BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12183

Length=702
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like          278   9e-87   Sesamum indicum [beniseed]
gb|AJD25256.1|  cytochrome P450 CYP736A121                              271   3e-84   Salvia miltiorrhiza [Chinese salvia]
gb|EYU24031.1|  hypothetical protein MIMGU_mgv1a004909mg                262   8e-81   Erythranthe guttata [common monkey flower]
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g             251   1e-77   Phaseolus vulgaris [French bean]
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    251   2e-76   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              250   3e-76   Glycine max [soybeans]
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g             249   4e-76   Phaseolus vulgaris [French bean]
emb|CDP12933.1|  unnamed protein product                                249   5e-76   Coffea canephora [robusta coffee]
ref|XP_010041191.1|  PREDICTED: cytochrome P450 CYP736A12-like          247   5e-76   
emb|CDP18035.1|  unnamed protein product                                248   1e-75   Coffea canephora [robusta coffee]
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          247   6e-75   Eucalyptus grandis [rose gum]
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          246   1e-74   Eucalyptus grandis [rose gum]
ref|XP_004236729.1|  PREDICTED: cytochrome P450 CYP736A12-like          246   2e-74   Solanum lycopersicum
emb|CDP01384.1|  unnamed protein product                                245   3e-74   Coffea canephora [robusta coffee]
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          245   3e-74   Eucalyptus grandis [rose gum]
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  245   4e-74   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               243   2e-73   Vitis vinifera
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   243   2e-73   Vitis arizonica x Vitis rupestris
emb|CDP01387.1|  unnamed protein product                                242   4e-73   Coffea canephora [robusta coffee]
ref|XP_012075327.1|  PREDICTED: cytochrome P450 CYP736A12-like          241   9e-73   Jatropha curcas
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like              241   1e-72   Cicer arietinum [garbanzo]
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   240   2e-72   Vitis arizonica x Vitis rupestris
ref|XP_003630098.1|  Cytochrome P450                                    239   2e-72   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               240   3e-72   Vitis vinifera
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             238   1e-71   Prunus persica
emb|CBI21489.3|  unnamed protein product                                239   2e-71   Vitis vinifera
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          236   5e-71   Eucalyptus grandis [rose gum]
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             236   8e-71   Phaseolus vulgaris [French bean]
ref|XP_002310007.2|  cytochrome P450 family protein                     236   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_003596030.1|  Cytochrome P450                                    234   3e-70   
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    234   4e-70   Populus euphratica
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          233   7e-70   Populus euphratica
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    233   1e-69   Glycine max [soybeans]
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               233   2e-69   Glycine max [soybeans]
gb|KHN29102.1|  Cytochrome P450 71A1                                    232   2e-69   Glycine soja [wild soybean]
ref|XP_010099912.1|  Cytochrome P450 71A1                               233   2e-69   Morus notabilis
ref|XP_008246192.1|  PREDICTED: cytochrome P450 CYP736A12-like          226   2e-69   Prunus mume [ume]
ref|XP_011025649.1|  PREDICTED: cytochrome P450 CYP736A12-like          226   3e-69   Populus euphratica
gb|AFK79031.1|  cytochrome P450 CYP736A54                               232   4e-69   Bupleurum chinense
ref|XP_002310015.1|  cytochrome P450 family protein                     232   4e-69   
ref|XP_006354724.1|  PREDICTED: cytochrome P450 750A1-like              228   8e-69   
ref|XP_004143494.1|  PREDICTED: cytochrome P450 CYP736A12-like          230   1e-68   Cucumis sativus [cucumbers]
