct  415  VSDIKEVAGGELKKWPQRLTAVPPRIASGSFEGVTAEMFNEDTKLWKKRVGHYKSVVSQF  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+ GGFAAAL  DP+WVMN+VP      TLGV+YERGLIG Y +WCE
Sbjct  475  GQKGRYRNLLDMNARFGGFAAALAGDPMWVMNMVPTIGNSTTLGVIYERGLIGNYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +F+LYKDRCE++ ILLEMDRILRP+G+V+IRDDVD++V +KS+A
Sbjct  535  GMSTYPRTYDLIHADSVFSLYKDRCEMDTILLEMDRILRPEGTVIIRDDVDLLVKIKSVA  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQNQ  76
            DG++W++++ DHED P VREK+L+  K YWT  D+ Q
Sbjct  595  DGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLGDEKQ  631



>dbj|BAJ84848.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   326 bits (836),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 181/217 (83%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IKE+AGGEL  WP+RLTAVPPRI+SGS +G+TAE F+ DT+LWKKRV HYK V  Q 
Sbjct  415  VSDIKEVAGGELKRWPQRLTAVPPRIASGSFEGVTAEMFNEDTKLWKKRVGHYKSVVSQF  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+ GGFAAAL  DP+WVMN+VP      TLGV+YERGLIG Y +WCE
Sbjct  475  GQKGRYRNLLDMNARFGGFAAALAGDPMWVMNMVPTIGNSTTLGVIYERGLIGNYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +F+LYKDRCE++ ILLEMDRILRP+G+V+IRDDVD++V +KS+A
Sbjct  535  GMSTYPRTYDLIHADSVFSLYKDRCEMDTILLEMDRILRPEGTVIIRDDVDLLVKIKSVA  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQNQ  76
            DG++W++++ DHED P VREK+L+  K YWT  D+ Q
Sbjct  595  DGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLGDEKQ  631



>ref|XP_010518192.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   326 bits (836),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 180/223 (81%), Gaps = 0/223 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
              ++K +AGG++  WP RL AVPPR++ G ++ IT E F  +T+LWK+RV++YK++D+QL
Sbjct  406  AGDLKTVAGGKVEKWPARLYAVPPRVNKGDLEEITPEAFLDNTKLWKQRVSYYKKLDYQL  465

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             E GRYRN++DMNA LGGFAAAL DDPVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCE
Sbjct  466  GESGRYRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCE  525

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +FTLY+ +CE E ILLEMDRILRP G V+IRDDVDI++ VK + 
Sbjct  526  AMSTYPRTYDFIHADSVFTLYQGKCEPEKILLEMDRILRPGGGVIIRDDVDILIKVKILT  585

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
             GLQW+ R+ADHE  PH REKI  A KQYWT    +E  N +S
Sbjct  586  KGLQWEGRIADHEKGPHEREKIYYAVKQYWTVAAPEEDKNNTS  628



>ref|NP_182099.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
 sp|O80844.1|PMTG_ARATH RecName: Full=Probable methyltransferase PMT16 [Arabidopsis thaliana]
 gb|AAC28550.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10597.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
Length=631

 Score =   326 bits (836),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 181/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL A+PPR++ G+++ IT E F  +T+LWK+RV++YK++D+QL E
Sbjct  408  DLKTVAGGKVEKWPARLNAIPPRVNKGALEEITPEAFLENTKLWKQRVSYYKKLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN++DMNA LGGFAAAL DDPVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAM
Sbjct  468  TGRYRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+ +CE E+ILLEMDRILRP G V+IRDDVD+++ VK +  G
Sbjct  528  STYPRTYDFIHADSVFTLYQGQCEPEEILLEMDRILRPGGGVIIRDDVDVLIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            L+W+ R+ADHE  PH REKI  A KQYWT     E  N +S
Sbjct  588  LEWEGRIADHEKGPHEREKIYYAVKQYWTVPAPDEDKNNTS  628



>ref|XP_006365768.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=637

 Score =   326 bits (835),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 183/219 (84%), Gaps = 0/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGG+L  WP+RL A+PPRISSG+V G+TA  F +D++LW+KRV++YK VD +L
Sbjct  416  VSSDEDVAGGQLEKWPKRLNAIPPRISSGTVKGVTAGSFEKDSQLWQKRVSYYKSVDDKL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAA  VDDPVWVMN+VP EA+VNTLGV+YERGLIGTY +WCE
Sbjct  476  NQPGRYRNLLDMNANLGGFAANWVDDPVWVMNIVPAEAEVNTLGVIYERGLIGTYQSWCE  535

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD IFT+YK+RC++EDILLEMDRILRP+GS++IR+DVDI+V VK I 
Sbjct  536  AMSTYPRTYDLLHADSIFTMYKERCDMEDILLEMDRILRPEGSIIIREDVDILVEVKRIV  595

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
            DGL W++ + DHED P  REK+L A K YWTA  N   S
Sbjct  596  DGLNWESLIVDHEDGPMEREKLLFAVKTYWTAPANTTTS  634



>ref|XP_009626220.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=650

 Score =   326 bits (836),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 184/216 (85%), Gaps = 0/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E+AGG++  WP+RL  +PPRIS G+++G+T EDF +D++LWK+RV++YK V+ QL
Sbjct  433  VSSEEEVAGGQVEKWPKRLHEIPPRISRGTINGVTEEDFQKDSQLWKRRVSYYKSVNSQL  492

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +  RYRNILDMNA LGGFAA LVDDPVWVMN+VPVEAKVNTLGV+YERGLIGTY +WCE
Sbjct  493  DQPERYRNILDMNAFLGGFAAKLVDDPVWVMNIVPVEAKVNTLGVIYERGLIGTYQSWCE  552

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLY++RCE+E+I+LE+DRILRP+GSV+IRDDVDI++ +K I 
Sbjct  553  AMSTYPRTYDLIHADSVFTLYENRCEMENIMLELDRILRPEGSVIIRDDVDILIKLKRIG  612

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            DGL WD+++ DHED P  REK+L A K YWTA   Q
Sbjct  613  DGLNWDSQIIDHEDGPLEREKLLFAVKSYWTAPTAQ  648



>ref|XP_010559094.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=620

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            ++ + E+   +L  WP RL AVPPRISSG V+GIT + F  +T+LWK RV++YK +D QL
Sbjct  398  LTPLPEVRETKLEKWPARLNAVPPRISSGQVEGITKDIFLENTQLWKTRVSYYKTLDNQL  457

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            AE+GRYRN+LDMNA LGGFAAALVDDPVWVMN+VPVE+ VNTLGVVYERGLIGTY NWCE
Sbjct  458  AERGRYRNLLDMNAYLGGFAAALVDDPVWVMNIVPVESSVNTLGVVYERGLIGTYQNWCE  517

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY+++CE EDIL+EMDRILRP G ++IRDDVDI++ V  I 
Sbjct  518  AMSTYPRTYDFIHADSVFSLYREKCEPEDILVEMDRILRPGGGIIIRDDVDILIQVSRIT  577

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
             GLQW  R+ADHE  PH REKIL A KQYWTA +
Sbjct  578  KGLQWQGRIADHEKGPHQREKILYAVKQYWTAPE  611



>ref|XP_010508116.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 180/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPR++ G ++ IT E F  +T+LWK+RV++YK++D+QL E
Sbjct  408  DLKTVAGGKVEKWPARLYAVPPRVNKGDLEEITPEAFLDNTKLWKQRVSYYKKLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN++DMNA LGGFAAAL DDPVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAM
Sbjct  468  SGRYRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHA+ +FTLY+ +CE E ILLEMDRILRP G V+IRDDVD+++ VK +  G
Sbjct  528  STYPRTYDFIHAESVFTLYQGKCEPEKILLEMDRILRPGGGVIIRDDVDVLIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            LQW+ R+ADHE  PH REKI  A KQYWT    +E  N +S
Sbjct  588  LQWEGRIADHEKGPHEREKIYYAVKQYWTVAAPEEDKNNTS  628



>gb|ACN28194.1| unknown [Zea mays]
Length=237

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 177/216 (82%), Gaps = 2/216 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGG +  WP+RLTAVPPR+S G++ G+TA  F++DT LW+KRV HYK V  Q 
Sbjct  11   VSSARDVAGGAVKKWPQRLTAVPPRVSRGTIKGVTARSFAQDTALWRKRVRHYKSVISQF  70

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP      TLG +YERGLIG+Y +W
Sbjct  71   EQKGRYRNVLDMNARLGGFAAALASAGDPLWVMNMVPTVGNTTTLGAIYERGLIGSYQDW  130

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLY++RC+++ ILLEMDRILRP+G+V+IR+DVD++V VKS
Sbjct  131  CEGMSTYPRTYDLIHADSVFTLYRNRCQMDRILLEMDRILRPRGTVIIREDVDLLVKVKS  190

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
            +ADG++W++++ DHED P VREKIL+  K YWTA +
Sbjct  191  LADGMRWESQIVDHEDGPLVREKILLVVKTYWTAHE  226



>ref|XP_002269747.2| PREDICTED: probable methyltransferase PMT15 [Vitis vinifera]
 emb|CBI38771.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V ++K+IAGG L  WPERLT+VPPRI  GSV GITA+ F  DT+ WKKRV +YK  D  L
Sbjct  408  VGHVKDIAGGMLKKWPERLTSVPPRIMRGSVKGITAKIFREDTDKWKKRVTYYKGFDGNL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A  GR+RNILDMNA LGGFAAAL++DP+WVMN+VPVEA++NTLG++YERGLIGTY NWCE
Sbjct  468  AVPGRFRNILDMNAYLGGFAAALINDPLWVMNMVPVEAEINTLGIIYERGLIGTYQNWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIH D +FTLYKDRCE+E+ILLEMDRILRP G+V++RDDVD++V ++SI 
Sbjct  528  AMSTYPRTYDFIHGDSVFTLYKDRCEMENILLEMDRILRPGGTVILRDDVDMVVKIQSII  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD---QNQEGSNAS  58
            + L W++++ DHE+ PH  EKI+ A KQYWTA     +Q+GS  S
Sbjct  588  ERLNWNSKIVDHEEGPHHTEKIVWAVKQYWTAPAAATDQQGSKTS  632



>dbj|BAJ95401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   323 bits (829),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 180/217 (83%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IKE+AGGEL  WP+RLTAVPPRI+SGS +G+TAE F+ DT+LWKKRV HYK V  Q 
Sbjct  415  VSDIKEVAGGELKKWPQRLTAVPPRIASGSFEGVTAEMFNEDTKLWKKRVGHYKSVVSQF  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRY N+LDMNA+ GGFAAAL  DP+WVMN+VP      TLGV+YERGLIG Y +WCE
Sbjct  475  GQKGRYCNLLDMNARFGGFAAALAGDPMWVMNMVPTIGNSTTLGVIYERGLIGNYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +F+LYKDRCE++ ILLEMDRILRP+G+V+IRDDVD++V +KS+A
Sbjct  535  GMSTYPRTYDLIHADSVFSLYKDRCEMDTILLEMDRILRPEGTVIIRDDVDLLVKIKSVA  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQNQ  76
            DG++W++++ DHED P VREK+L+  K YWT  D+ Q
Sbjct  595  DGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLGDEKQ  631



>ref|XP_008795397.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=629

 Score =   323 bits (829),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 185/215 (86%), Gaps = 2/215 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +I+++AGGEL  WPERL AVPPRISSGS++G+T E F +DTELWKKRV +YK++   L
Sbjct  416  VDSIQDMAGGELKRWPERLVAVPPRISSGSLNGVTDEMFFQDTELWKKRVGYYKKL-LNL  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             EKGRYRN+LDMNA+ GGFAAA++D+PVWVMNVVP  A  +TLGV+YERGLIGTY +WCE
Sbjct  475  GEKGRYRNLLDMNAQFGGFAAAMIDEPVWVMNVVPTAANSSTLGVIYERGLIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +FTLYKDRC++EDILLEMDRILRP+G+V+ RDDVD++V ++SI 
Sbjct  535  AMSTYPRTYDLLHADSVFTLYKDRCQMEDILLEMDRILRPEGTVIFRDDVDVLVKIRSIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQ  82
            +G++W +++ADHED P  +EKIL+A K YWT +DQ
Sbjct  595  NGMRWKSQIADHEDGPRQKEKILLAVKDYWTLSDQ  629



>ref|XP_006293834.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
 gb|EOA26732.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
Length=631

 Score =   323 bits (829),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 179/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG+L  WP RL A+PPR++ G +  IT E F  +T+LW++RV++YK++D+QL E
Sbjct  408  DLKTVAGGKLEKWPARLNAIPPRVNKGELTEITPEAFLENTKLWEQRVSYYKKLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN++DMNA LGGFAAAL DDPVWVMN+VPVEAK NTLGV+YERGLIGTY NWCEAM
Sbjct  468  TGRYRNLVDMNAYLGGFAAALADDPVWVMNIVPVEAKRNTLGVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FT+Y+ +CE E+ILLEMDRILRP G V+IRDDVD+++ VK +  G
Sbjct  528  STYPRTYDFIHADSVFTMYQGKCEPEEILLEMDRILRPGGGVIIRDDVDVLIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            LQW+ R+ADHE  PH REKI  A KQYWT    ++  N +S
Sbjct  588  LQWEGRIADHEKGPHEREKIYYAVKQYWTVPAPEDDKNNTS  628



>ref|XP_008439398.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=603

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 181/223 (81%), Gaps = 5/223 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN KEIAGG+LA WPERL A+P RIS G+V+G+T E F  D+ELWKKR+ +Y+ ++ QL
Sbjct  378  VSNSKEIAGGKLARWPERLNAIPQRISRGTVEGVTEETFIHDSELWKKRLTYYRTINNQL  437

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN LDMNA LGGFAAALVDDPVWVMNVVPV+ KVNTLGV+Y+RGLIGTY +WCE
Sbjct  438  NKPGRYRNFLDMNAFLGGFAAALVDDPVWVMNVVPVDVKVNTLGVIYDRGLIGTYQDWCE  497

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LYK+RCE+EDILLEMDR LRP+GSV+ R+++D++V +K I 
Sbjct  498  AMSTYPRTYDFIHADSVFSLYKNRCEMEDILLEMDRTLRPEGSVIFRENIDVLVKIKMIT  557

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA-----DQNQEG  70
            D L W +++  HED P+  EK+L A K YWTA     DQ QE 
Sbjct  558  DNLNWSSQIVHHEDGPYHMEKLLFAVKNYWTAPPELSDQQQES  600



>ref|XP_004228448.2| PREDICTED: probable methyltransferase PMT15, partial [Solanum 
lycopersicum]
Length=637

 Score =   323 bits (829),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +++AGG+L  WP+RL A+PPRISSGSV G+TA  F +D++LW+KRV++YK +D +L
Sbjct  413  VTSEEDVAGGQLEKWPKRLNAIPPRISSGSVKGVTAGSFEKDSQLWRKRVSYYKSIDNKL  472

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GR+RN+LDMNA LGGFAA+ VDDPVWVMN+VP EA+VNTLGV+YERGLIGTY +WCE
Sbjct  473  NQPGRFRNLLDMNANLGGFAASWVDDPVWVMNIVPAEAEVNTLGVIYERGLIGTYQSWCE  532

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD IFT+YK+RC+++DILLEMDRILRP+GS++IR+DVDI+V VK I 
Sbjct  533  AMSTYPRTYDLLHADSIFTMYKERCDMDDILLEMDRILRPEGSIIIREDVDILVEVKRIV  592

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQN  79
            DGL W++ + DHED P  REK+L   K YWTA  N
Sbjct  593  DGLNWESLIVDHEDGPMEREKLLFGVKTYWTAPAN  627



>ref|XP_010061323.1| PREDICTED: probable methyltransferase PMT16 [Eucalyptus grandis]
 gb|KCW90733.1| hypothetical protein EUGRSUZ_A02808 [Eucalyptus grandis]
Length=605

 Score =   322 bits (826),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 182/222 (82%), Gaps = 0/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V + +EI+GGELANWPERL  +PPRIS G++ GITAE F R+T LW++RV++YK V+ QL
Sbjct  384  VKDGQEISGGELANWPERLNTIPPRISKGTLPGITAEIFQRETALWERRVSYYKTVNNQL  443

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRN+LDMNA LGGFAA LV DPVWV+NVVPVEAKVNTLG +YERGLIGTYH+WC+
Sbjct  444  GLPGRYRNLLDMNAYLGGFAATLVQDPVWVLNVVPVEAKVNTLGAIYERGLIGTYHSWCK  503

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPR YD IHAD +F+LY+DRCE++DILLEMDR+LRP+GS ++RDDVD++V VK I 
Sbjct  504  AMSTYPRAYDLIHADSLFSLYQDRCELDDILLEMDRVLRPEGSFILRDDVDMLVKVKRII  563