ref|XP_006585306.1|  PREDICTED: cytochrome P450 750A1-like isofor...    228   2e-68   Glycine max [soybeans]
ref|XP_011100884.1|  PREDICTED: cytochrome P450 CYP736A12-like          229   2e-68   Sesamum indicum [beniseed]
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             229   3e-68   Populus trichocarpa [western balsam poplar]
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             229   3e-68   
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          229   4e-68   Prunus mume [ume]
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             229   4e-68   Prunus persica
emb|CDP12853.1|  unnamed protein product                                227   5e-68   Coffea canephora [robusta coffee]
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          229   5e-68   
dbj|BAP15886.1|  cytochrome P450 71AU50                                 228   6e-68   Prunus mume [ume]
ref|XP_009782203.1|  PREDICTED: cytochrome P450 CYP736A12-like          228   6e-68   Nicotiana sylvestris
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             228   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011025648.1|  PREDICTED: cytochrome P450 CYP736A12-like          222   1e-67   Populus euphratica
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          226   4e-67   
ref|XP_006367702.1|  PREDICTED: cytochrome P450 71A1-like               228   4e-67   
gb|EYU24037.1|  hypothetical protein MIMGU_mgv1a005167mg                226   4e-67   Erythranthe guttata [common monkey flower]
ref|XP_004304846.1|  PREDICTED: cytochrome P450 CYP736A12-like          226   4e-67   Fragaria vesca subsp. vesca
ref|XP_009770873.1|  PREDICTED: cytochrome P450 CYP736A12-like          226   5e-67   Nicotiana sylvestris
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          226   6e-67   Prunus mume [ume]
gb|KHN38214.1|  Cytochrome P450 71A1                                    224   7e-67   Glycine soja [wild soybean]
ref|XP_002310014.1|  cytochrome P450 family protein                     226   8e-67   
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    226   9e-67   
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             226   9e-67   Populus trichocarpa [western balsam poplar]
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             225   1e-66   Prunus persica
ref|XP_006354722.1|  PREDICTED: cytochrome P450 71A1-like               225   1e-66   Solanum tuberosum [potatoes]
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             225   1e-66   Prunus persica
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          225   1e-66   Prunus mume [ume]
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             225   1e-66   Prunus persica
ref|XP_004143566.2|  PREDICTED: cytochrome P450 CYP736A12-like          225   1e-66   Cucumis sativus [cucumbers]
ref|XP_007048087.1|  Cytochrome P450                                    224   3e-66   
ref|XP_011090597.1|  PREDICTED: cytochrome P450 CYP736A12-like          224   4e-66   Sesamum indicum [beniseed]
gb|KGN48794.1|  hypothetical protein Csa_6G501340                       218   4e-66   Cucumis sativus [cucumbers]
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             224   5e-66   
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          224   5e-66   Pyrus x bretschneideri [bai li]
ref|XP_009802012.1|  PREDICTED: cytochrome P450 CYP736A12-like          224   5e-66   Nicotiana sylvestris
ref|XP_009615258.1|  PREDICTED: cytochrome P450 CYP736A12-like          223   6e-66   Nicotiana tomentosiformis
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               223   8e-66   Cicer arietinum [garbanzo]
ref|XP_009586899.1|  PREDICTED: cytochrome P450 CYP736A12-like          223   8e-66   Nicotiana tomentosiformis
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             223   9e-66   Citrus clementina [clementine]
ref|XP_011090598.1|  PREDICTED: cytochrome P450 CYP736A12-like          223   9e-66   
ref|XP_009607200.1|  PREDICTED: cytochrome P450 CYP736A12-like          223   1e-65   
ref|XP_004237615.1|  PREDICTED: cytochrome P450 CYP736A12-like          222   2e-65   Solanum lycopersicum
ref|XP_009607201.1|  PREDICTED: cytochrome P450 CYP736A12-like          222   2e-65   Nicotiana tomentosiformis
gb|KJB37875.1|  hypothetical protein B456_006G224300                    222   2e-65   Gossypium raimondii
ref|XP_009588170.1|  PREDICTED: cytochrome P450 CYP736A12-like          221   3e-65   Nicotiana tomentosiformis
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          221   5e-65   Cucumis melo [Oriental melon]
ref|XP_006363549.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    221   5e-65   Solanum tuberosum [potatoes]
ref|XP_009608339.1|  PREDICTED: cytochrome P450 CYP736A12-like          220   9e-65   Nicotiana tomentosiformis
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             220   1e-64   Phaseolus vulgaris [French bean]
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         220   1e-64   Morus notabilis
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          219   2e-64   Cucumis melo [Oriental melon]
ref|XP_004237505.1|  PREDICTED: cytochrome P450 CYP736A12-like          219   2e-64   Solanum lycopersicum
emb|CDP12934.1|  unnamed protein product                                216   3e-64   Coffea canephora [robusta coffee]
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             219   4e-64   Populus trichocarpa [western balsam poplar]
gb|KJB37877.1|  hypothetical protein B456_006G224400                    218   6e-64   Gossypium raimondii
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          218   6e-64   Cucumis melo [Oriental melon]
ref|XP_009767392.1|  PREDICTED: cytochrome P450 CYP736A12-like          218   7e-64   Nicotiana sylvestris
ref|XP_011657998.1|  PREDICTED: cytochrome P450 CYP736A12-like          218   8e-64   Cucumis sativus [cucumbers]
ref|XP_011090604.1|  PREDICTED: cytochrome P450 CYP736A12-like          216   5e-63   Sesamum indicum [beniseed]
gb|EYU31078.1|  hypothetical protein MIMGU_mgv1a004963mg                216   6e-63   Erythranthe guttata [common monkey flower]
ref|XP_009631554.1|  PREDICTED: cytochrome P450 CYP736A12-like          215   1e-62   Nicotiana tomentosiformis
ref|XP_009586693.1|  PREDICTED: cytochrome P450 CYP736A12-like          209   1e-62   Nicotiana tomentosiformis
gb|AJD25257.1|  cytochrome P450 CYP736A122                              214   1e-62   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009770688.1|  PREDICTED: cytochrome P450 CYP736A12-like          214   3e-62   Nicotiana sylvestris
gb|AHN09742.1|  biphenyl-4-hydroxylase                                  214   3e-62   Sorbus aucuparia [European mountain ash]
ref|XP_004252512.2|  PREDICTED: cytochrome P450 CYP736A12-like          208   8e-62   
ref|XP_009378500.1|  PREDICTED: cytochrome P450 CYP736A12-like          212   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_008385982.1|  PREDICTED: cytochrome P450 CYP736A12-like          212   1e-61   
ref|XP_011658487.1|  PREDICTED: cytochrome P450 CYP736A12-like          212   1e-61   Cucumis sativus [cucumbers]
ref|XP_008440670.1|  PREDICTED: cytochrome P450 CYP736A12-like          212   1e-61   Cucumis melo [Oriental melon]
gb|EYU24036.1|  hypothetical protein MIMGU_mgv1a005182mg                211   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_009600860.1|  PREDICTED: cytochrome P450 CYP736A12-like          210   5e-61   Nicotiana tomentosiformis
gb|KCW54385.1|  hypothetical protein EUGRSUZ_I00337                     205   5e-61   Eucalyptus grandis [rose gum]
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             209   2e-60   Citrus clementina [clementine]
ref|XP_008385983.1|  PREDICTED: cytochrome P450 CYP736A12-like          209   2e-60   
ref|XP_006346619.1|  PREDICTED: cytochrome P450 71A1-like               208   3e-60   Solanum tuberosum [potatoes]
ref|XP_004252295.1|  PREDICTED: cytochrome P450 CYP736A12-like          208   4e-60   Solanum lycopersicum
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               206   2e-59   Solanum tuberosum [potatoes]
ref|XP_006366158.1|  PREDICTED: cytochrome P450 750A1-like              206   2e-59   Solanum tuberosum [potatoes]
ref|XP_009790894.1|  PREDICTED: cytochrome P450 CYP736A12-like          197   3e-59   Nicotiana sylvestris
ref|XP_009372721.1|  PREDICTED: cytochrome P450 CYP736A12-like          206   3e-59   Pyrus x bretschneideri [bai li]
ref|XP_004252382.1|  PREDICTED: cytochrome P450 CYP736A12               205   5e-59   Solanum lycopersicum
ref|XP_011100886.1|  PREDICTED: cytochrome P450 CYP736A12-like          206   5e-59   Sesamum indicum [beniseed]
ref|XP_008344234.1|  PREDICTED: cytochrome P450 CYP736A12-like          204   2e-58   Malus domestica [apple tree]