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNAS  58
            D + +D+++ DHED P VREK+L A K YWTA    +  + S
Sbjct  564  DTMNYDSQIVDHEDGPLVREKLLFAVKSYWTASAPSDDPHTS  605



>ref|XP_003555372.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=600

 Score =   322 bits (825),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 183/220 (83%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E AGG + NWP+RL ++PPRI  G+++G+TAE +S++ ELWKKRV+HYK V+  L
Sbjct  382  VSSKEETAGGVVDNWPKRLKSIPPRIYKGTIEGVTAETYSKNYELWKKRVSHYKTVNNLL  441

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              + RYRN+LDMNA LGGFAAAL++DPVWVMNVVPV+AKVNTLG +YERGLIG YH+WCE
Sbjct  442  GTE-RYRNLLDMNAYLGGFAAALIEDPVWVMNVVPVQAKVNTLGAIYERGLIGIYHDWCE  500

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY +RCE+EDILLEMDRILRP+G V+IRDD DI+V VKSI 
Sbjct  501  AMSTYPRTYDLIHADSVFSLYSNRCELEDILLEMDRILRPEGCVIIRDDADILVKVKSIV  560

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            +GL+WD+ + DHED P  REK+L A K+YWTA    E +N
Sbjct  561  NGLEWDSIIVDHEDGPLQREKLLFAMKKYWTAPAASEKTN  600



>ref|XP_006340522.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=654

 Score =   323 bits (829),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 182/216 (84%), Gaps = 0/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +E+AGG+L  WP+RL  +PPRIS G+VDG+T E F +D++LWK+RV++YK V+ QL
Sbjct  434  VASEEEVAGGQLEKWPKRLHVIPPRISRGTVDGVTEEVFQKDSQLWKRRVSYYKSVNNQL  493

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA LV+DPVWVMN+VP+EAKVNTLG +YERGLIGTY +WCE
Sbjct  494  DQPGRYRNILDMNAFLGGFAANLVNDPVWVMNIVPLEAKVNTLGAIYERGLIGTYQSWCE  553

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLY++RCE+EDI+LE+DRILRP+GSV+IRDDVDI++ VK IA
Sbjct  554  AMSTYPRTYDLIHADSVFTLYENRCEMEDIMLELDRILRPEGSVIIRDDVDILIRVKRIA  613

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            DGL WD+++ DHED P  REK+  A K Y TA   Q
Sbjct  614  DGLNWDSQIVDHEDGPLEREKLFFAVKTYSTAPATQ  649



>ref|XP_004140852.1| PREDICTED: probable methyltransferase PMT15 [Cucumis sativus]
 gb|KGN57350.1| hypothetical protein Csa_3G180380 [Cucumis sativus]
Length=604

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 181/223 (81%), Gaps = 5/223 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN KEIAGG+LA WPERL A+P RIS G+V+G+T E F  D+ELWKKR+ +Y+ ++ QL
Sbjct  379  VSNSKEIAGGKLARWPERLNAIPQRISRGTVEGVTEETFIHDSELWKKRLTYYRTINNQL  438

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN LDMNA LGGFAAALVDDPVWVMNVVPV+AKVNTLGV+Y+RGLIGTY +WCE
Sbjct  439  NKPGRYRNFLDMNAFLGGFAAALVDDPVWVMNVVPVDAKVNTLGVIYDRGLIGTYQDWCE  498

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYDFIHAD +F+LY++RCE+EDILLEMDRILRP+GSV+ R+++D +  +K I 
Sbjct  499  AMSTYPRTYDFIHADSVFSLYENRCEMEDILLEMDRILRPEGSVIFRENIDTLAKIKMIT  558

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA-----DQNQEG  70
            D L W +++  HED P+  EK+L A K YWTA     DQ QE 
Sbjct  559  DNLNWSSQIVHHEDGPYHMEKLLFAVKNYWTAPPELSDQQQES  601



>ref|XP_004240739.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Solanum 
lycopersicum]
Length=651

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 182/221 (82%), Gaps = 0/221 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +++AGG+L  WP+RL A+PPRIS G+VDG+TAE F +D+ELWK+RV++YK V+ QL
Sbjct  431  VASEEDLAGGQLEKWPKRLNAIPPRISRGTVDGVTAEVFQKDSELWKRRVSYYKSVNNQL  490

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA LV+DPVWVMN+VPVE K NTLG +YERGLIGTY +WCE
Sbjct  491  DQPGRYRNILDMNAFLGGFAANLVNDPVWVMNIVPVEVKTNTLGAIYERGLIGTYQSWCE  550

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLY++RCE+EDI+LE+DRILRP+GSV+IRDDVDI++ VK IA
Sbjct  551  AMSTYPRTYDLIHADSVFTLYENRCEMEDIVLELDRILRPEGSVIIRDDVDILIRVKRIA  610

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNA  61
            DGL WD+ + DHED P  REK+  A K Y TA   Q    +
Sbjct  611  DGLNWDSLIVDHEDGPLEREKLFFAVKTYSTAPATQPSKTS  651



>ref|XP_003592303.1| hypothetical protein MTR_1g101370 [Medicago truncatula]
 gb|AES62554.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=634

 Score =   322 bits (824),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 182/211 (86%), Gaps = 1/211 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E AGG L NWP+RL +VPPRI  G+++G+T+E +S+D ELWKKR+ HYK+V+ QL
Sbjct  409  VSNKEETAGGVLKNWPQRLESVPPRIHMGTIEGVTSEGYSKDNELWKKRIPHYKKVNNQL  468

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              K RYRN++DMNA LGGFA+ALV +PVWVMNVVPV+AKV+TLG +YERGLIGTYH+WCE
Sbjct  469  GTK-RYRNLVDMNANLGGFASALVKNPVWVMNVVPVQAKVDTLGAIYERGLIGTYHDWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +F+LY  RCE+EDI+LEMDRILRP+G+++IRDDVD+++ VK+IA
Sbjct  528  AMSTYPRTYDLIHADSLFSLYNGRCELEDIMLEMDRILRPEGAIIIRDDVDVLLKVKNIA  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT  91
            +GL+WD+ + DHED P  REK+L A K+YWT
Sbjct  588  NGLEWDSSIVDHEDGPLEREKLLFAVKKYWT  618



>emb|CDY27362.1| BnaC04g50430D [Brassica napus]
Length=1009

 Score =   330 bits (846),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPRI+ G +  IT E F  DT+LWK+RV++YK++D+QL E
Sbjct  408  DLKTVAGGKVEKWPARLNAVPPRINKGDLKEITPEGFLEDTKLWKQRVSYYKKLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN+LDMNA +GGFAAAL D+PVWVMNVVPVEAK+NTLGV+YERGLIGTY NWCEAM
Sbjct  468  TGRYRNLLDMNAYVGGFAAALADEPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+D+CE EDILLEMDRILRP G V+IRDDVD+++ VK +  G
Sbjct  528  STYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRILRPGGGVIIRDDVDVLIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            LQW+ R+ADHE SPH R KI  A KQYWT    +E  N
Sbjct  588  LQWEGRIADHEKSPHERVKIYYAVKQYWTVTAPEEDKN  625



>ref|XP_006648932.1| PREDICTED: probable methyltransferase PMT15-like [Oryza brachyantha]
Length=603

 Score =   320 bits (821),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS   E+AGG L  WP+RLTAVPPRIS G+V G+TA+ F++DTELW+KRV HYK V  Q 
Sbjct  387  VSGAGEVAGGALKKWPQRLTAVPPRISRGTVKGVTAKAFAQDTELWRKRVRHYKGVINQF  446

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA LGGFAAAL DDPVWVMN+VP      TLGVVYERGLIG+Y +WCE
Sbjct  447  EQKGRYRNVLDMNAGLGGFAAALADDPVWVMNMVPTVGNSTTLGVVYERGLIGSYQDWCE  506

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IH+D +FTLYK+RCE++ ILLEMDRILRP+G+V+IRDDVD++V VK+ A
Sbjct  507  GMSTYPRTYDLIHSDSVFTLYKNRCEMDAILLEMDRILRPEGTVIIRDDVDMLVKVKNAA  566

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++WD+++ DHED P VREKIL+  K YWTA +  +
Sbjct  567  DGMRWDSQIIDHEDGPLVREKILLVVKTYWTAKEQGQ  603



>ref|XP_010934554.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=608

 Score =   320 bits (820),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 182/217 (84%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+ ++E AGGEL  WP+RL AVPPRISSGS+ G+T + F +DTELWK+RV + K    +L
Sbjct  392  VAGMQEKAGGELEKWPKRLMAVPPRISSGSISGVTPQMFLQDTELWKRRVRYCKAASTEL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KG +RN+LDMN+ LGGFAAA++DDPVWVMN+VP  AK++TLGV+YERGLIGTYH+WCE
Sbjct  452  TQKGTHRNLLDMNSGLGGFAAAMIDDPVWVMNIVPTVAKIDTLGVIYERGLIGTYHDWCE  511

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +FTLYKDRCE+EDILLEMDRILRP+G+V+ RDDVDI+V +KSI 
Sbjct  512  AMSTYPRTYDLLHADSVFTLYKDRCEMEDILLEMDRILRPEGTVIFRDDVDILVRIKSIT  571

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQNQ  76
            DG+ W++R+ DHED P  REK+LIA K  W+ ++Q Q
Sbjct  572  DGMSWNSRIVDHEDGPLQREKLLIAVKANWSISNQTQ  608



>ref|XP_002880195.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56454.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 178/221 (81%), Gaps = 0/221 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            ++K +AGG++  WP RL AVPPR++ G +  IT   F  +T+LWK+RV++YK++D+QL E
Sbjct  408  DLKTVAGGKVEKWPARLNAVPPRVNKGDLKEITPAAFLENTKLWKQRVSYYKKLDYQLGE  467

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRN++DMNA LGGFAAALVDDPVWVMN+VPVEAK+NTL V+YERGLIGTY NWCEAM
Sbjct  468  TGRYRNLVDMNAYLGGFAAALVDDPVWVMNIVPVEAKLNTLSVIYERGLIGTYQNWCEAM  527

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYDFIHAD +FTLY+ +C+ E+ILLEMDRILRP G V+IRDDVD+++ VK +  G
Sbjct  528  STYPRTYDFIHADSVFTLYQGKCKPEEILLEMDRILRPGGGVIIRDDVDVLIKVKELTKG  587

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            L+W+ R+ADHE  PH REKI  A KQYWT     E  N +S
Sbjct  588  LEWEGRIADHEKGPHEREKIYYAVKQYWTVPAPYEDKNNTS  628



>ref|NP_001047721.1| Os02g0675700 [Oryza sativa Japonica Group]
 dbj|BAD29526.1| dehydration-responsive family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF09635.1| Os02g0675700 [Oryza sativa Japonica Group]
 gb|EEE57564.1| hypothetical protein OsJ_07909 [Oryza sativa Japonica Group]
Length=646

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG L  WP+RLTAVPPRIS GS+ G+T++ F +DTELW+KR+ HYK V  Q 
Sbjct  430  VSDASEVAGGALKKWPQRLTAVPPRISRGSIKGVTSKAFVQDTELWRKRIQHYKGVINQF  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA LGGFAAAL  DP+WVMN+VP     +TLGVVYERGLIG+Y +WCE
Sbjct  490  EQKGRYRNVLDMNAGLGGFAAALASDPLWVMNMVPTVGNSSTLGVVYERGLIGSYQDWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLYK+RCE++ ILLEMDRILRP+G+V+IRDDVD++V VKS A
Sbjct  550  GMSTYPRTYDLIHADSVFTLYKNRCEMDIILLEMDRILRPEGTVIIRDDVDMLVKVKSAA  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++WD+++ DHED P VREKIL+  K YWTA +  +
Sbjct  610  DGMRWDSQIVDHEDGPLVREKILLVVKTYWTAKEQDQ  646



>ref|XP_010321993.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Solanum 
lycopersicum]
Length=651

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 180/216 (83%), Gaps = 0/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +++AGG+L  WP+RL A+PPRIS G+VDG+TAE F +D+ELWK+RV++YK V+ QL
Sbjct  431  VASEEDLAGGQLEKWPKRLNAIPPRISRGTVDGVTAEVFQKDSELWKRRVSYYKSVNNQL  490

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAA LV+DPVWVMN+VPVE K NTLG +YERGLIGTY +WCE
Sbjct  491  DQPGRYRNILDMNAFLGGFAANLVNDPVWVMNIVPVEVKTNTLGAIYERGLIGTYQSWCE  550

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD +FTLY++RCE+EDI+LE+DRILRP+GSV+IRDDVDI++ VK IA
Sbjct  551  AMSTYPRTYDLIHADSVFTLYENRCEMEDIVLELDRILRPEGSVIIRDDVDILIRVKRIA  610

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            DGL WD+ + DHED P  REK+  A   Y TA   Q
Sbjct  611  DGLNWDSLIVDHEDGPLEREKLFFAVMTYSTAPATQ  646



>ref|XP_003580353.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=643

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+IK++AGGEL  WP+RLTAVPPRI+SGS+ G+T E F  DT+LW+KRV HYK V  Q 
Sbjct  426  VSDIKKVAGGELKKWPQRLTAVPPRIASGSIAGVTDEMFLEDTKLWRKRVGHYKSVISQF  485

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA  GGFAAALV DP+WVMN+VP      TLGV+YERGLIG Y +WCE
Sbjct  486  GQKGRYRNLLDMNAHFGGFAAALVGDPMWVMNMVPTVGNSTTLGVIYERGLIGNYQDWCE  545

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +F+LYKDRCE++ ILLEMDRILRP+G+V+IRDDVDI+V +KSI 
Sbjct  546  GMSTYPRTYDLIHADSVFSLYKDRCEMDSILLEMDRILRPEGTVIIRDDVDILVKIKSIT  605

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT  91
            DG++W++++ DHED P VREK+L+  K YWT
Sbjct  606  DGMRWNSQVVDHEDGPLVREKLLLVVKTYWT  636



>ref|XP_006656589.1| PREDICTED: probable methyltransferase PMT15-like [Oryza brachyantha]
Length=562

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 175/213 (82%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSV-DGITAEDFSRDTELWKKRVAHYKRVDFQ  547
            VS   E+AGGE+  WPERLTA PPRI+ GS+   +T + F +D E+W++RV  YK V   
Sbjct  350  VSGPGEVAGGEVKRWPERLTAPPPRIAGGSLGSSVTVDTFGKDAEVWRRRVDRYKGVSGG  409

Query  546  LAEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWC  367
            LAEKGRYRN+LDMNA LGGFAAAL  DPVWVMNVVP  A  NTLGV+YERGLIGTY +WC
Sbjct  410  LAEKGRYRNLLDMNAGLGGFAAALAGDPVWVMNVVPTAASANTLGVIYERGLIGTYQDWC  469

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYD IHAD +FT+YKDRCE+EDILLEMDR+LRP+G+V+ RDD+D++V +K+I
Sbjct  470  EAMSTYPRTYDLIHADSLFTMYKDRCEMEDILLEMDRVLRPEGTVIFRDDIDVLVKIKNI  529

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            ADG++W++R+ DHED P  REKIL++ K YWTA
Sbjct  530  ADGMRWESRIVDHEDGPMQREKILVSLKSYWTA  562



>gb|EEC73773.1| hypothetical protein OsI_08448 [Oryza sativa Indica Group]
Length=646

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG L  WP+RLTAVPPRIS GS+ G+T++ F +DTELW+KRV HYK V  Q 
Sbjct  430  VSDASKVAGGALKKWPQRLTAVPPRISRGSIKGVTSKAFVQDTELWRKRVQHYKGVINQF  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA LGGFAAAL  DP+WVMN+VP     +TLGVVYERGLIG+Y +WCE
Sbjct  490  EQKGRYRNVLDMNAGLGGFAAALASDPLWVMNMVPTVGNSSTLGVVYERGLIGSYQDWCE  549

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
             MSTYPRTYD IHAD +FTLYK+RCE++ ILLEMDRILRP+G+V+IRDDVD++V VKS A
Sbjct  550  GMSTYPRTYDLIHADSVFTLYKNRCEMDIILLEMDRILRPEGTVIIRDDVDMLVKVKSAA  609

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++WD+++ DHED P VREKIL+  K YWTA +  +
Sbjct  610  DGMRWDSQIVDHEDGPLVREKILLVVKTYWTAKEQDQ  646



>ref|NP_001141030.1| uncharacterized protein LOC100273109 [Zea mays]
 gb|ACF85221.1| unknown [Zea mays]
Length=350