gb|EYU27291.1|  hypothetical protein MIMGU_mgv1a023536mg                204   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          203   3e-58   Malus domestica [apple tree]
ref|XP_008441066.1|  PREDICTED: cytochrome P450 CYP736A12-like          203   3e-58   Cucumis melo [Oriental melon]
ref|XP_009372725.1|  PREDICTED: cytochrome P450 CYP736A12-like          202   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_006354708.1|  PREDICTED: flavonoid 3'-monooxygenase-like         202   5e-58   Solanum tuberosum [potatoes]
ref|XP_009372726.1|  PREDICTED: cytochrome P450 CYP736A12-like          202   5e-58   Pyrus x bretschneideri [bai li]
gb|EYU31073.1|  hypothetical protein MIMGU_mgv1a004944mg                202   6e-58   Erythranthe guttata [common monkey flower]
ref|XP_009372727.1|  PREDICTED: cytochrome P450 CYP736A12-like          202   7e-58   
ref|XP_006428068.1|  hypothetical protein CICLE_v10027567mg             200   1e-57   
ref|XP_006365792.1|  PREDICTED: cytochrome P450 71A1-like               202   1e-57   Solanum tuberosum [potatoes]
ref|XP_009372715.1|  PREDICTED: cytochrome P450 CYP736A12-like          201   2e-57   
ref|XP_009770874.1|  PREDICTED: cytochrome P450 CYP736A12-like          196   2e-57   Nicotiana sylvestris
ref|XP_007214078.1|  hypothetical protein PRUPE_ppa017849mg             198   2e-57   
ref|XP_006428066.1|  hypothetical protein CICLE_v10025445mg             201   3e-57   Citrus clementina [clementine]
gb|EYU24035.1|  hypothetical protein MIMGU_mgv1a020942mg                201   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_006493867.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    201   3e-57   
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          200   4e-57   
ref|XP_004153472.1|  PREDICTED: cytochrome P450 CYP736A12-like          199   6e-57   Cucumis sativus [cucumbers]
gb|KDO59985.1|  hypothetical protein CISIN_1g036759mg                   190   8e-57   Citrus sinensis [apfelsine]
ref|XP_004237617.1|  PREDICTED: cytochrome P450 CYP736A12-like          198   2e-56   Solanum lycopersicum
ref|XP_004237435.1|  PREDICTED: cytochrome P450 CYP736A12-like          198   3e-56   Solanum lycopersicum
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg             197   6e-56   Prunus persica
ref|XP_009629564.1|  PREDICTED: cytochrome P450 CYP736A12-like          195   8e-56   
ref|XP_006348217.1|  PREDICTED: cytochrome P450 71A1-like               196   1e-55   Solanum tuberosum [potatoes]
ref|XP_006354701.1|  PREDICTED: cytochrome P450 84A1-like               196   1e-55   Solanum tuberosum [potatoes]
ref|XP_006365796.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    196   1e-55   Solanum tuberosum [potatoes]
gb|KDO59987.1|  hypothetical protein CISIN_1g025878mg                   189   2e-55   Citrus sinensis [apfelsine]
ref|XP_006365795.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    196   2e-55   Solanum tuberosum [potatoes]
emb|CDP01385.1|  unnamed protein product                                189   4e-55   Coffea canephora [robusta coffee]
ref|XP_006354723.1|  PREDICTED: cytochrome P450 71A2-like               192   1e-54   
ref|XP_006354704.1|  PREDICTED: cytochrome P450 750A1-like              192   3e-54   Solanum tuberosum [potatoes]
emb|CDP12931.1|  unnamed protein product                                196   9e-54   Coffea canephora [robusta coffee]
ref|XP_008440669.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    186   1e-53   
gb|KGN49698.1|  hypothetical protein Csa_5G075690                       186   2e-53   Cucumis sativus [cucumbers]
gb|AJD25258.1|  cytochrome P450 CYP736A123                              189   6e-53   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004142333.2|  PREDICTED: cytochrome P450 CYP736A12-like          186   1e-51   Cucumis sativus [cucumbers]
gb|KGN56080.1|  hypothetical protein Csa_3G067750                       181   1e-51   Cucumis sativus [cucumbers]
ref|XP_008460602.1|  PREDICTED: cytochrome P450 CYP736A12-like          186   1e-51   Cucumis melo [Oriental melon]
ref|XP_004253509.1|  PREDICTED: cytochrome P450 CYP736A12-like          185   2e-51   Solanum lycopersicum
ref|XP_006354705.1|  PREDICTED: cytochrome P450 750A1-like              184   3e-51   Solanum tuberosum [potatoes]
ref|XP_009631583.1|  PREDICTED: cytochrome P450 CYP736A12-like          174   1e-50   Nicotiana tomentosiformis
ref|XP_011658488.1|  PREDICTED: cytochrome P450 CYP736A12-like          182   4e-50   Cucumis sativus [cucumbers]