 Score =   309 bits (791),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 177/216 (82%), Gaps = 2/216 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGG +  WP+RLTAVPPR+S G++ G+TA  F++DT LW+KRV HYK V  Q 
Sbjct  124  VSSARDVAGGAVKKWPQRLTAVPPRVSRGTIKGVTARSFAQDTALWRKRVRHYKSVISQF  183

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP      TLG +YERGLIG+Y +W
Sbjct  184  EQKGRYRNVLDMNARLGGFAAALASAGDPLWVMNMVPTVGNTTTLGAIYERGLIGSYQDW  243

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLY++RC+++ ILLEMDRILRP+G+V+IR+DVD++V VKS
Sbjct  244  CEGMSTYPRTYDLIHADSVFTLYRNRCQMDRILLEMDRILRPRGTVIIREDVDLLVKVKS  303

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
            +ADG++W++++ DHED P VREKIL+  K YWTA +
Sbjct  304  LADGMRWESQIVDHEDGPLVREKILLVVKTYWTAHE  339



>ref|XP_003570093.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=639

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 179/217 (82%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN  E+AGG +  WP+RLTAVPPRIS GS+ G+TA+ F +DTELWK+RV HYK V  Q 
Sbjct  423  VSNADEVAGGAVKKWPQRLTAVPPRISRGSIKGVTAKAFQQDTELWKRRVRHYKAVINQF  482

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA LGGFAAAL + P+WVMN+VP     +TLGV+YERGLIG+Y +WCE
Sbjct  483  EQKGRYRNVLDMNAGLGGFAAALANYPLWVMNMVPTVRNSSTLGVIYERGLIGSYQDWCE  542

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD +HAD +FTLYK RCE++ ILLEMDRILRP+G+V+IRDDVD++V VKS+A
Sbjct  543  GASTYPRTYDLVHADSVFTLYKSRCEMDSILLEMDRILRPEGTVIIRDDVDMLVKVKSVA  602

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQ  76
            DG++WD+++ DHED P VREK+L+  K YWTA DQ+Q
Sbjct  603  DGMRWDSQIVDHEDGPLVREKLLLVVKTYWTAPDQDQ  639



>gb|AFW72783.1| hypothetical protein ZEAMMB73_970285 [Zea mays]
Length=391

 Score =   309 bits (792),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 177/216 (82%), Gaps = 2/216 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGG +  WP+RLTAVPPR+S G++ G+TA  F++DT LW+KRV HYK V  Q 
Sbjct  165  VSSARDVAGGAVKKWPQRLTAVPPRVSRGTIKGVTARSFAQDTALWRKRVRHYKSVISQF  224

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP      TLG +YERGLIG+Y +W
Sbjct  225  EQKGRYRNVLDMNARLGGFAAALASAGDPLWVMNMVPTVGNTTTLGAIYERGLIGSYQDW  284

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLY++RC+++ ILLEMDRILRP+G+V+IR+DVD++V VKS
Sbjct  285  CEGMSTYPRTYDLIHADSVFTLYRNRCQMDRILLEMDRILRPRGTVIIREDVDLLVKVKS  344

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
            +ADG++W++++ DHED P VREKIL+  K YWTA +
Sbjct  345  LADGMRWESQIVDHEDGPLVREKILLVVKTYWTAHE  380



>gb|EAZ35683.1| hypothetical protein OsJ_19971 [Oryza sativa Japonica Group]
Length=605

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 177/213 (83%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSV-DGITAEDFSRDTELWKKRVAHYKRVDFQ  547
            VS   ++AGGE+  WPERLT+ PPRI+ GS+   +T + F +D+E+W++RV  YK V   
Sbjct  393  VSGPGDVAGGEVKRWPERLTSPPPRIAGGSLGSSVTVDTFIKDSEMWRRRVDRYKGVSGG  452

Query  546  LAEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWC  367
            LAEKGRYRN+LDMNA LGGFAAALVDDPVWVMNVVP  A  NTLGV+YERGLIGTY +WC
Sbjct  453  LAEKGRYRNLLDMNAGLGGFAAALVDDPVWVMNVVPTAAVANTLGVIYERGLIGTYQDWC  512

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYD IHA  +FT+YKDRCE+EDILLEMDR+LRP+G+V+ RDDVD++V +K+I
Sbjct  513  EAMSTYPRTYDLIHAYSLFTMYKDRCEMEDILLEMDRVLRPEGTVIFRDDVDVLVKIKNI  572

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            ADG++W++R+ DHED P  REKIL++ K YWTA
Sbjct  573  ADGMRWESRIVDHEDGPMQREKILVSVKSYWTA  605



>ref|XP_004496597.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=623

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E AGG L NWP+RL ++PPRI   ++ G++   FS+D ELWKKRV++YK+V+ QL
Sbjct  407  VSSKEETAGGNLENWPQRLNSIPPRIQKATIKGVSPSAFSKDNELWKKRVSYYKKVNNQL  466

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFA++L++DPVWVMNVVPV+AKVN+LG +YERGLIG YH+WCE
Sbjct  467  GKSGRYRNILDMNAYLGGFASSLIEDPVWVMNVVPVQAKVNSLGAIYERGLIGIYHDWCE  526

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHA  +F+LY  RCE+E I+LEMDRILRP+G+++IRDDVD+++ VKSI 
Sbjct  527  AMSTYPRTYDLIHAGSLFSLYNGRCELEGIMLEMDRILRPEGAIIIRDDVDVLLKVKSIG  586

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DGL+W +++ DHED P  REK+L   K+YWTA
Sbjct  587  DGLEWQSQIVDHEDGPLEREKLLFVVKKYWTA  618



>dbj|BAJ98046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 180/217 (83%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG +  WP+RLTAVPPR+S G+V G+TA+ F +DTELW+KRV HYK V  Q 
Sbjct  429  VSDASEVAGGAVKKWPQRLTAVPPRVSRGTVKGVTAKAFLQDTELWRKRVRHYKAVINQF  488

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+LGGFAAAL   P+WVMN+VP  A  + LGVVYERGLIG+Y +WCE
Sbjct  489  EQKGRYRNVLDMNARLGGFAAALASYPLWVMNMVPTVANSSALGVVYERGLIGSYQDWCE  548

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHAD +FTLY++RCE++ ILLEMDRILRP+G+V+IRDDVDI+V VKS+A
Sbjct  549  GTSTYPRTYDLIHADSVFTLYRNRCEMDTILLEMDRILRPEGTVIIRDDVDILVKVKSVA  608

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++WD+++ DHED P VREKIL+  K YWTA +NQ+
Sbjct  609  DGMRWDSQIVDHEDGPLVREKILLVAKTYWTA-KNQD  644



>dbj|BAC24840.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAD44781.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 gb|EAY99493.1| hypothetical protein OsI_21463 [Oryza sativa Indica Group]
Length=618

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 177/213 (83%), Gaps = 1/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSV-DGITAEDFSRDTELWKKRVAHYKRVDFQ  547
            VS   ++AGGE+  WPERLT+ PPRI+ GS+   +T + F +D+E+W++RV  YK V   
Sbjct  406  VSGPGDVAGGEVKRWPERLTSPPPRIAGGSLGSSVTVDTFIKDSEMWRRRVDRYKGVSGG  465

Query  546  LAEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWC  367
            LAEKGRYRN+LDMNA LGGFAAALVDDPVWVMNVVP  A  NTLGV+YERGLIGTY +WC
Sbjct  466  LAEKGRYRNLLDMNAGLGGFAAALVDDPVWVMNVVPTAAVANTLGVIYERGLIGTYQDWC  525

Query  366  EAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSI  187
            EAMSTYPRTYD IHA  +FT+YKDRCE+EDILLEMDR+LRP+G+V+ RDDVD++V +K+I
Sbjct  526  EAMSTYPRTYDLIHAYSLFTMYKDRCEMEDILLEMDRVLRPEGTVIFRDDVDVLVKIKNI  585

Query  186  ADGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            ADG++W++R+ DHED P  REKIL++ K YWTA
Sbjct  586  ADGMRWESRIVDHEDGPMQREKILVSVKSYWTA  618



>ref|XP_010692380.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSNI ++AGGE++ WP +LTAVPPR+ SGS++GIT + F++DT +WK+R+A+YK ++ +L
Sbjct  407  VSNITQMAGGEVSKWPHKLTAVPPRVYSGSLEGITPDVFTKDTIIWKERLAYYKSLNNEL  466

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN+LDMNA LGGFAAALVDDPVWVMN+VPVEAKVNTLGVV+ERGLIGTY +WCE
Sbjct  467  NDAGRYRNVLDMNANLGGFAAALVDDPVWVMNIVPVEAKVNTLGVVFERGLIGTYQSWCE  526

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HA  +F+LY  RC++EDILLEMDRILRP+G V+ RDD+D++V VK+  
Sbjct  527  AMSTYPRTYDLLHAHSVFSLYDGRCKMEDILLEMDRILRPEGCVIFRDDIDVLVKVKNNI  586

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            + +QW++ + DHE+ P  REK+++A KQYWTA
Sbjct  587  EEMQWNSVIFDHEEGPMQREKVMVAVKQYWTA  618



>ref|XP_002452759.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
 gb|EES05735.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
Length=666

 Score =   314 bits (805),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 180/219 (82%), Gaps = 2/219 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ K++AGG +  WP+RLTAVPPR+S G+V G+TA+ F++DTELW+KRV HYK V  + 
Sbjct  448  VSSAKDVAGGAVKKWPQRLTAVPPRVSRGAVKGVTAKSFAQDTELWRKRVRHYKSVISEF  507

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP      TLG +YERGLIG+Y +W
Sbjct  508  EQKGRYRNVLDMNARLGGFAAALATAGDPLWVMNMVPTVGNTTTLGAIYERGLIGSYQDW  567

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLYK+RCE++ ILLEMDR+LRP+G+V+IR+DVD++V VKS
Sbjct  568  CEGMSTYPRTYDLIHADSVFTLYKNRCEMDRILLEMDRVLRPRGTVIIREDVDMLVKVKS  627

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            +ADG++W++++ DHED P VREKIL+  K YWTA +  +
Sbjct  628  VADGMRWESQIVDHEDGPLVREKILLVVKTYWTAQEQDQ  666



>emb|CDM86771.1| unnamed protein product [Triticum aestivum]
Length=641

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG +  WP+RLTAVPPR+S G+V G+TA+ F +DTELWKKRV HYK V  Q 
Sbjct  427  VSDASEVAGGAVKKWPQRLTAVPPRVSRGTVKGVTAKAFQQDTELWKKRVRHYKAVINQF  486

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMNA+LGGFAAAL   P+WVMN+VP  A  + LGVVYERGLIG+Y +WCE
Sbjct  487  EQKGRYRNVLDMNARLGGFAAALASYPLWVMNMVPAVANSSALGVVYERGLIGSYQDWCE  546

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHAD +FTLYK RCE++ ILLEMDR+LRP+G+V+IRDDVD++V VKS++
Sbjct  547  GTSTYPRTYDLIHADSVFTLYKSRCEMDTILLEMDRVLRPEGTVIIRDDVDMLVKVKSVS  606

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            D ++WD+++ DHED P VREKIL+  K YWTA +NQ
Sbjct  607  DRMRWDSQIVDHEDGPLVREKILLVAKTYWTA-KNQ  641



>gb|ACF85761.1| unknown [Zea mays]
Length=229

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 181/219 (83%), Gaps = 3/219 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            +S   ++AGG +  WP+RLTAVPPR+S G+V G+TA  F++DTELW++RV HYK V  QL
Sbjct  11   ISKASDVAGGAVKRWPQRLTAVPPRVSRGTVRGVTARSFAQDTELWRRRVRHYKSVASQL  70

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP  A   TLG +YERGLIG+Y +W
Sbjct  71   EQKGRYRNVLDMNARLGGFAAALALAGDPLWVMNMVPTVANATTLGAIYERGLIGSYQDW  130

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLYKDRCE++ ILLEMDRILRP+G+V++R+DVD++V VKS
Sbjct  131  CEGMSTYPRTYDLIHADSVFTLYKDRCEMDRILLEMDRILRPRGTVIVREDVDMLVKVKS  190

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQ  76
            +ADG++W++++ DHED P VREKIL+  K YWTA DQ+Q
Sbjct  191  LADGMRWESQIVDHEDGPLVREKILLVVKTYWTAQDQDQ  229



>ref|XP_008800812.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=917

 Score =   318 bits (814),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 174/210 (83%), Gaps = 0/210 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+ ++E AGGEL  WP+RL AVPPRI SGS++G+  + F +DTELWK+RV +YK    +L
Sbjct  389  VAGMQEKAGGELKKWPKRLMAVPPRIGSGSINGVAPKMFLKDTELWKRRVRYYKEASTEL  448

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             +KGRYRN+LDMN+ LGGFA AL+DDPVWVMN+VP  A  +TLGV+YERGLIGTYH+WCE
Sbjct  449  TQKGRYRNLLDMNSGLGGFATALIDDPVWVMNMVPTIATADTLGVIYERGLIGTYHDWCE  508

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD +HAD +FTLYKDRCE+EDILLEMDRILRP+G+V+ RDDVDI+V +KSI 
Sbjct  509  AMSTYPRTYDLLHADLVFTLYKDRCEMEDILLEMDRILRPEGTVIFRDDVDILVGIKSIT  568

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYW  94
            DG++WD R+ DHED P  REK+L A K  W
Sbjct  569  DGMRWDTRIVDHEDGPLQREKLLFAVKLRW  598



>ref|XP_007143370.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
 gb|ESW15364.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
Length=598

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 179/220 (81%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E +GG + +WP+RL ++PPRI   +++G+T E FS+D ELWKKRV++YK V+ +L
Sbjct  380  VSNKEETSGGMVEDWPKRLKSIPPRIYRSTIEGVTDEAFSKDYELWKKRVSYYKTVN-KL  438

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRN+LDMNA LGGFAAAL++DPVWVMNVVPV+AKV+TLG +YERGLIG YH+WCE
Sbjct  439  LGTGRYRNLLDMNAHLGGFAAALIEDPVWVMNVVPVQAKVDTLGSIYERGLIGVYHDWCE  498

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            AMSTYPRTYD IHAD + +LY +RC +EDILLEMDRILRP+G V+IRDDVD++V VKSI 
Sbjct  499  AMSTYPRTYDLIHADSVLSLYSNRCGLEDILLEMDRILRPEGCVIIRDDVDMLVKVKSIV  558

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            +GL+WD+ + DHED    REK+L A K+YWT     + +N
Sbjct  559  NGLEWDSIIVDHEDEHLKREKLLFAVKKYWTTPPASDNTN  598



>gb|KDO82912.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=334

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            ++   E+AGGEL  +PERL A+PPRISSGS+ G++AE +  D+  WKK V  YK+++ +L
Sbjct  117  ITPYPEVAGGELKAFPERLYAIPPRISSGSIPGVSAESYQEDSNKWKKHVNAYKKIN-RL  175

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA  GGFAAA+    +WVMNVVP  A  NTLGV+YERGLIG YH+WCE
Sbjct  176  LDSGRYRNIMDMNAGFGGFAAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCE  235

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C IEDILLEMDRILRP+G+++IRD+VD ++ VK I 
Sbjct  236  AFSTYPRTYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIV  295

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
             G++WD +M DHED P V EKIL+A KQYW A  N   S
Sbjct  296  GGMRWDTKMVDHEDGPLVPEKILVAVKQYWVASGNSTSS  334



>ref|NP_001266897.1| hypothetical protein [Zea mays]
 gb|ACR38585.1| unknown [Zea mays]
 gb|AFW63360.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
Length=384

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 181/219 (83%), Gaps = 3/219 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            +S   ++AGG +  WP+RLTAVPPR+S G+V G+TA  F++DTELW++RV HYK V  QL
Sbjct  166  ISKASDVAGGAVKRWPQRLTAVPPRVSRGTVRGVTARSFAQDTELWRRRVRHYKSVASQL  225

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP  A   TLG +YERGLIG+Y +W
Sbjct  226  EQKGRYRNVLDMNARLGGFAAALALAGDPLWVMNMVPTVANATTLGAIYERGLIGSYQDW  285

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLYKDRCE++ ILLEMDRILRP+G+V++R+DVD++V VKS
Sbjct  286  CEGMSTYPRTYDLIHADSVFTLYKDRCEMDRILLEMDRILRPRGTVIVREDVDMLVKVKS  345

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQ  76
            +ADG++W++++ DHED P VREKIL+  K YWTA DQ+Q
Sbjct  346  LADGMRWESQIVDHEDGPLVREKILLVVKTYWTAQDQDQ  384



>gb|ABR16934.1| unknown [Picea sitchensis]
Length=626

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++I  +AGG L  WP+R+TAVPPRI SGS+ GITAE+F+ D++LW  RVA+YKR+  QL
Sbjct  409  VNDINAVAGGALEKWPKRVTAVPPRIRSGSIPGITAENFNEDSKLWTDRVANYKRLIGQL  468