ref|XP_011652733.1|  PREDICTED: cytochrome P450 CYP736A12-like          180   1e-49   Cucumis sativus [cucumbers]
ref|XP_002275714.2|  PREDICTED: cytochrome P450 CYP736A12-like          177   2e-48   Vitis vinifera
gb|EYU31075.1|  hypothetical protein MIMGU_mgv1a005090mg                176   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_010094782.1|  Cytochrome P450 71A1                               176   5e-48   
ref|XP_009791748.1|  PREDICTED: cytochrome P450 CYP736A12-like          169   6e-48   Nicotiana sylvestris
ref|XP_009337244.1|  PREDICTED: cytochrome P450 CYP736A12-like          174   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_009337218.1|  PREDICTED: cytochrome P450 CYP736A12-like          174   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          174   5e-47   
ref|XP_011652735.1|  PREDICTED: cytochrome P450 CYP736A12-like          173   5e-47   Cucumis sativus [cucumbers]
dbj|BAD15331.1|  cytochrome P450                                        173   6e-47   Panax ginseng [Asiatic ginseng]
gb|EYU31074.1|  hypothetical protein MIMGU_mgv1a005121mg                173   7e-47   Erythranthe guttata [common monkey flower]
ref|XP_008385725.1|  PREDICTED: cytochrome P450 CYP736A12-like          173   8e-47   
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               172   1e-46   Vitis vinifera
ref|XP_009339381.1|  PREDICTED: cytochrome P450 CYP736A12-like          164   3e-46   Pyrus x bretschneideri [bai li]
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         171   4e-46   Jatropha curcas
emb|CAN69566.1|  hypothetical protein VITISV_033535                     176   5e-46   Vitis vinifera
ref|XP_012092981.1|  PREDICTED: cytochrome P450 CYP736A12-like          171   5e-46   Jatropha curcas
ref|XP_004253368.1|  PREDICTED: cytochrome P450 CYP736A12-like          162   8e-46   Solanum lycopersicum
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          170   9e-46   
sp|H2DH18.1|C7A12_PANGI  RecName: Full=Cytochrome P450 CYP736A12        170   1e-45   Panax ginseng [Asiatic ginseng]
gb|AAL66194.1|AF386512_1  cytochrome P450                               169   2e-45   Pyrus communis
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          169   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_002514610.1|  flavonoid 3-hydroxylase, putative                  169   3e-45   Ricinus communis
ref|XP_010663579.1|  PREDICTED: cytochrome P450 CYP736A12-like          168   3e-45   Vitis vinifera
ref|XP_008374965.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    169   4e-45   
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             168   4e-45   
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          168   4e-45   
ref|XP_003630097.1|  Cytochrome P450                                    167   6e-45   
emb|CBI15433.3|  unnamed protein product                                168   6e-45   Vitis vinifera
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          167   8e-45   Pyrus x bretschneideri [bai li]
ref|XP_007211074.1|  hypothetical protein PRUPE_ppa017688mg             166   1e-44   
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          167   1e-44   Malus domestica [apple tree]
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  167   1e-44   Ricinus communis
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          167   2e-44   Prunus mume [ume]
gb|KJB78920.1|  hypothetical protein B456_013G025400                    166   2e-44   Gossypium raimondii
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          166   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          166   2e-44   
gb|KJB78919.1|  hypothetical protein B456_013G025300                    162   3e-44   Gossypium raimondii
ref|XP_003627829.1|  Cytochrome P450                                    166   4e-44   
gb|KHN32022.1|  Cytochrome P450 71A1                                    164   2e-43   Glycine soja [wild soybean]
ref|XP_004490596.1|  PREDICTED: uncharacterized protein LOC101501242    167   2e-43   
ref|XP_010094781.1|  Cytochrome P450 71D8                               163   4e-43   Morus notabilis
gb|KHN32024.1|  Cytochrome P450 71A1                                    160   2e-42   Glycine soja [wild soybean]
ref|XP_003534174.2|  PREDICTED: cytochrome P450 750A1-like              164   3e-42   Glycine max [soybeans]
ref|XP_003630839.1|  Cytochrome P450                                    155   4e-42   