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LGGFAAAL +DPVWVMNVVP +AK NTLGV+YERG IGTY +WCE
Sbjct  469  GQ-GRYRNIMDMNAGLGGFAAALANDPVWVMNVVPSDAKHNTLGVIYERGFIGTYQDWCE  527

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+ ++Y+DRCEI DILLEMDRILRP+G+V+ RD VD++V V+++ 
Sbjct  528  AFSTYPRTYDLIHASGLLSMYQDRCEISDILLEMDRILRPEGTVIFRDTVDVLVKVENLI  587

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
             G++W ++M DHE  P  +EKILIA KQYWT 
Sbjct  588  GGMRWQSQMMDHESGPFNQEKILIAVKQYWTG  619



>ref|XP_001778231.1| predicted protein [Physcomitrella patens]
 gb|EDQ56898.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 173/222 (78%), Gaps = 1/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V + KE+AGG LA WP RLT VPPRISS S+ G+TAE F  D  LW KRV +Y       
Sbjct  381  VKDTKEVAGGALAKWPVRLTDVPPRISSESIPGLTAESFRNDNLLWTKRVNYYTAHLITP  440

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAALV  PVWVMNV+P +AK+NTLGV+YERGLIGTY NWCE
Sbjct  441  LVSGRYRNIMDMNAGLGGFAAALVKYPVWVMNVMPFDAKLNTLGVIYERGLIGTYQNWCE  500

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC IEDILLEMDRILRP+G+++IRD+VD++ +V  I+
Sbjct  501  AFSTYPRTYDLIHASGVFSMYQDRCNIEDILLEMDRILRPEGAIIIRDEVDVLNNVMMIS  560

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWT-ADQNQEGSNA  61
            +G++W+ R+ADHED P V EKILI  K YW  ++ N+ G++ 
Sbjct  561  NGMRWETRIADHEDGPLVSEKILIGVKTYWVGSNSNKTGAST  602



>gb|KDO82910.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
 gb|KDO82911.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=506

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            ++   E+AGGEL  +PERL A+PPRISSGS+ G++AE +  D+  WKK V  YK+++ +L
Sbjct  289  ITPYPEVAGGELKAFPERLYAIPPRISSGSIPGVSAESYQEDSNKWKKHVNAYKKIN-RL  347

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA  GGFAAA+    +WVMNVVP  A  NTLGV+YERGLIG YH+WCE
Sbjct  348  LDSGRYRNIMDMNAGFGGFAAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCE  407

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C IEDILLEMDRILRP+G+++IRD+VD ++ VK I 
Sbjct  408  AFSTYPRTYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIV  467

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
             G++WD +M DHED P V EKIL+A KQYW A  N   S
Sbjct  468  GGMRWDTKMVDHEDGPLVPEKILVAVKQYWVASGNSTSS  506



>gb|KJB18847.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=386

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG +  WPER  AVPPRI SGS  G+TAE F  D +LWK+RVAHYKR+   L
Sbjct  169  VSSSDDVAGGAIEKWPERAYAVPPRIRSGSTPGVTAERFVEDNKLWKERVAHYKRIISPL  228

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAA+++ PVWVMNVVP+ +  +TLGV+YERGLIGTY +WCE
Sbjct  229  P-TGRYRNIMDMNAYLGGFAAAMLNYPVWVMNVVPINSNHDTLGVIYERGLIGTYQDWCE  287

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+FTLY++RC+I  ILLEMDRILRP+G+V+ RD V+++V ++SI 
Sbjct  288  AFSTYPRTYDLIHASGLFTLYQNRCDITYILLEMDRILRPEGTVIFRDTVELLVKIQSIT  347

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT +  Q+
Sbjct  348  DGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEATQK  384



>ref|XP_001779831.1| predicted protein [Physcomitrella patens]
 gb|EDQ55344.1| predicted protein, partial [Physcomitrella patens]
Length=636

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 167/214 (78%), Gaps = 0/214 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ KE+AGG L  WP RLT VPPRI+SGS+ G+TA+ F  DT LW KRV++YK      
Sbjct  415  VTDTKEVAGGALEKWPARLTTVPPRIASGSIPGMTAKSFRDDTLLWDKRVSYYKTRLVTP  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAA+LV DPVWVMNV+P + K NTLGV+YERGLIGTY NWCE
Sbjct  475  LASGRYRNIMDMNAGLGGFAASLVKDPVWVMNVMPSDVKDNTLGVIYERGLIGTYQNWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I DILLEMDRILRP+G+V+IRD+V+++  V  I+
Sbjct  535  AFSTYPRTYDLIHASGLFSMYQDRCDIVDILLEMDRILRPEGAVIIRDEVEVLNRVMMIS  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
             G++W+ RMADHED P V EKIL+  K YW    
Sbjct  595  QGMRWETRMADHEDGPLVPEKILVGVKTYWVGSS  628



>ref|XP_008677769.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW63363.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
Length=647

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 181/219 (83%), Gaps = 3/219 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            +S   ++AGG +  WP+RLTAVPPR+S G+V G+TA  F++DTELW++RV HYK V  QL
Sbjct  429  ISKASDVAGGAVKRWPQRLTAVPPRVSRGTVRGVTARSFAQDTELWRRRVRHYKSVASQL  488

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP  A   TLG +YERGLIG+Y +W
Sbjct  489  EQKGRYRNVLDMNARLGGFAAALALAGDPLWVMNMVPTVANATTLGAIYERGLIGSYQDW  548

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLYKDRCE++ ILLEMDRILRP+G+V++R+DVD++V VKS
Sbjct  549  CEGMSTYPRTYDLIHADSVFTLYKDRCEMDRILLEMDRILRPRGTVIVREDVDMLVKVKS  608

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQ  76
            +ADG++W++++ DHED P VREKIL+  K YWTA DQ+Q
Sbjct  609  LADGMRWESQIVDHEDGPLVREKILLVVKTYWTAQDQDQ  647



>ref|XP_006438677.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
 ref|XP_006483161.1| PREDICTED: probable methyltransferase PMT2-like [Citrus sinensis]
 gb|ESR51917.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
Length=610

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            ++   E+AGGEL  +PERL A+PPRISSGS+ G++AE +  D+  WKK V  YK+++ +L
Sbjct  393  ITPYPEVAGGELKAFPERLYAIPPRISSGSIPGVSAESYQEDSNKWKKHVNAYKKIN-RL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA  GGFAAA+    +WVMNVVP  A  NTLGV+YERGLIG YH+WCE
Sbjct  452  LDSGRYRNIMDMNAGFGGFAAAIQSPKLWVMNVVPTIADKNTLGVIYERGLIGIYHDWCE  511

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C IEDILLEMDRILRP+G+++IRD+VD ++ VK I 
Sbjct  512  AFSTYPRTYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIV  571

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
             G++WD +M DHED P V EKIL+A KQYW A  N   S
Sbjct  572  GGMRWDTKMVDHEDGPLVPEKILVAVKQYWVASGNSTSS  610



>ref|XP_012067633.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Jatropha 
curcas]
 gb|KDP41191.1| hypothetical protein JCGZ_15598 [Jatropha curcas]
Length=617

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGGEL  +PERL A+PPR++SGS+ G++ E +  D   WKK V  YK+++ +L
Sbjct  399  VSSRDEVAGGELKAFPERLYAIPPRVASGSIPGVSVETYQEDNNKWKKHVKAYKKIN-KL  457

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LGGFAAAL    +WVMNVVP  A  +TLGV+YERGLIG YH+WCE
Sbjct  458  IDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWCE  517

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+G+F+LYKD+C  EDILLEMDRILRP+G+V+ RD+VD+++ V+ I 
Sbjct  518  AFSTYPRTYDLIHANGVFSLYKDKCNTEDILLEMDRILRPEGAVIFRDEVDVLIKVRKIV  577

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
             G++WD +M DHED P V EKIL+A KQYW AD N   S
Sbjct  578  GGMRWDTKMVDHEDGPLVPEKILVAVKQYWVADGNSTSS  616



>ref|XP_010110847.1| putative methyltransferase PMT18 [Morus notabilis]
 gb|EXC28326.1| putative methyltransferase PMT18 [Morus notabilis]
Length=224

 Score =   282 bits (722),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGGEL  WPER  ++PPRI+SGS+ G+T E F  D ++WK+R+ HYKR+    
Sbjct  11   VSSPDEVAGGELEKWPERAFSIPPRITSGSIPGVTPEKFREDDQVWKERLTHYKRII--P  68

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             ++GRYRNI+DMNA LGGFAAAL   PVWVMNVVP  +  +TLGV+YERG IGTY +WCE
Sbjct  69   LQQGRYRNIMDMNAHLGGFAAALSKYPVWVMNVVPANSDQDTLGVIYERGFIGTYQDWCE  128

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I  IL+EMDRILRP+G+V+ RD V+I+V ++SIA
Sbjct  129  AFSTYPRTYDLIHAGGVFSIYQDRCDITHILVEMDRILRPEGTVIFRDTVEILVKIQSIA  188

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
              ++W +++ DHE  P  +EKIL+A K YW A +  
Sbjct  189  KEMRWKSQIMDHESGPFNQEKILVAVKTYWAAHKQH  224



>ref|XP_010933740.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=632

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 173/217 (80%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N +E+AGGEL  WP R  AVPPRIS GS+ G+TAE+F  D ++WK+RV HYKR+   L
Sbjct  416  VNNEEEVAGGELEKWPYRAFAVPPRISRGSIPGVTAENFEEDNQMWKERVTHYKRIVPPL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN++DMNA LGGFAAAL+  PVWVMNVVPV +  +TLGV+YERG IGTY +WCE
Sbjct  476  PQ-GRYRNVMDMNANLGGFAAALIKYPVWVMNVVPVNSDRDTLGVIYERGFIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD +HA+G+F+ Y+DRC+I  ILLEMDRILRPQG+V+IRD V+++  VK+I 
Sbjct  535  AFSTYPRTYDLLHANGVFSTYQDRCDITYILLEMDRILRPQGTVIIRDIVEVLTKVKAIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWTA+ +++
Sbjct  595  DGMRWKSQIMDHESGPFKPEKILVAVKTYWTAEPSKQ  631



>gb|EEE61530.1| hypothetical protein OsJ_15834 [Oryza sativa Japonica Group]
Length=529

 Score =   292 bits (748),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = -1

Query  678  PERLT-AVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAEKGRYRNILDMNA  502
            PER +  + PRI+SGS++G+T E F  DT+LW+KRV HYK V  Q  +KGRYRN+LDMNA
Sbjct  327  PERGSLQLQPRIASGSIEGVTDEMFVEDTKLWQKRVGHYKSVISQFGQKGRYRNLLDMNA  386

Query  501  KLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAMSTYPRTYDFIHA  322
            + GGFAAALVDDPVWVMN+VP      TLGV+YERGLIG+Y +WCE MSTYPRTYD IHA
Sbjct  387  RFGGFAAALVDDPVWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCEGMSTYPRTYDLIHA  446

Query  321  DGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADGLQWDNRMADHED  142
            D +FTLYKDRC++++ILLEMDRILRP+G+V+IRDDVD++V +KSI DG++W++++ DHED
Sbjct  447  DSVFTLYKDRCQMDNILLEMDRILRPEGTVIIRDDVDMLVKIKSITDGMRWNSQIVDHED  506

Query  141  SPHVREKILIANKQYWTADQNQE  73
             P VREK+L+  K YWT  + +E
Sbjct  507  GPLVREKLLLVVKTYWTLGEEKE  529



>ref|XP_004145886.1| PREDICTED: probable methyltransferase PMT18 [Cucumis sativus]
 gb|KGN49950.1| hypothetical protein Csa_5G146240 [Cucumis sativus]
Length=636

 Score =   295 bits (756),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 176/217 (81%), Gaps = 2/217 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +E+AGG + NWPER  AVPPRIS G++ GITAE+F  D +LWK+R+ +YK++   L
Sbjct  417  VNDSEEVAGGAVENWPERALAVPPRISRGTIPGITAENFEEDNKLWKERITYYKKM-IPL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRNI+DMNA LGGFAAALV  PVWVMNVVP  +  +TLGV+YERGLIGTY +WCE
Sbjct  476  AQ-GRYRNIMDMNANLGGFAAALVKFPVWVMNVVPANSDRDTLGVIYERGLIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+GIF++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +++I+
Sbjct  535  AFSTYPRTYDLIHANGIFSIYQDRCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTIS  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT + NQ+
Sbjct  595  DGMKWKSQIMDHETGPFNPEKILVAVKTYWTGETNQQ  631



>gb|KHG10506.1| hypothetical protein F383_11349 [Gossypium arboreum]
Length=616

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 170/215 (79%), Gaps = 1/215 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGGEL  +PERL AVPPRI+SGSV G++ E +  D  +WKK V  YK+++ +L
Sbjct  398  VSSSSEVAGGELKPFPERLFAVPPRIASGSVPGVSVETYEEDNNIWKKHVNAYKKIN-RL  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL    +WVMNV+P  A+ +TLGV+YERGLIG YH+WCE
Sbjct  457  IDSGRYRNILDMNAGLGGFAAALNSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C +EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  517  AFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIT  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQN  79
             G++WD +M DHED P V EK+L+A KQYWT   N
Sbjct  577  AGMRWDTKMVDHEDGPLVPEKVLVAVKQYWTVGGN  611



>gb|KJB60757.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=616

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 170/215 (79%), Gaps = 1/215 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGGEL  +PERL AVPPRI+SGSV GI+ E +  D  +WKK V  YK+++ +L
Sbjct  398  VSSSGEVAGGELKPFPERLFAVPPRIASGSVPGISVETYEEDNNIWKKHVNAYKKIN-RL  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL    +WVMNV+P  A+ +TLGV+YERGLIG YH+WCE
Sbjct  457  IDSGRYRNILDMNAGLGGFAAALNSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C +EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  517  AFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIT  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQN  79
             G++WD +M DHED P V EK+L+A KQYWT   N
Sbjct  577  AGMRWDTKMVDHEDGPLVPEKVLVAVKQYWTVGGN  611



>emb|CDP12267.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN  E+AGG L  WPER  A PPRIS GSV GIT+E F  D E+WK RVA+Y++V   L
Sbjct  429  VSNKDEVAGGALEKWPERAFATPPRISVGSVPGITSEKFREDNEVWKVRVANYRQVVAPL  488

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + G+YRN++DMNA LGGFAAAL   PVWVMNVVP +   +TLG+VYERG IGTYH+WCE
Sbjct  489  GQ-GQYRNVMDMNAFLGGFAAALAKYPVWVMNVVPAKLDPDTLGIVYERGFIGTYHDWCE  547

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHADG+F++Y+DRC+I DILLEMDRILRP+G+V+ RD V+++V +KSI+
Sbjct  548  AFSTYPRTYDLIHADGVFSIYQDRCDITDILLEMDRILRPEGTVIFRDAVEVLVKIKSIS  607

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            DG++W++R+ DHE  P   +KIL+A K YWTA+  +
Sbjct  608  DGMRWESRILDHESGPFNPQKILVAVKNYWTAEAKE  643



>gb|KJB18849.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18850.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18851.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18852.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18853.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18857.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=528

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG +  WPER  AVPPRI SGS  G+TAE F  D +LWK+RVAHYKR+   L
Sbjct  311  VSSSDDVAGGAIEKWPERAYAVPPRIRSGSTPGVTAERFVEDNKLWKERVAHYKRIISPL  370

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAA+++ PVWVMNVVP+ +  +TLGV+YERGLIGTY +WCE
Sbjct  371  P-TGRYRNIMDMNAYLGGFAAAMLNYPVWVMNVVPINSNHDTLGVIYERGLIGTYQDWCE  429

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+FTLY++RC+I  ILLEMDRILRP+G+V+ RD V+++V ++SI 
Sbjct  430  AFSTYPRTYDLIHASGLFTLYQNRCDITYILLEMDRILRPEGTVIFRDTVELLVKIQSIT  489

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT +  Q+
Sbjct  490  DGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEATQK  526



>ref|XP_010917038.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=616

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ KE+AGGEL  +PERL A+PPRISSGSV G + E + +D +LW+K V  YK+V+ +L
Sbjct  397  VNSPKEVAGGELRPFPERLNAIPPRISSGSVPGFSVESYQKDNKLWQKHVKAYKKVN-KL  455

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LG FAAA+    +WVMNVVP  A+++TLGV+YERGLIG YH+WCE
Sbjct  456  LDIGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTIAELSTLGVIYERGLIGIYHDWCE  515

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+G+F++Y+++C++EDILLEMDRILRP+G+++ RDDVD+++ VKS+ 
Sbjct  516  AFSTYPRTYDLIHANGVFSMYQNKCKMEDILLEMDRILRPEGAIIFRDDVDVLIKVKSMV  575

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
             G++W  +MADHED P V EKIL A KQYW      + S
Sbjct  576  SGMRWSTKMADHEDGPLVSEKILFAVKQYWVGGSKNKTS  614



>ref|XP_007039271.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23772.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=630

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 167/219 (76%), Gaps = 1/219 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG +  WPER  AVPPRISSGS+ GITAE F  D ELW  RV HYKR+   L
Sbjct  413  VSSSDDVAGGAVEKWPERAFAVPPRISSGSIPGITAEKFREDNELWNDRVEHYKRI-ISL  471

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAAL+  PVWVMNVVP  +  NTLG +YERGLIGTY +WCE
Sbjct  472  LPTGRYRNIMDMNAYLGGFAAALLKYPVWVMNVVPANSDHNTLGAIYERGLIGTYQDWCE  531

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +KSI 
Sbjct  532  AFSTYPRTYDLIHASGLFSIYQDRCDITYILLEMDRILRPEGTVIFRDSVELLVKIKSIT  591

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
            DG++W +++ DHE  P   EKIL+A K YWT +  ++ S
Sbjct  592  DGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEATEKQS  630



>ref|XP_011624208.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Amborella 
trichopoda]
 gb|ERN08212.1| hypothetical protein AMTR_s00018p00198280 [Amborella trichopoda]
Length=634

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 170/214 (79%), Gaps = 1/214 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG L  WPER  AVPPRI+SGS+ GITAE F  D +LWKKRV HYKR+   L
Sbjct  418  VSDSSEVAGGSLDKWPERAMAVPPRITSGSIPGITAEKFQVDNDLWKKRVRHYKRIIETL  477

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A  GRYRNI+DMNA LGGFAAA+ +DPVWVMNVVP  ++ +TLG++YERG IGTY +WCE
Sbjct  478  AH-GRYRNIMDMNANLGGFAAAMAEDPVWVMNVVPANSEHDTLGMIYERGFIGTYQDWCE  536

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I +ILLEMDRILRP+G+V+ RD V+++V ++ I 
Sbjct  537  AFSTYPRTYDMIHAVGVFSIYQDRCDISNILLEMDRILRPEGTVIFRDTVEVLVKIQGIT  596

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
            +G++W +++ DHE  P   EKIL+A K YWT ++
Sbjct  597  EGMRWKSQIMDHESGPFNPEKILLAVKTYWTGEE  630



>ref|XP_006846537.2| PREDICTED: probable methyltransferase PMT17 isoform X1 [Amborella 
trichopoda]
Length=638

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 170/214 (79%), Gaps = 1/214 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG L  WPER  AVPPRI+SGS+ GITAE F  D +LWKKRV HYKR+   L
Sbjct  422  VSDSSEVAGGSLDKWPERAMAVPPRITSGSIPGITAEKFQVDNDLWKKRVRHYKRIIETL  481

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A  GRYRNI+DMNA LGGFAAA+ +DPVWVMNVVP  ++ +TLG++YERG IGTY +WCE
Sbjct  482  AH-GRYRNIMDMNANLGGFAAAMAEDPVWVMNVVPANSEHDTLGMIYERGFIGTYQDWCE  540

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I +ILLEMDRILRP+G+V+ RD V+++V ++ I 
Sbjct  541  AFSTYPRTYDMIHAVGVFSIYQDRCDISNILLEMDRILRPEGTVIFRDTVEVLVKIQGIT  600

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
            +G++W +++ DHE  P   EKIL+A K YWT ++
Sbjct  601  EGMRWKSQIMDHESGPFNPEKILLAVKTYWTGEE  634



>ref|XP_010529126.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010529127.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG+L  +PERL AVPPRIS G V+G+ AE F  D +LWKKR++ YKRV+ +L
Sbjct  394  VSSEDEVAGGKLKKFPERLFAVPPRISKGQVEGVNAESFEEDNKLWKKRLSTYKRVN-RL  452

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                R+RN++DMNA LGGFAAA+     WVMNV+P  AK NTLGV+YERGLIG YH+WCE
Sbjct  453  IGTTRFRNVMDMNAGLGGFAAAVESPKSWVMNVIPTIAK-NTLGVIYERGLIGIYHDWCE  511

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHA+G+F+LYK+ C+IEDILLEMDRILRP+G+V+ RD+VD++  V+ IA
Sbjct  512  GFSTYPRTYDLIHANGVFSLYKNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRKIA  571

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNA  61
            DG++WD ++ DHED P V EKIL+A KQYW A  N   S++
Sbjct  572  DGMRWDTKLMDHEDGPLVPEKILVAVKQYWVAGGNSTSSSS  612



>gb|KHN06856.1| Putative methyltransferase PMT2 [Glycine soja]
Length=221

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 163/216 (75%), Gaps = 1/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            ++   ++ GG L  +P RL A+PPRI+SG V G+++E +  D + WKK V  YK+ + +L
Sbjct  5    ITPTPKVTGGNLKPFPSRLYAIPPRIASGLVPGVSSETYQDDNKKWKKHVKAYKKTN-RL  63

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LG FAAA+    +WVMNVVP  A+ NTLGV+YERGLIG YH+WCE
Sbjct  64   LDSGRYRNIMDMNAGLGSFAAAIHSSKLWVMNVVPTIAEANTLGVIYERGLIGIYHDWCE  123

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C+ EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  124  AFSTYPRTYDLIHAHGVFSLYKDKCKAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIV  183

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
             G++WD +M DHED P V EK+L+A KQYW  +   
Sbjct  184  GGMRWDTKMVDHEDGPLVPEKVLVAVKQYWVTNSTS  219



>ref|XP_004953430.1| PREDICTED: probable methyltransferase PMT16-like [Setaria italica]
Length=648

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 178/219 (81%), Gaps = 3/219 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS   ++AGG +  WP+RLTAVPPR+S G V G+TA+ F++DTELW+KRV HYK V  Q 
Sbjct  430  VSGASDVAGGAVKKWPQRLTAVPPRVSRGGVRGVTAKSFAQDTELWRKRVRHYKLVIRQF  489

Query  543  AEKGRYRNILDMNAKLGGFAAALVD--DPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNW  370
             +KGRYRN+LDMNA+LGGFAAAL    DP+WVMN+VP      TLG +YERGLIG+Y +W
Sbjct  490  EQKGRYRNVLDMNARLGGFAAALAAAGDPLWVMNMVPTLRNTTTLGAIYERGLIGSYQDW  549

Query  369  CEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKS  190
            CE MSTYPRTYD IHAD +FTLY +RCE++ ILLEMDRILRP+G+V+IRDDVD++V VKS
Sbjct  550  CEGMSTYPRTYDLIHADSVFTLYNNRCEMDRILLEMDRILRPEGTVIIRDDVDMLVKVKS  609

Query  189  IADGLQWDNRMADHEDSPHVREKILIANKQYWTA-DQNQ  76
            +ADG++WD+++ DHED P VREKIL+  K+YWTA DQ Q
Sbjct  610  VADGIRWDSQIVDHEDGPLVREKILLVVKRYWTAQDQGQ  648



>gb|ACF86888.1| unknown [Zea mays]
Length=228

 Score =   280 bits (715),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 162/215 (75%), Gaps = 1/215 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +  ++AGG +  +P RL AVPPRI++G V G++++ F +D ++WKK V  Y  V+  L
Sbjct  11   VKDENDVAGGAIKPFPARLNAVPPRIANGLVPGVSSQAFQKDNKMWKKHVKSYSSVNKYL  70

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA+ GGFAAA+     WVMNVVP  AK+ TLG VYERGLIG YH+WCE
Sbjct  71   LT-GRYRNIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCE  129

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+FTLYK +C +ED+LLEMDRILRP+G+V+IRDDVD++  V S+A
Sbjct  130  AFSTYPRTYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSLA  189

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQN  79
             G++WD +M DHED P VREKIL A KQYW   + 
Sbjct  190  LGMRWDTKMVDHEDGPLVREKILYAVKQYWVGGKQ  224



>ref|XP_001782639.1| predicted protein [Physcomitrella patens]
 gb|EDQ52542.1| predicted protein [Physcomitrella patens]
Length=629

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 171/222 (77%), Gaps = 0/222 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++  E+AGG+LA +P R TA+PPRISSGSV  +TA+ F  DT+LW+KR+ +YK      
Sbjct  403  VTSRSEVAGGKLAKFPARSTAIPPRISSGSVPFMTAQKFKEDTKLWQKRIKYYKTHLIPP  462

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAALV +PVWVMN +P EAKV+TLGV++ERG IGTY NWCE
Sbjct  463  LTNGRYRNIMDMNAGLGGFAAALVKEPVWVMNAMPPEAKVDTLGVIFERGFIGTYQNWCE  522

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHAD +F++Y+DRC+I  +LLEMDRILRP+G+V+IRD+V+I+  V  I 
Sbjct  523  AFSTYPRTYDLIHADKVFSMYQDRCDIVYVLLEMDRILRPEGAVLIRDEVEIVNKVMVIT  582

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNAS  58
             G++W+ R+ADHED P V+EKIL+  K YW  +     + AS
Sbjct  583  QGMRWECRLADHEDGPFVKEKILVCVKNYWVGEIKAANTTAS  624



>gb|KHG23981.1| hypothetical protein F383_09020 [Gossypium arboreum]
Length=616

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 170/216 (79%), Gaps = 1/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E+AGG+L  +PERL AVPPR++SGSV G++ E +  D E WKK V  YK+++ +L
Sbjct  398  VSNPEEVAGGKLKPFPERLYAVPPRVASGSVPGVSVETYQEDNEKWKKHVGAYKKIN-RL  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL    +WVMNV+P  A+ +TLGV++ERGLIG YH+WCE
Sbjct  457  IDSGRYRNILDMNAGLGGFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C +EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  517  AFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIT  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
             G++WD +M DHED P V EKIL+A K+YW    N 
Sbjct  577  AGMRWDTKMVDHEDGPLVPEKILVAVKRYWVVGANS  612



>gb|KJB18848.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18854.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18855.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18856.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
 gb|KJB18859.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=633

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG +  WPER  AVPPRI SGS  G+TAE F  D +LWK+RVAHYKR+   L
Sbjct  416  VSSSDDVAGGAIEKWPERAYAVPPRIRSGSTPGVTAERFVEDNKLWKERVAHYKRIISPL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAA+++ PVWVMNVVP+ +  +TLGV+YERGLIGTY +WCE
Sbjct  476  P-TGRYRNIMDMNAYLGGFAAAMLNYPVWVMNVVPINSNHDTLGVIYERGLIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+FTLY++RC+I  ILLEMDRILRP+G+V+ RD V+++V ++SI 
Sbjct  535  AFSTYPRTYDLIHASGLFTLYQNRCDITYILLEMDRILRPEGTVIFRDTVELLVKIQSIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT +  Q+
Sbjct  595  DGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEATQK  631



>gb|KDO43766.1| hypothetical protein CISIN_1g026623mg [Citrus sinensis]
Length=235

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 166/220 (75%), Gaps = 2/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ KE+AGGEL  +P RL  VPPRI++G V+G+T + +  D++LWKK V  YK+++  +
Sbjct  18   VSSTKEVAGGELKKFPSRLFDVPPRIANGEVEGVTGKSYQEDSKLWKKHVNAYKKMNSLI  77

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              + RYRN++DMNA LGGFAAAL     WVMNVVP  AK NTLGV+YERGLIG YH+WCE
Sbjct  78   GTR-RYRNVMDMNAGLGGFAAALESPKSWVMNVVPTTAK-NTLGVIYERGLIGIYHDWCE  135

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHA+G+F+LY++ C+ EDILLEMDRILRP+G+V+ RD+VD +  V+  A
Sbjct  136  GFSTYPRTYDLIHANGVFSLYENTCKPEDILLEMDRILRPEGAVIFRDEVDALNKVRKFA  195

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            +G++WD +M DHED P + EKILIA KQYW        S+
Sbjct  196  EGMRWDTKMMDHEDGPLMPEKILIAVKQYWVGSAGNSTSD  235



>ref|XP_012067632.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Jatropha 
curcas]
Length=620

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 170/222 (77%), Gaps = 4/222 (2%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGGEL  +PERL A+PPR++SGS+ G++ E +  D   WKK V  YK+++ +L
Sbjct  399  VSSRDEVAGGELKAFPERLYAIPPRVASGSIPGVSVETYQEDNNKWKKHVKAYKKIN-KL  457

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LGGFAAAL    +WVMNVVP  A  +TLGV+YERGLIG YH+WCE
Sbjct  458  IDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWCE  517

Query  363  AMSTYPRTYDFIHADGIFTLYKD---RCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVK  193
            A STYPRTYD IHA+G+F+LYKD   RC  EDILLEMDRILRP+G+V+ RD+VD+++ V+
Sbjct  518  AFSTYPRTYDLIHANGVFSLYKDNECRCNTEDILLEMDRILRPEGAVIFRDEVDVLIKVR  577

Query  192  SIADGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGS  67
             I  G++WD +M DHED P V EKIL+A KQYW AD N   S
Sbjct  578  KIVGGMRWDTKMVDHEDGPLVPEKILVAVKQYWVADGNSTSS  619



>ref|XP_010056104.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056105.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056106.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 gb|KCW72678.1| hypothetical protein EUGRSUZ_E01134 [Eucalyptus grandis]
Length=633

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG +  WPER  AVPPR+SSGS+ GITA+ +  D E+WK RV+HYKR+   L
Sbjct  416  VSSSDEVAGGAVETWPERAFAVPPRVSSGSIPGITAQKYKEDNEIWKDRVSHYKRIISPL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN++DMNA LGGFAAALV  PVWVMNVVPV    +TLG +YERG IGTY +WCE
Sbjct  476  TQ-GRYRNVMDMNANLGGFAAALVKYPVWVMNVVPVNTNHDTLGAIYERGFIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            + STYPRTYD IHA G+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +KSI 
Sbjct  535  SFSTYPRTYDLIHAGGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVEVLVKIKSIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT   +Q+
Sbjct  595  DGMRWKSQIMDHESGPFNPEKILVAVKTYWTGKPSQK  631



>ref|XP_008437487.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
 ref|XP_008437488.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
Length=636

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 174/217 (80%), Gaps = 2/217 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +E+AGG + NWPER  AVPPRIS G++ GIT E+F  D +LW++R+ +YK++   L
Sbjct  417  VNDSEEVAGGAVENWPERALAVPPRISRGTIPGITVENFEEDNKLWRERITYYKKM-IPL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            A+ GRYRNI+DMNA LGGFAAALV  PVWVMNVVP  +  +TLGV+YERG IGTY +WCE
Sbjct  476  AQ-GRYRNIMDMNANLGGFAAALVKFPVWVMNVVPANSDRDTLGVIYERGFIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+GIF++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +++I+
Sbjct  535  AFSTYPRTYDLIHANGIFSIYQDRCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTIS  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT + NQ+
Sbjct  595  DGMRWKSQIMDHETGPFNPEKILVAVKTYWTGETNQQ  631



>ref|XP_008660000.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Zea mays]
Length=383

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 167/216 (77%), Gaps = 1/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+++ E+AGG+L  +P+RL AVPPRI+ GSV G + E +  D  LW+K V  YK+++  L
Sbjct  168  VNSVDEVAGGQLEPFPKRLYAVPPRITDGSVPGFSVESYEEDNNLWRKHVKAYKKIN-NL  226

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LG FAAAL    VWVMNV+P  A  +TLGV+YERGLIG YH+WCE
Sbjct  227  LDTGRYRNIMDMNAGLGSFAAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWCE  286

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IH++ IF+LY+++C+ EDILLEMDRILRP+G+++IRD VD++V V+ IA
Sbjct  287  GFSTYPRTYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKIA  346

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            + ++W  R+ADHE  PHV EKIL A KQYWTA++  
Sbjct  347  NAMRWKTRLADHEGGPHVPEKILFAVKQYWTAEKTS  382



>gb|KJB18860.1| hypothetical protein B456_003G072700 [Gossypium raimondii]
Length=669

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG +  WPER  AVPPRI SGS  G+TAE F  D +LWK+RVAHYKR+   L
Sbjct  452  VSSSDDVAGGAIEKWPERAYAVPPRIRSGSTPGVTAERFVEDNKLWKERVAHYKRIISPL  511

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAA+++ PVWVMNVVP+ +  +TLGV+YERGLIGTY +WCE
Sbjct  512  P-TGRYRNIMDMNAYLGGFAAAMLNYPVWVMNVVPINSNHDTLGVIYERGLIGTYQDWCE  570