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          160   4e-42   
ref|XP_004490599.1|  PREDICTED: uncharacterized protein LOC101502297    163   6e-42   
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          159   7e-42   Pyrus x bretschneideri [bai li]
ref|XP_002522214.1|  cytochrome P450, putative                          155   9e-42   
ref|XP_007199546.1|  hypothetical protein PRUPE_ppb020039mg             151   1e-41   
ref|XP_002285460.2|  PREDICTED: cytochrome P450 71B34-like              159   1e-41   Vitis vinifera
ref|XP_002285472.2|  PREDICTED: cytochrome P450 71B34-like              159   1e-41   Vitis vinifera
gb|KJB34360.1|  hypothetical protein B456_006G062200                    159   1e-41   Gossypium raimondii
ref|XP_007152790.1|  hypothetical protein PHAVU_004G159900g             158   2e-41   Phaseolus vulgaris [French bean]
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               158   2e-41   Glycine max [soybeans]
ref|XP_007036495.1|  Cytochrome P450 superfamily protein, putativ...    158   2e-41   
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              161   3e-41   
emb|CAN60733.1|  hypothetical protein VITISV_023587                     157   3e-41   Vitis vinifera
ref|XP_003636948.1|  Cytochrome P450                                    154   4e-41   
ref|XP_010650716.1|  PREDICTED: cytochrome P450 71B34-like              157   4e-41   Vitis vinifera
gb|KHN20715.1|  Cytochrome P450 71A1                                    157   6e-41   Glycine soja [wild soybean]
ref|XP_002285456.1|  PREDICTED: cytochrome P450 71B34-like              156   1e-40   Vitis vinifera
gb|KJB13389.1|  hypothetical protein B456_002G072000                    156   1e-40   Gossypium raimondii
emb|CAN83446.1|  hypothetical protein VITISV_019663                     159   1e-40   Vitis vinifera
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               155   2e-40   Cicer arietinum [garbanzo]
gb|KHG07950.1|  Cytochrome P450                                         155   4e-40   Gossypium arboreum [tree cotton]
gb|KHF97324.1|  Cytochrome P450                                         154   4e-40   Gossypium arboreum [tree cotton]
ref|XP_003528941.2|  PREDICTED: cytochrome P450 750A1-like              157   5e-40   Glycine max [soybeans]
emb|CAN69565.1|  hypothetical protein VITISV_033534                     154   5e-40   Vitis vinifera
ref|XP_004299223.2|  PREDICTED: cytochrome P450 CYP736A12-like          154   7e-40   Fragaria vesca subsp. vesca
ref|XP_002275691.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X1    154   7e-40   Vitis vinifera
ref|XP_007152787.1|  hypothetical protein PHAVU_004G159600g             154   7e-40   Phaseolus vulgaris [French bean]
ref|XP_007036496.1|  Cytochrome P450 superfamily protein, putativ...    154   8e-40   
ref|XP_004301061.2|  PREDICTED: cytochrome P450 CYP736A12-like          154   1e-39   Fragaria vesca subsp. vesca
ref|XP_003600322.1|  Cytochrome P450                                    153   1e-39   Medicago truncatula
ref|XP_010111002.1|  Cytochrome P450 71D10                              153   1e-39   
gb|KEH27058.1|  cytochrome P450 family 71 protein                       153   1e-39   Medicago truncatula
gb|KJB13388.1|  hypothetical protein B456_002G071900                    153   2e-39   Gossypium raimondii
ref|XP_003600328.1|  Cytochrome P450                                    152   2e-39   Medicago truncatula
ref|XP_007152789.1|  hypothetical protein PHAVU_004G159800g             152   3e-39   Phaseolus vulgaris [French bean]
gb|KCW79056.1|  hypothetical protein EUGRSUZ_C00482                     151   3e-39   Eucalyptus grandis [rose gum]
ref|XP_010045641.1|  PREDICTED: cytochrome P450 CYP736A12-like          152   3e-39   Eucalyptus grandis [rose gum]
ref|XP_007036492.1|  Cytochrome P450 superfamily protein                151   6e-39   
ref|XP_010050339.1|  PREDICTED: cytochrome P450 CYP736A12-like          151   6e-39   
gb|KJB81628.1|  hypothetical protein B456_013G153200                    151   7e-39   Gossypium raimondii
ref|XP_002523242.1|  cytochrome P450, putative                          151   8e-39   
gb|AES98625.2|  cytochrome P450 family 71 protein                       150   1e-38   Medicago truncatula
ref|XP_012070986.1|  PREDICTED: cytochrome P450 71D10-like              150   1e-38   Jatropha curcas
ref|XP_007216122.1|  hypothetical protein PRUPE_ppa018839mg             150   2e-38   