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+FTLY++RC+I  ILLEMDRILRP+G+V+ RD V+++V ++SI 
Sbjct  571  AFSTYPRTYDLIHASGLFTLYQNRCDITYILLEMDRILRPEGTVIFRDTVELLVKIQSIT  630

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT +  Q+
Sbjct  631  DGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEATQK  667



>ref|XP_012089660.1| PREDICTED: probable methyltransferase PMT14 [Jatropha curcas]
 gb|KDP22915.1| hypothetical protein JCGZ_01776 [Jatropha curcas]
Length=612

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 168/220 (76%), Gaps = 2/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N KE+AGGEL  +PERL AVPPRI++G VDG+T E +  D +LWKK V  YKR++ +L
Sbjct  393  VNNAKEVAGGELKKFPERLFAVPPRIANGLVDGVTTESYQEDNQLWKKHVKEYKRIN-RL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                RYRN++DMNA LGGFAAAL     WVMNVVP  AK NTLGV+YERGL+G YH+WCE
Sbjct  452  IGTTRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTVAK-NTLGVIYERGLVGIYHDWCE  510

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHA+G+F+LY++RC+ EDILLEMDRILRP+GSV+ RD VD++  VK IA
Sbjct  511  GFSTYPRTYDLIHANGVFSLYQNRCKFEDILLEMDRILRPEGSVIFRDGVDVLNEVKKIA  570

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD ++ DHED P V EKIL+A KQYW        S+
Sbjct  571  GGMRWDIKLMDHEDGPLVPEKILVAVKQYWVGGAGNSTSS  610



>ref|XP_010683197.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683199.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683200.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683201.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=610

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 169/216 (78%), Gaps = 5/216 (2%)
 Frame = -1

Query  702  AGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAEKGRYR  523
            AG +L  +PERL AVPPR++SGSV G++ + + +D  +WKK V  YKR++  L + GRYR
Sbjct  398  AGEQLKPFPERLYAVPPRVASGSVPGVSVDAYLKDNSMWKKHVKAYKRIN-SLLDTGRYR  456

Query  522  NILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAMSTYPR  343
            NI+DMNA LGGFAAA+    +WVMNV+P  A+ NTLGV+YERGLIG YH+WCE  STYPR
Sbjct  457  NIMDMNAGLGGFAAAIHSSKLWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEGFSTYPR  516

Query  342  TYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADGLQWDN  163
            TYD IHA+GIF+LYK++C +EDILLEMDRILRP+G+V+IRD+VD++V VK I  G++WD 
Sbjct  517  TYDLIHANGIFSLYKNKCNLEDILLEMDRILRPEGAVIIRDEVDVLVKVKKIVAGMRWDT  576

Query  162  RMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            RM DHED P V EKIL+A KQYWT D    G N +S
Sbjct  577  RMVDHEDGPLVPEKILVAVKQYWTVD----GGNVTS  608



>ref|NP_001170352.1| uncharacterized protein LOC100384329 [Zea mays]
 gb|ACN36721.1| unknown [Zea mays]
Length=180

 Score =   276 bits (706),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -1

Query  609  FSRDTELWKKRVAHYKRVDFQLAEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEA  430
            F  DTELWKKRV HYK V  QL +KGRYRN+LDMNAKLGGFAAALV+DP+WVMN+VP   
Sbjct  2    FVEDTELWKKRVGHYKSVIAQLGQKGRYRNLLDMNAKLGGFAAALVNDPLWVMNMVPTVG  61

Query  429  KVNTLGVVYERGLIGTYHNWCEAMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRIL  250
               TLGV+YERGLIG+Y +WCE MSTYPRTYD IHAD +FTLY  RCE E+ILLEMDRIL
Sbjct  62   NSTTLGVIYERGLIGSYQDWCEGMSTYPRTYDLIHADTVFTLYNGRCEAENILLEMDRIL  121

Query  249  RPQGSVVIRDDVDIMVSVKSIADGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            RP+G+V+IRDDVD++V +KS+ADG++W++++ DHED P VREK+L+  K YWT D +++
Sbjct  122  RPEGTVIIRDDVDLLVKIKSMADGMRWNSQIVDHEDGPLVREKLLLVVKTYWTLDGSEQ  180



>ref|XP_007039581.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY24082.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=612

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 167/220 (76%), Gaps = 2/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGGEL  +P RL AVPPRI+ G VDG++AE +  D +LWKK V  YKR++ +L
Sbjct  393  VSSSSEVAGGELKKYPARLFAVPPRIAKGLVDGVSAESYQEDNKLWKKHVNAYKRIN-KL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                RYRN++DMNA LGGFAA+L     WVMNVVP  AK NTLGV+YERGLIG YH+WCE
Sbjct  452  IGTARYRNMMDMNAGLGGFAASLESPKSWVMNVVPTVAK-NTLGVIYERGLIGIYHDWCE  510

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYDFIHA+G+F+LY+++C  EDILLEMDRILRP+G+V+ RDDVD++  V+ IA
Sbjct  511  GFSTYPRTYDFIHANGVFSLYQNKCNFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKIA  570

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++W+ +M DHED P V EKIL+A KQYW        SN
Sbjct  571  GGMRWNTKMMDHEDGPLVPEKILVAVKQYWVGSSGNSTSN  610



>gb|KHG13750.1| hypothetical protein F383_08462 [Gossypium arboreum]
Length=633

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  ++AGG +  WPER +AVPPRI SGS  GITAE F  D +LWK+RVAHYKR+   L
Sbjct  416  VSSSDDVAGGAMEKWPERASAVPPRIRSGSTPGITAERFEEDNKLWKERVAHYKRIISPL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA +GGFA A+++ PVWVMNVVP+ +  +TLGV+YERGLIGTY +WCE
Sbjct  476  P-TGRYRNIMDMNAYIGGFATAMLNYPVWVMNVVPINSNHDTLGVIYERGLIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+FTLY++RC+I  ILL+MDRILRP+G+V+ RD V+++V ++SI 
Sbjct  535  AFSTYPRTYDLIHASGLFTLYQNRCDITYILLDMDRILRPEGTVIFRDTVELLVKIQSIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT +  Q+
Sbjct  595  DGMRWKSQIIDHESGPFNPEKILVAVKTYWTGEATQK  631



>ref|XP_008813543.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008813544.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Phoenix 
dactylifera]
Length=624

 Score =   289 bits (740),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E+AGG L  WPER  A+PPRIS GS+ GITAE F  D  +WK+R+A YK++   L
Sbjct  408  VSSSEEVAGGMLEKWPERAFAIPPRISRGSIPGITAEKFQEDNNMWKERLARYKKIIPPL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             E GRYRN++DMNA LGGFAAALV  PVWVMNVVP + + +TLGV+YERG IGTY +WCE
Sbjct  468  TE-GRYRNVMDMNANLGGFAAALVKYPVWVMNVVPADTQQDTLGVIYERGFIGTYQDWCE  526

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHADG+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD VD++V V++I 
Sbjct  527  AFSTYPRTYDLIHADGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKVQAIT  586

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G++W +++ DHE  P   EKIL+A K YWT 
Sbjct  587  NGMRWKSQIMDHESGPFNPEKILVAVKTYWTG  618



>gb|EPS64080.1| hypothetical protein M569_10695, partial [Genlisea aurea]
Length=606

 Score =   289 bits (739),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 165/213 (77%), Gaps = 1/213 (0%)
 Frame = -1

Query  702  AGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAEKGRYR  523
            A   L  +PERL AVPPRI++GSV G++AE +S D E WKK V  YKR++ +  +  RYR
Sbjct  395  AANSLKPFPERLFAVPPRIAAGSVSGVSAEAYSDDNEQWKKHVDAYKRIN-KFIDTVRYR  453

Query  522  NILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAMSTYPR  343
            N +DMNA LGGFAAAL    +WVMNVVP  A+ NTLGV+YERGLIG YH+WCEA STYPR
Sbjct  454  NFMDMNAGLGGFAAALQSPKIWVMNVVPTAAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  513

Query  342  TYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADGLQWDN  163
            TYDFIHA G+F+LYKD+CE ED+LLEMDRILRP+G+VV RD+VD++V VK + +G++WD+
Sbjct  514  TYDFIHASGVFSLYKDKCEFEDVLLEMDRILRPEGAVVFRDEVDVLVKVKKMTEGMRWDS  573

Query  162  RMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
            ++ DHED P V +KIL A KQYW A  N   S+
Sbjct  574  KLIDHEDGPLVSQKILFAVKQYWVAAGNSSSSS  606



>ref|XP_010532828.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN  E+AGG+L  +PERL +VPPRISSGS+ GI+ E +  D+  W+K V  YKR++  L
Sbjct  397  VSNPDEVAGGKLKVFPERLNSVPPRISSGSIPGISVEAYQEDSREWRKHVKAYKRIN-SL  455

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA  GGFAAA+    +W MNVVP  A+ NTLGV+YERGLIG YH+WCE
Sbjct  456  LDTGRYRNIMDMNAGFGGFAAAIESPKLWTMNVVPTIAEKNTLGVIYERGLIGIYHDWCE  515

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A+STYPRTYD IHA+ +F+LYKD+C++ DIL+EMDRILRP+G+V+IRD+VD++V VK + 
Sbjct  516  ALSTYPRTYDLIHANHLFSLYKDKCDMGDILVEMDRILRPEGAVIIRDEVDVLVKVKKMI  575

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD+++ DHED P V EK+LIA KQYW A  N   +N
Sbjct  576  GGMRWDSKLVDHEDGPLVPEKVLIAVKQYWVAGGNSTSAN  615



>ref|XP_010066916.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 ref|XP_010066917.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 gb|KCW64965.1| hypothetical protein EUGRSUZ_G02508 [Eucalyptus grandis]
Length=615

 Score =   289 bits (739),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 171/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++  E+AGGEL  +P+RL AVPPRI SGS+ G++ E +  D+  WK+ V  YK+++ +L
Sbjct  397  VNDSDEVAGGELKPFPQRLYAVPPRIVSGSISGVSVETYQEDSNKWKRHVNAYKKMN-KL  455

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA+LGGFAAA+    +W MNVVP  A  +TLGV+YERGLIG YH+WCE
Sbjct  456  LDTGRYRNIMDMNARLGGFAAAIESPKLWTMNVVPTIADKSTLGVIYERGLIGIYHDWCE  515

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+G+F+LY D+C+ EDILLEMDRILRP+G+V+IRD+VD+++ VK I 
Sbjct  516  AFSTYPRTYDLIHANGVFSLYNDKCDAEDILLEMDRILRPEGAVIIRDEVDVLIKVKKIV  575

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD +M DHED P V EKIL+A KQYW A  N   S+
Sbjct  576  GGMRWDTKMMDHEDGPLVPEKILVAVKQYWVAGGNSTSSH  615



>gb|ABK94953.1| unknown [Populus trichocarpa]
Length=435

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG +  WP R  A+PPRI SGS+ GITAE F  D  LWK RV +YK +   L
Sbjct  217  VSSSDEVAGGAVEKWPARAFAIPPRIRSGSIPGITAEKFKEDNNLWKDRVTNYKHIISPL  276

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRNI+DMNA+LGGFAAAL   PVWVMNVVP  +  +TLGV+YERG IGTY +WCE
Sbjct  277  T-KGRYRNIMDMNAQLGGFAAALAKYPVWVMNVVPANSNPDTLGVIYERGFIGTYQDWCE  335

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A+STYPRTYD IHA G+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +++I 
Sbjct  336  AVSTYPRTYDLIHAGGVFSIYQDRCDITHILLEMDRILRPEGTVIFRDTVEVLVKIQTIT  395

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            +G++W +++ DHE  P   EKIL+A K YWT ++ Q+
Sbjct  396  NGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEKKQK  432



>ref|XP_010934594.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
 ref|XP_010934595.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=624

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E+AGG L  WPER  A+PPRIS GS+ GITAE F  D  +WK+R+A YK++   L
Sbjct  408  VSSSEEVAGGALEKWPERAFAIPPRISRGSILGITAEKFQEDNNMWKERLAGYKKIIPPL  467

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN++DMNA LGGFAAALV  PVWVMNVVP + + +TLGV+YERG IGTY +WCE
Sbjct  468  TQ-GRYRNVMDMNANLGGFAAALVKYPVWVMNVVPADTQKDTLGVIYERGFIGTYQDWCE  526

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHADG+F+ Y+DRC+I  ILLEMDRILRP+G+V+ RD VD++V V++I 
Sbjct  527  AFSTYPRTYDLIHADGVFSTYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKVETIT  586

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            +G++W +++ DHE  P   EKIL+A K YWT    Q+
Sbjct  587  NGMRWKSQIMDHESGPFNPEKILVAVKSYWTGAPAQQ  623



>ref|XP_009373681.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373682.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373683.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=630

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
             S+  ++AGG L  WPER  AVPPRISSGS+ GITAE    D +LWK+RV HYKR+    
Sbjct  415  TSDPNDVAGGALEKWPERAFAVPPRISSGSIPGITAEKLREDNQLWKERVVHYKRI--VP  472

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRN++DMNA LGGFAAAL   PVWVMN VP  +  +TLGV+YERG IGTY +WCE
Sbjct  473  ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERGFIGTYQDWCE  532

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA GIF++Y+DRC+I  ILLEMDRILRP+G+VV RD V+I+V +K+I 
Sbjct  533  AFSTYPRTYDLIHAGGIFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAIT  592

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT ++ +E
Sbjct  593  DGMRWKSQIMDHESGPFNPEKILLAVKTYWTGEEKKE  629



>ref|XP_008813541.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Phoenix 
dactylifera]
Length=657

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +E+AGG L  WPER  A+PPRIS GS+ GITAE F  D  +WK+R+A YK++   L
Sbjct  441  VSSSEEVAGGMLEKWPERAFAIPPRISRGSIPGITAEKFQEDNNMWKERLARYKKIIPPL  500

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             E GRYRN++DMNA LGGFAAALV  PVWVMNVVP + + +TLGV+YERG IGTY +WCE
Sbjct  501  TE-GRYRNVMDMNANLGGFAAALVKYPVWVMNVVPADTQQDTLGVIYERGFIGTYQDWCE  559

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHADG+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD VD++V V++I 
Sbjct  560  AFSTYPRTYDLIHADGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKVQAIT  619

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G++W +++ DHE  P   EKIL+A K YWT 
Sbjct  620  NGMRWKSQIMDHESGPFNPEKILVAVKTYWTG  651



>ref|XP_008796868.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
 ref|XP_008796869.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
Length=632

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N +E+AGGEL  WP R  AVPPRIS GS+ G+ A++F  D ++WK+RV HYKR+   L
Sbjct  416  VNNEEEVAGGELEKWPYRAFAVPPRISRGSIPGVAAKNFEEDNQMWKERVTHYKRIVPPL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN++DMNA LGGFAAAL+  PVWVMNVVP+ +  +TLGV+YERG IGTY +WCE
Sbjct  476  LQ-GRYRNVMDMNANLGGFAAALIKYPVWVMNVVPISSDRDTLGVIYERGFIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPR+YD +HADG+F+ Y+DRC+I  ILLEMDRILRP+G+V+IRD V+++  VK+I 
Sbjct  535  AFSTYPRSYDLLHADGVFSAYQDRCDITYILLEMDRILRPEGTVIIRDIVEVLTKVKAIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            DG++W +++ DHE  P   EKIL+A K YWTA+ ++
Sbjct  595  DGMRWKSQILDHESGPFNPEKILVAVKTYWTAEASK  630



>emb|CBI31965.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 171/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +E++GGEL  +P+RL AVPPR++SGS+ G++ E +  D +LWKK +  YK+++ ++
Sbjct  295  VNSPEEVSGGELQPFPKRLYAVPPRVASGSIPGVSVETYLEDNKLWKKHLNAYKKIN-KI  353

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LGGFAAAL    +WVMNVVP  A+ +TLG VYERGLIG YH+WCE
Sbjct  354  IDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGAVYERGLIGIYHDWCE  413

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C+ EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  414  AFSTYPRTYDLIHAHGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIV  473

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD ++ DHED P V EKIL+A KQYW        S+
Sbjct  474  GGMRWDTKLVDHEDGPLVSEKILVAVKQYWVVSAENSTSS  513



>ref|XP_002528760.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33582.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 167/220 (76%), Gaps = 2/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ KE+AGGEL  +PERL AVPPRI+ G V+G+T E +  D +LWKK V  YKR++ +L
Sbjct  393  VASAKEVAGGELKKFPERLFAVPPRIAKGLVEGVTEESYLEDNKLWKKHVKEYKRIN-KL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                RYRN++DMNA LGGFAAAL     WVMNVVP  A+ NTLGV+YERGL+G YH+WCE
Sbjct  452  IGTVRYRNVMDMNAGLGGFAAALESPKSWVMNVVPTAAQ-NTLGVIYERGLVGIYHDWCE  510