ref|XP_003600327.1|  Cytochrome P450                                    150   2e-38   Medicago truncatula
gb|ABR17846.1|  unknown                                                 150   2e-38   Picea sitchensis
ref|XP_004512940.1|  PREDICTED: cytochrome P450 71A1-like               150   2e-38   Cicer arietinum [garbanzo]
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg             146   3e-38   
ref|XP_002285457.1|  PREDICTED: cytochrome P450 71B34                   149   3e-38   Vitis vinifera
gb|KJB82210.1|  hypothetical protein B456_013G181700                    149   4e-38   Gossypium raimondii
ref|XP_010044548.1|  PREDICTED: cytochrome P450 71B36-like              149   4e-38   Eucalyptus grandis [rose gum]
gb|KDP34574.1|  hypothetical protein JCGZ_11124                         145   4e-38   Jatropha curcas
ref|XP_010044549.1|  PREDICTED: cytochrome P450 71B10-like              149   5e-38   Eucalyptus grandis [rose gum]
ref|XP_010099910.1|  Cytochrome P450 750A1                              140   5e-38   
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             148   7e-38   
gb|KJB61440.1|  hypothetical protein B456_009G358600                    147   7e-38   Gossypium raimondii
emb|CDP19360.1|  unnamed protein product                                148   9e-38   Coffea canephora [robusta coffee]
ref|XP_012076040.1|  PREDICTED: cytochrome P450 71B34-like              146   9e-38   
gb|KCW79058.1|  hypothetical protein EUGRSUZ_C00484                     148   1e-37   Eucalyptus grandis [rose gum]
gb|ABR16640.1|  unknown                                                 148   1e-37   Picea sitchensis
ref|XP_003615667.1|  Cytochrome P450                                    150   1e-37   
gb|KCW48536.1|  hypothetical protein EUGRSUZ_K02211                     147   1e-37   Eucalyptus grandis [rose gum]
ref|XP_012085876.1|  PREDICTED: cytochrome P450 71B36-like              144   1e-37   
ref|XP_010036876.1|  PREDICTED: cytochrome P450 CYP736A12-like          147   1e-37   Eucalyptus grandis [rose gum]
ref|XP_010047217.1|  PREDICTED: cytochrome P450 CYP736A12-like          147   2e-37   Eucalyptus grandis [rose gum]
gb|KJB61456.1|  hypothetical protein B456_009G359000                    147   2e-37   Gossypium raimondii
gb|KHG02344.1|  Cytochrome P450                                         147   2e-37   Gossypium arboreum [tree cotton]
gb|KJB61457.1|  hypothetical protein B456_009G359000                    147   2e-37   
gb|KJB61438.1|  hypothetical protein B456_009G358400                    147   2e-37   
ref|XP_003525259.2|  PREDICTED: cytochrome P450 750A1-like              147   2e-37   
ref|XP_002530058.1|  cytochrome P450, putative                          147   2e-37   
emb|CBI16810.3|  unnamed protein product                                149   2e-37   
gb|KJB61441.1|  hypothetical protein B456_009G358600                    147   2e-37   
gb|KHG24310.1|  Cytochrome P450                                         146   2e-37   
gb|KHG07193.1|  Cytochrome P450                                         146   2e-37   
gb|ACN40130.1|  unknown                                                 147   2e-37   
gb|KHN20714.1|  Cytochrome P450 71D10                                   147   2e-37   
ref|XP_002523241.1|  cytochrome P450, putative                          146   3e-37   
ref|XP_002526055.1|  cytochrome P450, putative                          144   3e-37   
ref|XP_007160365.1|  hypothetical protein PHAVU_002G315400g             147   3e-37   
ref|XP_009617817.1|  PREDICTED: cytochrome P450 CYP736A12-like          146   3e-37   
gb|KHG20290.1|  Cytochrome P450 protein                                 146   3e-37   
gb|ACN40749.1|  unknown                                                 147   3e-37   
gb|KHG19246.1|  Cytochrome P450                                         146   3e-37   
gb|KJB60525.1|  hypothetical protein B456_009G310200                    146   4e-37   
gb|KDP36607.1|  hypothetical protein JCGZ_08423                         145   4e-37   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          146   4e-37   
ref|XP_007146605.1|  hypothetical protein PHAVU_006G054200g             146   4e-37   
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     146   4e-37   
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              146   5e-37   
ref|XP_011465681.1|  PREDICTED: cytochrome P450 CYP736A12-like          146   5e-37   