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHADG+F+LY+  C++EDILLEMDRILRP+GSV+ RD+VD++  VK IA
Sbjct  511  GFSTYPRTYDLIHADGVFSLYQKICKLEDILLEMDRILRPEGSVIFRDEVDVLNEVKRIA  570

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD +M DHED P V EKIL+A KQYW        SN
Sbjct  571  GGMRWDTKMMDHEDGPLVPEKILVAVKQYWVGGTGNSTSN  610



>ref|XP_008781841.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=616

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 170/212 (80%), Gaps = 1/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +E+AGGEL  +P+RL ++PPRISSGSV G +AE + +D +LW+K V  YK+V+ +L
Sbjct  397  VNSPEEVAGGELRPFPDRLNSIPPRISSGSVPGFSAESYQKDNKLWQKHVKAYKKVN-KL  455

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LG FAAA+    +WVMNVVP  A+++TLGV+YERGLIG YH+WCE
Sbjct  456  LNTGRYRNIMDMNAGLGSFAAAIESPKLWVMNVVPTIAELSTLGVIYERGLIGIYHDWCE  515

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LY+++C++EDILLEMDRILRP+G+++ RDDVD+++ VK + 
Sbjct  516  AFSTYPRTYDLIHASGVFSLYQNKCKMEDILLEMDRILRPEGAIIFRDDVDVLIKVKRMV  575

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
             G++W  +MADHED P V EKIL A KQYW  
Sbjct  576  SGMRWSTKMADHEDGPLVSEKILFAVKQYWVG  607



>gb|EMS59423.1| putative methyltransferase PMT2 [Triticum urartu]
Length=659

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 173/221 (78%), Gaps = 6/221 (3%)
 Frame = -1

Query  702  AGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAEKGRYR  523
            AGGEL ++PERL A+PPRISSG+V G T E +  +   W++ V  Y++V+++L  K RYR
Sbjct  302  AGGELQSFPERLKAIPPRISSGAVQGFTMESYEEENRRWERHVKAYRKVNYKLDTK-RYR  360

Query  522  NILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAMSTYPR  343
            NI+DMNA +GGFAAA+     WVMNVVP  A+++TLGV+YERGLIG YH+WCEA STYPR
Sbjct  361  NIMDMNAGVGGFAAAIFSPMSWVMNVVPTAAELSTLGVIYERGLIGIYHDWCEAFSTYPR  420

Query  342  TYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADGLQWDN  163
            TYD IHA+G+F +Y+D+C++EDI+LEMDRILRP+G+V++RDD+D+++ V  +A G++W  
Sbjct  421  TYDLIHANGVFNIYRDKCKMEDIMLEMDRILRPEGTVILRDDIDVLLRVDKVATGMRWKT  480

Query  162  RMADHEDSPHVREKILIANKQYWTAD-----QNQEGSNASS  55
             MA+HEDSPH+REK+L A K YWTAD     Q+QE    SS
Sbjct  481  MMANHEDSPHIREKVLYAIKPYWTADSDKSSQDQEKKATSS  521



>ref|XP_009350354.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=628

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
             S+  ++AGG L  WPER  AVPPRISSGS+ GITAE    D +LWK+RV HYKR+    
Sbjct  413  TSDPNDVAGGALEKWPERAFAVPPRISSGSIPGITAEKLREDNQLWKERVVHYKRI--VP  470

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRN++DMNA LGGFAAAL   PVWVMN VP  +  +TLGV+YERG +GTY +WCE
Sbjct  471  ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERGFLGTYQDWCE  530

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA GIF++Y+DRC+I  ILLEMDRILRP+G+VV RD V+I+V +K+I 
Sbjct  531  AFSTYPRTYDLIHAGGIFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAIT  590

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT ++ +E
Sbjct  591  DGMRWKSQIMDHESGPFNPEKILLAVKTYWTGEEKKE  627



>ref|XP_001760613.1| predicted protein [Physcomitrella patens]
 gb|EDQ74688.1| predicted protein [Physcomitrella patens]
Length=629

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 165/213 (77%), Gaps = 0/213 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +  E+AGGELA +P R+  +PPRI+SGSV  +TA++F  D ELW+KRV +YK      
Sbjct  403  VKSKNEVAGGELAKFPARVNTIPPRIASGSVPLMTAQEFKEDAELWEKRVKYYKNHLIPP  462

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA LGGFAAALV DPVWVMN +P EAK +TLGV++ERG IGTY NWCE
Sbjct  463  LTNGRYRNIMDMNAGLGGFAAALVKDPVWVMNAMPPEAKTDTLGVIFERGFIGTYQNWCE  522

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHAD +F++Y+DRC+I  +LLEMDRILRP+G+V+IRD+VD++  V  I 
Sbjct  523  AFSTYPRTYDLIHADNVFSMYQDRCDITYVLLEMDRILRPEGAVLIRDEVDVVNKVMIIT  582

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTAD  85
             G++W+ R+ADHE+ P +REKIL+  K YW  +
Sbjct  583  QGMRWECRLADHEEGPFIREKILVCVKTYWVGE  615



>gb|ACN26954.1| unknown [Zea mays]
Length=328

 Score =   278 bits (711),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 162/215 (75%), Gaps = 1/215 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +  ++AGG +  +P RL AVPPRI++G V G++++ F +D ++WKK V  Y  V+  L
Sbjct  111  VKDENDVAGGAIKPFPARLNAVPPRIANGLVPGVSSQAFQKDNKMWKKHVKSYSSVNKYL  170

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
               GRYRNI+DMNA+ GGFAAA+     WVMNVVP  AK+ TLG VYERGLIG YH+WCE
Sbjct  171  L-TGRYRNIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCE  229

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+FTLYK +C +ED+LLEMDRILRP+G+V+IRDDVD++  V S+A
Sbjct  230  AFSTYPRTYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSLA  289

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQN  79
             G++WD +M DHED P VREKIL A KQYW   + 
Sbjct  290  LGMRWDTKMVDHEDGPLVREKILYAVKQYWVGGKQ  324



>ref|XP_010552579.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+ +++AGGEL  +PERL A+PPRI SGS+ G++ E +  D   W+K V  YKR++  L
Sbjct  397  VSSPEDVAGGELKVFPERLNAIPPRILSGSISGVSVEAYEEDNRQWRKHVKEYKRLN-SL  455

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA  GGFAAA+    +WVMNVVP  A+ NTLGV+YERGLIG YH+WC+
Sbjct  456  LDTGRYRNIMDMNAGFGGFAAAIESRKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCQ  515

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+ +F+LYKDRC  EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  516  AFSTYPRTYDLIHANHLFSLYKDRCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKII  575

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD+++ DHED P V EK+LIA KQYW    N   +N
Sbjct  576  GGMRWDSKLVDHEDGPLVPEKVLIAVKQYWVTGSNSTSAN  615



>ref|XP_002522425.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF39917.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   286 bits (733),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 170/220 (77%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V +  E+AGG L  +P+RL AVPPR+SSGS+ G++ E +  D + WKK V+ YK+++ +L
Sbjct  394  VGSQDEVAGGGLKAFPDRLYAVPPRVSSGSIPGVSVETYQEDNKNWKKHVSAYKKIN-RL  452

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LGGFAAAL    +WVMNVVP  A+ +TLGV+YERGLIG YH+WCE
Sbjct  453  IDSGRYRNIMDMNAGLGGFAAALQSPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCE  512

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+G+F+LYK++C+ EDILLEMDRILRP+G+V+ RD+VD+++ V+ I 
Sbjct  513  AFSTYPRTYDLIHANGVFSLYKEKCDFEDILLEMDRILRPEGAVIFRDEVDVLIKVRKIV  572

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD +M DHED P V EKIL+A KQYW    N   + 
Sbjct  573  AGMRWDTKMVDHEDGPLVPEKILVAVKQYWVTGGNSTSAQ  612



>ref|XP_007046111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY01943.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=616

 Score =   286 bits (733),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++  E+AG EL  +PERL AVPPRI+SGSV G + E +  D   WKK V  YK+++ +L
Sbjct  398  VNSPDEVAGRELKPFPERLYAVPPRIASGSVPGFSVETYQEDNHKWKKHVKAYKKIN-RL  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL    +WVMNV+P  A+ +TLGV+YERGLIG YH+WCE
Sbjct  457  IDSGRYRNILDMNAVLGGFAAALDSPKLWVMNVMPTIAQKDTLGVIYERGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKDRC +EDILLEMDRILRP+G+V+ RD+VD+++ VK IA
Sbjct  517  AFSTYPRTYDLIHAYGLFSLYKDRCNVEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIA  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD +M DHED P V EKIL+A KQYW    N   + 
Sbjct  577  AGMRWDAKMIDHEDGPLVPEKILVAVKQYWVVGGNTTSTQ  616



>ref|XP_010258374.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
 ref|XP_010258376.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=617

 Score =   286 bits (733),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 171/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++  E+AG EL  +P+RL AVPPR++SGSV G++ E +  D +LWKK V  YK+++ ++
Sbjct  398  VNSPDEVAGEELKPFPQRLNAVPPRVASGSVPGVSVETYLDDNKLWKKHVKAYKKIN-KI  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN++DMNA LG FAAA+    +WVMNVVP  A+  TLGV+YERGLIG YH+WCE
Sbjct  457  LDSGRYRNMMDMNAGLGSFAAAIESPKLWVMNVVPTIAEKKTLGVIYERGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+G+F+LYKD+C  EDILLEMDRILRP+G+V+ RDDVD+++ VK I 
Sbjct  517  AFSTYPRTYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDDVDVLIKVKRII  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++W+ +M DHED P V EKIL+A KQYWT  +N   S+
Sbjct  577  AGMKWNTKMVDHEDGPLVPEKILVAVKQYWTVGENNSTSS  616



>ref|XP_009389104.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389112.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389120.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
Length=629

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AG  L  WPER  AVPPRIS G++ G+ +  F  D  +WK+RV HYK++   L
Sbjct  413  VSSPDEVAGEVLEKWPERAFAVPPRISRGTIPGLDSRKFEEDNAMWKERVTHYKKIILPL  472

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRN++DMNA LGGFAAALV  PVWVMNVVP  +  +TLGV+YERG IGTY +WCE
Sbjct  473  P-KGRYRNVMDMNANLGGFAAALVKYPVWVMNVVPASSNQDTLGVIYERGFIGTYQDWCE  531

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHADG+F++Y+DRC+I  ILLEMDRILRP+G+V++RD V+++  V++I 
Sbjct  532  AFSTYPRTYDLIHADGVFSIYQDRCDITYILLEMDRILRPEGTVIVRDTVEVLTKVQAIT  591

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W+N++ DHE  P   EKIL+A K YWTAD + +
Sbjct  592  DGMRWNNQIIDHESGPFNPEKILVAVKTYWTADPSTQ  628



>gb|EYU33422.1| hypothetical protein MIMGU_mgv1a002913mg [Erythranthe guttata]
Length=626

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 168/218 (77%), Gaps = 1/218 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN  E+AGG L  WPER   VPPRI+SGS+ GITA+ F  D  +WK+R+++YK +  QL
Sbjct  410  VSNPNEVAGGALKKWPERAFTVPPRITSGSIQGITAKKFLEDNAMWKERISYYKNLVSQL  469

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
            + +G  RN++DMNA LGGFAAAL   PVWVMNVVP  +  +TLGV+YERG IG Y +WCE
Sbjct  470  S-RGLIRNVMDMNANLGGFAAALSKYPVWVMNVVPANSDPDTLGVIYERGFIGAYQDWCE  528

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +KSI 
Sbjct  529  AFSTYPRTYDLIHAGGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDVVEVLVKIKSIT  588

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEG  70
            DG++W++++ DHE  P   EKIL+A K YWTA+ N +G
Sbjct  589  DGMRWESKIVDHESGPFNVEKILLATKTYWTAESNPQG  626



>ref|XP_011032031.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
 ref|XP_011032032.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
Length=612

 Score =   286 bits (732),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 167/220 (76%), Gaps = 2/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++  E+AGGEL  +PERL A+PPR++ G V G+TAE F  D +LWKKR+  YKR + +L
Sbjct  393  VNSANEVAGGELKKFPERLFAIPPRVAKGLVKGVTAESFQEDNKLWKKRINAYKRNN-KL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                RYRNI+DMNA LGGFAAAL     WVMNVVP  AK NTLGV+YERGL+G YH+WCE
Sbjct  452  IGTTRYRNIMDMNAGLGGFAAALESPKSWVMNVVPTIAK-NTLGVIYERGLVGIYHDWCE  510

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYDFIHA+G+F+LY+++C +EDILLEMDRILRP+G+V+ RD+VD++  VK IA
Sbjct  511  GFSTYPRTYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKIA  570

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD +M DHED P V EKI++  KQYW        S+
Sbjct  571  GGMRWDTKMMDHEDGPLVPEKIVVVVKQYWVGGTGNSTSS  610



>emb|CBI33946.3| unnamed protein product [Vitis vinifera]
Length=509

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 169/223 (76%), Gaps = 6/223 (3%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++  E+AGGEL  +P RL A+PPRI++G V+G+T E +  D +LWKK V  YKR++ +L
Sbjct  291  VTSANEVAGGELKKFPARLFAIPPRIAAGLVEGVTVESYEEDNKLWKKHVNTYKRIN-KL  349

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                RYRNI+DMNA LGGFAAAL     WVMNVVP  AK NTLGV+YERGLIG YH+WCE
Sbjct  350  LGTTRYRNIMDMNAGLGGFAAALESPKSWVMNVVPTIAK-NTLGVIYERGLIGIYHDWCE  408

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYDFIHA G+F+LY++ C++EDILLEMDRILRP+G+V+ RD+VD+++ VK IA
Sbjct  409  GFSTYPRTYDFIHASGVFSLYQNTCKLEDILLEMDRILRPEGAVMFRDEVDVLIKVKKIA  468

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
             G++W+  M DHED P V EKIL+  KQYW       G N++S
Sbjct  469  KGMRWNTNMMDHEDGPLVPEKILVVVKQYWVGG----GDNSTS  507



>ref|XP_003628359.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
Length=402

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+   +++GG+L  +P+RL A+PPR+SSGS+ G+++E +  D ++WKK V  YK+++  L
Sbjct  184  VTPTPKVSGGDLKPFPDRLYAIPPRVSSGSIPGVSSETYQNDNKMWKKHVNAYKKIN-SL  242

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LG FAAA+     WVMNVVP  A+ +TLGV+YERGLIG YH+WCE
Sbjct  243  LDSGRYRNIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCE  302

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHA+G+F+LY+D+C  EDILLEMDRILRP+G+V+IRD+VD+++ VK + 
Sbjct  303  GFSTYPRTYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLI  362

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++W+ ++ DHED P V EK+LIA KQYW  D N   + 
Sbjct  363  GGMRWNMKLVDHEDGPLVPEKVLIAVKQYWVTDGNSTSTQ  402



>ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=618

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 171/220 (78%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++ +E++GGEL  +P+RL AVPPR++SGS+ G++ E +  D +LWKK +  YK+++ ++
Sbjct  399  VNSPEEVSGGELQPFPKRLYAVPPRVASGSIPGVSVETYLEDNKLWKKHLNAYKKIN-KI  457

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LGGFAAAL    +WVMNVVP  A+ +TLG VYERGLIG YH+WCE
Sbjct  458  IDSGRYRNIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGAVYERGLIGIYHDWCE  517

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C+ EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  518  AFSTYPRTYDLIHAHGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIV  577

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD ++ DHED P V EKIL+A KQYW        S+
Sbjct  578  GGMRWDTKLVDHEDGPLVSEKILVAVKQYWVVSAENSTSS  617



>ref|XP_007155749.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
 gb|ESW27743.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
Length=613

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 169/220 (77%), Gaps = 2/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N  E+AGGEL  +P RL AVPPRI+ G+V G+TA+ +  D +LWKK V  YKR++ QL
Sbjct  394  VTNKNEVAGGELKKFPARLFAVPPRIAQGNVPGVTAKSYQEDNKLWKKHVNSYKRIN-QL  452

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                RYRN++DMNA LGGFAAAL     WVMNVVP  A+ NTLGVVYERGLIG YH+WCE
Sbjct  453  IGTTRYRNLMDMNAGLGGFAAALDSPKSWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCE  511

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHA+G+F+LY+ +C +EDILLEMDRILRP+G+++IRD+VD++  VK I 
Sbjct  512  GFSTYPRTYDLIHANGLFSLYRGKCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKIV  571

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++W+ +M DHED P V EKIL+A K+YW A   ++ SN
Sbjct  572  GGMRWEAKMVDHEDGPLVPEKILVAVKEYWVATTKKDSSN  611



>gb|KJB80180.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
 gb|KJB80181.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
Length=616

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 169/216 (78%), Gaps = 1/216 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN +E+AGG+L  +P+RL AVPPR++SGSV  ++ E +  D E WKK V  YK+++ +L
Sbjct  398  VSNPEEVAGGKLKPFPKRLYAVPPRVASGSVPVVSVETYQGDNEKWKKHVGAYKKIN-RL  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LGGFAAAL    +WVMNV+P  A+ +TLGV++ERGLIG YH+WCE
Sbjct  457  IDSGRYRNILDMNAGLGGFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F+LYKD+C +EDILLEMDRILRP+G+V+ RD+VD+++ VK I 
Sbjct  517  AFSTYPRTYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIT  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
             G++WD +M DHED P V EKIL+A K+YW    N 
Sbjct  577  AGMRWDTKMVDHEDGPLVPEKILVAVKRYWVVGANS  612



>ref|XP_002298987.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE83792.1| dehydration-responsive family protein [Populus trichocarpa]
Length=529

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG +  WP R  A+PPRI SGS+ GITAE F  D  LWK RV +YK +   L
Sbjct  311  VSSSDEVAGGAVEKWPARAFAIPPRIRSGSIPGITAEKFKEDNNLWKDRVTNYKHIISPL  370

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRNI+DMNA+LGGFAAAL   PVWVMNVVP  +  +TLGV+YERG IGTY +WCE
Sbjct  371  T-KGRYRNIMDMNAQLGGFAAALAKYPVWVMNVVPANSNPDTLGVIYERGFIGTYQDWCE  429

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A+STYPRTYD IHA G+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +++I 
Sbjct  430  AVSTYPRTYDLIHAGGVFSIYQDRCDITHILLEMDRILRPEGTVIFRDTVEVLVKIQTIT  489

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            +G++W +++ DHE  P   EKIL+A K YWT ++ Q+
Sbjct  490  NGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEKKQK  526



>ref|XP_009591906.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009591908.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=617

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 166/215 (77%), Gaps = 1/215 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
             +N  E+AGGEL  +P+RL  VPPRI+SGSV G++ E F  D +LWKK V  YKRV+ ++
Sbjct  398  TTNSDEVAGGELKPFPQRLNTVPPRIASGSVPGLSVESFQEDNKLWKKHVNSYKRVN-KI  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA LG FAAAL    +WVMNVVP  A+ +TLGV+YE+GLIG YH+WCE
Sbjct  457  LDSGRYRNILDMNAGLGSFAAALESPKLWVMNVVPNIAEQDTLGVIYEQGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+G+F+LYKD+C  EDILLEMDRILRP+G+V++RD VD++  VK IA
Sbjct  517  AFSTYPRTYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVILRDHVDVLTQVKRIA  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQN  79
             G++W+ +M DHED P + EK+L   K+YW A  N
Sbjct  577  SGMRWNIKMVDHEDGPLIPEKVLFGVKKYWVAGDN  611



>ref|XP_011070323.1| PREDICTED: probable methyltransferase PMT18 [Sesamum indicum]
Length=626

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 165/212 (78%), Gaps = 1/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VSN  E+AGG L  WPER  AVPPRISSGS+ GI A+ F  DTE+WK+R+ +YK +   L
Sbjct  416  VSNPNEVAGGALQKWPERAFAVPPRISSGSIPGINAQKFQEDTEMWKERIVYYKSLVTDL  475

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRN++DMNA LGGFAAA++  PVW+MNVVP   + +TLG +YERG IG Y +WCE
Sbjct  476  PQ-GRYRNVMDMNANLGGFAAAMMRFPVWIMNVVPANTQPDTLGAIYERGFIGAYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD V+++V +K I 
Sbjct  535  AFSTYPRTYDLIHAAGVFSMYQDRCDITYILLEMDRILRPEGTVIFRDMVEVLVKIKGIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            DG++W++++ DHE  P   EKIL+A+K YWTA
Sbjct  595  DGMRWNSKIIDHESGPFNPEKILLASKTYWTA  626



>ref|XP_010250929.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250938.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250946.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250956.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250965.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250972.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250980.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
Length=633

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            +S+  E+AGG L  WPER  +VPPRI SGS+  ITA+ F  D ELWK R+  YKR+   L
Sbjct  414  ISSSDEVAGGALEKWPERAFSVPPRIKSGSIPSITAKKFQEDNELWKDRLTRYKRIIPPL  473

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GR+RNI+DMNA +GGFAAALV  PVWVMNVVP     +TLGV+YERG IGTYH+WCE
Sbjct  474  TQ-GRFRNIMDMNAYMGGFAAALVKYPVWVMNVVPANTNQDTLGVIYERGFIGTYHDWCE  532

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I  ILLEMDRILRP+G+V+ RD VD++V ++SI 
Sbjct  533  AFSTYPRTYDLIHAGGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKIQSIT  592

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +++ DHE  P   EKIL+A K YWT + + +
Sbjct  593  DGMRWKSQIMDHESGPFNPEKILVAVKTYWTGEASSK  629



>gb|KDO76804.1| hypothetical protein CISIN_1g006834mg [Citrus sinensis]
Length=629

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG L  WPER  +VPPRISSGS+ GITAE    D ELWK R+ +YK++D  L
Sbjct  416  VSSSDEVAGGALEKWPERAFSVPPRISSGSLSGITAEKLREDNELWKDRMTYYKKID-GL  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRN++DMNA LGGFAAA+   PVWVMNVVP  +  +TLG +YERGLIGTY +WCE
Sbjct  475  FHKGRYRNVMDMNAYLGGFAAAMSKYPVWVMNVVPFHSNPDTLGAIYERGLIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I +ILLEMDRILRP+G+V+ RD V+++V ++SI 
Sbjct  535  AFSTYPRTYDLIHASGVFSIYQDRCDITNILLEMDRILRPEGTVIFRDTVEMLVKIRSIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G++W +++ DHE  P   EKIL A K YWT 
Sbjct  595  EGMRWKSQIMDHESGPFNPEKILFAAKTYWTG  626



>ref|XP_006385609.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
 gb|ERP63406.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
Length=612

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 166/220 (75%), Gaps = 2/220 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V++  E+AGGEL  +PERL A+PPR++ G V G+TAE F  D +LWKK +  YKR + +L
Sbjct  393  VNSANEVAGGELKKFPERLFAIPPRVAKGLVKGVTAESFQEDNKLWKKHINAYKRNN-KL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
                RYRNI+DMNA LGGFAAAL     WVMNVVP  AK NTLGV+YERGL+G YH+WCE
Sbjct  452  IGTTRYRNIMDMNAGLGGFAAALESPKSWVMNVVPTIAK-NTLGVIYERGLVGIYHDWCE  510

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYDFIHA+G+F+LY+++C +EDILLEMDRILRP+G+V+ RD+VD++  VK IA
Sbjct  511  GFSTYPRTYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKIA  570

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD +M DHED P V EKIL+  KQYW        S+
Sbjct  571  GGMRWDTKMMDHEDGPLVPEKILVVVKQYWVGGTGNSTSS  610



>ref|XP_009772034.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009772035.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=615

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 164/213 (77%), Gaps = 1/213 (0%)
 Frame = -1

Query  717  NIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAE  538
            N  E+AGGEL  +PERL A+PPRI+SGSV G++ E F  D +LWKK V  YKRV+ +  +
Sbjct  399  NSDEVAGGELKPFPERLNAIPPRIASGSVPGVSVESFQEDNKLWKKHVKAYKRVN-KFLD  457

Query  537  KGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAM  358
             GRYRNILDMNA LG FAAAL    +WVMNV+P +A+ +TLGV+YERGLIG YH+WCEA 
Sbjct  458  TGRYRNILDMNAGLGSFAAALESPKLWVMNVMPTKAESDTLGVLYERGLIGIYHDWCEAF  517

Query  357  STYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADG  178
            STYPRTYD IHA+G+F+LYKD+C +EDILLEMDRILRP+G+V+ RD  DI+  VK IA G
Sbjct  518  STYPRTYDLIHANGVFSLYKDKCNVEDILLEMDRILRPEGAVIFRDHADILGQVKLIATG  577

Query  177  LQWDNRMADHEDSPHVREKILIANKQYWTADQN  79
            ++W  +M D+ED P + EK+L A K+YW    N
Sbjct  578  MRWKTKMVDNEDGPLIPEKVLFAVKRYWVVGDN  610



>ref|XP_006476235.1| PREDICTED: probable methyltransferase PMT18-like [Citrus sinensis]
Length=629

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 164/212 (77%), Gaps = 1/212 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            VS+  E+AGG L  WPER  +VPPRISSGS+ GITAE    D ELWK R+ +YK++D  L
Sbjct  416  VSSSDEVAGGALEKWPERAFSVPPRISSGSLSGITAEKLREDNELWKDRMTYYKKID-GL  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRN++DMNA LGGFAAA+   PVWVMNVVP  +  +TLG +YERGLIGTY +WCE
Sbjct  475  LHKGRYRNVMDMNAYLGGFAAAMSKYPVWVMNVVPFHSNPDTLGAIYERGLIGTYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+F++Y+DRC+I +ILLEMDRILRP+G+V+ RD V+++V ++SI 
Sbjct  535  AFSTYPRTYDLIHASGVFSIYQDRCDITNILLEMDRILRPEGTVIFRDTVEMLVKIRSIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTA  88
            +G++W +++ DHE  P   EKIL A K YWT 
Sbjct  595  EGMRWKSQIMDHESGPFNPEKILFAVKTYWTG  626



>ref|XP_010089758.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB38334.1| putative methyltransferase PMT2 [Morus notabilis]
Length=611

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 166/220 (75%), Gaps = 1/220 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            ++   E A GEL  +P RL AVPPRI+SGSV G++ E +  D  +WKK V  YK+++ +L
Sbjct  393  ITPYPEEAVGELQPFPRRLYAVPPRIASGSVPGVSVETYEEDNRVWKKHVNAYKKIN-RL  451

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LGGFAAAL    +WVMNV+P  A+ NTLGV+YERGL+G YH+WCE
Sbjct  452  LDTGRYRNIMDMNAGLGGFAAALHSPKLWVMNVMPTIAEKNTLGVIYERGLVGIYHDWCE  511

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IHA+G+F+LYKD+C  EDILLEMDRILRP+G+V+ RD+VD +V VK I 
Sbjct  512  PFSTYPRTYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDTLVKVKKII  571

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQEGSN  64
             G++WD +M DHED P V EKIL+A KQYW AD N   + 
Sbjct  572  GGMRWDTKMVDHEDGPLVPEKILVAVKQYWAADGNSTSTQ  611



>ref|XP_009413462.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=615

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V N +E AGGEL  +P+RL AVPPRISSGSV G + + +  D  LW+K V  YK+++  L
Sbjct  398  VGNPEEFAGGELKPFPQRLNAVPPRISSGSVPGFSVKSYHEDIRLWQKHVETYKKIN-DL  456

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNILDMNA+LG FAAA+    +WVMNVVP  A+++TLGV+YERGLIG YH+WCE
Sbjct  457  LDTGRYRNILDMNARLGSFAAAIESPKLWVMNVVPTIAEISTLGVIYERGLIGIYHDWCE  516

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA+G+F+LY+++C++EDILLEMDRILRP+G+V++RDDVD+++ VK + 
Sbjct  517  AFSTYPRTYDLIHANGVFSLYQNKCKMEDILLEMDRILRPEGAVILRDDVDVLMKVKKMV  576

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYW  94
             G++W+ ++ DHED P V EKIL+A KQYW
Sbjct  577  TGMRWNTKLLDHEDGPLVPEKILVAVKQYW  606



>ref|XP_008659999.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Zea mays]
Length=611

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 167/214 (78%), Gaps = 1/214 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+++ E+AGG+L  +P+RL AVPPRI+ GSV G + E +  D  LW+K V  YK+++  L
Sbjct  396  VNSVDEVAGGQLEPFPKRLYAVPPRITDGSVPGFSVESYEEDNNLWRKHVKAYKKIN-NL  454

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
             + GRYRNI+DMNA LG FAAAL    VWVMNV+P  A  +TLGV+YERGLIG YH+WCE
Sbjct  455  LDTGRYRNIMDMNAGLGSFAAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWCE  514

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
              STYPRTYD IH++ IF+LY+++C+ EDILLEMDRILRP+G+++IRD VD++V V+ IA
Sbjct  515  GFSTYPRTYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKIA  574

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQ  82
            + ++W  R+ADHE  PHV EKIL A KQYWTA++
Sbjct  575  NAMRWKTRLADHEGGPHVPEKILFAVKQYWTAEK  608



>ref|XP_004244735.1| PREDICTED: probable methyltransferase PMT18 [Solanum lycopersicum]
Length=631

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
            V+N  E+AGG L  WPER  A+PPRIS+GSV  IT E F  D ++W +RV++YKR+   L
Sbjct  416  VTNSNEVAGGALEKWPERAFAIPPRISTGSVPSITVEKFKEDNKVWSERVSYYKRL-IGL  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              +GRYRN++D NA LGGFAAAL   PVWVMNVVP + + +TLG++YERG IGTY++WCE
Sbjct  475  LPQGRYRNVMDANAYLGGFAAALAKHPVWVMNVVPAKIEPDTLGIIYERGFIGTYNDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A STYPRTYD IHA G+ +LY+DRC+I  ILLEMDRILRP+G+V+ RD V+ +V +KSIA
Sbjct  535  AFSTYPRTYDLIHAGGLISLYQDRCDITYILLEMDRILRPEGTVIFRDGVEALVKIKSIA  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQE  73
            DG++W +R+ DHE  P   EKILIA K YWT +  +E
Sbjct  595  DGMRWQSRIVDHESGPFNPEKILIAVKTYWTGEPKRE  631



>ref|XP_008375441.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008375442.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=632

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 165/216 (76%), Gaps = 2/216 (1%)
 Frame = -1

Query  723  VSNIKEIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQL  544
             SN  ++AGG L  WP+R  A+PPRISSGS+ GITA+    D +LWK+RV HYKR+    
Sbjct  417  TSNPNDVAGGALEKWPQRAFAIPPRISSGSIPGITADKLREDNQLWKERVDHYKRI--VP  474

Query  543  AEKGRYRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCE  364
              KGRYRN++DMNA LGGFAAAL   PVWVMN VP  +  +TLGV+YERG IG Y +WCE
Sbjct  475  ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERGFIGHYQDWCE  534

Query  363  AMSTYPRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIA  184
            A+STYPRTYDFIHA G+F++Y+DRC+I  ILLEMDRILRP+G+VV RD V+I+V VK+I 
Sbjct  535  ALSTYPRTYDFIHAGGVFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKVKAIT  594

Query  183  DGLQWDNRMADHEDSPHVREKILIANKQYWTADQNQ  76
            DG++W +++ DHE  P   EKIL+A K YWT ++ +
Sbjct  595  DGMRWKSQILDHESGPFNPEKILLAVKTYWTGEEKK  630



>ref|XP_010257294.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=615

 Score =   284 bits (727),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 171/218 (78%), Gaps = 5/218 (2%)
 Frame = -1

Query  708  EIAGGELANWPERLTAVPPRISSGSVDGITAEDFSRDTELWKKRVAHYKRVDFQLAEKGR  529
            E++GGE+  +PERL A+PPRI+SGSV G+  + +  D +LW+K V  YK+++ ++ + GR
Sbjct  401  EVSGGEVKPFPERLNAIPPRIASGSVPGVFVDTYLDDNKLWRKHVKAYKKIN-KIIDSGR  459

Query  528  YRNILDMNAKLGGFAAALVDDPVWVMNVVPVEAKVNTLGVVYERGLIGTYHNWCEAMSTY  349
            YRNI+DMNA LG FAAAL    +WVMNVVP  ++ NTLGV+YERGLIG YH+WCEA STY
Sbjct  460  YRNIMDMNAGLGSFAAALESPKLWVMNVVPTISEKNTLGVIYERGLIGIYHDWCEAFSTY  519

Query  348  PRTYDFIHADGIFTLYKDRCEIEDILLEMDRILRPQGSVVIRDDVDIMVSVKSIADGLQW  169
            PRTYD IHA+G+F+LYK++C+ EDILLEMDRILRP+G+V+ RDDVD+++ VK IA G++W
Sbjct  520  PRTYDLIHANGVFSLYKNKCKAEDILLEMDRILRPEGAVIFRDDVDVLIKVKKIAGGIRW  579

Query  168  DNRMADHEDSPHVREKILIANKQYWTADQNQEGSNASS  55
            + +M DHED P V EKIL+A KQYW       G N++S
Sbjct  580  NTKMVDHEDGPLVPEKILVAVKQYWVVG----GDNSTS  613



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1337034311616