gb|ACJ85671.1|  unknown                                                 145   5e-37   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              146   5e-37   
ref|XP_012076015.1|  PREDICTED: cytochrome P450 71B34-like              146   5e-37   
gb|KDP34532.1|  hypothetical protein JCGZ_11082                         145   6e-37   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             145   7e-37   
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   145   7e-37   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    145   8e-37   
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             145   8e-37   
gb|KCW86628.1|  hypothetical protein EUGRSUZ_B03254                     142   8e-37   
ref|XP_010045642.1|  PREDICTED: cytochrome P450 CYP736A12-like          145   1e-36   
ref|XP_012077833.1|  PREDICTED: cytochrome P450 71D9-like               140   1e-36   
gb|KCW78883.1|  hypothetical protein EUGRSUZ_C00326                     145   1e-36   
emb|CAR92135.1|  5-epi-aristolochene-1,3-hydroxylase                    139   1e-36   
ref|XP_009587294.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    139   1e-36   
ref|XP_012076039.1|  PREDICTED: cytochrome P450 71B34-like              144   1e-36   
gb|AES69199.2|  flavonoid hydroxylase                                   144   2e-36   
gb|KDP26675.1|  hypothetical protein JCGZ_17833                         144   2e-36   
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                144   2e-36   
ref|XP_009776870.1|  PREDICTED: premnaspirodiene oxygenase-like         142   2e-36   
ref|XP_007020549.1|  Cytochrome P450                                    144   2e-36   
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like               143   2e-36   
dbj|BAF98468.1|  cytochrome P450                                        144   3e-36   
emb|CDP22002.1|  unnamed protein product                                140   3e-36   
emb|CBI16811.3|  unnamed protein product                                143   3e-36   
ref|XP_008799325.1|  PREDICTED: cytochrome P450 71A1-like               144   3e-36   
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           144   3e-36   
ref|XP_012076016.1|  PREDICTED: cytochrome P450 71B36-like              139   3e-36   
gb|KDP33179.1|  hypothetical protein JCGZ_13444                         140   4e-36   
gb|EYU22011.1|  hypothetical protein MIMGU_mgv1a022953mg                140   4e-36   
gb|AFK79030.1|  cytochrome P450 CYP736A53                               143   4e-36   
ref|XP_010917480.1|  PREDICTED: cytochrome P450 750A1-like              140   4e-36   
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             143   5e-36   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               143   5e-36   
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               143   5e-36   
gb|KEH28165.1|  cytochrome P450 family 71 protein                       142   5e-36   
gb|KJB61458.1|  hypothetical protein B456_009G359100                    143   5e-36   
ref|XP_008353443.1|  PREDICTED: premnaspirodiene oxygenase-like         140   6e-36   
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         143   6e-36   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       143   6e-36   
ref|XP_011005616.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    143   7e-36   
gb|EYU21984.1|  hypothetical protein MIMGU_mgv1a019764mg                138   7e-36   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               142   7e-36   
ref|XP_004291274.1|  PREDICTED: cytochrome P450 CYP736A12-like          142   8e-36   
ref|XP_009371765.1|  PREDICTED: premnaspirodiene oxygenase-like         143   8e-36   
ref|XP_008449122.1|  PREDICTED: cytochrome P450 CYP736A12-like          142   8e-36   
emb|CDP20259.1|  unnamed protein product                                142   8e-36   
emb|CDP12699.1|  unnamed protein product                                145   9e-36   
ref|XP_010044542.1|  PREDICTED: cytochrome P450 71B34-like              142   9e-36   
ref|XP_010027137.1|  PREDICTED: cytochrome P450 71A22-like              142   9e-36   
gb|KHN01537.1|  Cytochrome P450 71D11                                   142   1e-35   
ref|XP_003549267.1|  PREDICTED: cytochrome P450 71D11-like              142   1e-35   
gb|AES98640.2|  cytochrome P450 family 71 protein                       137   1e-35   
ref|XP_010045513.1|  PREDICTED: cytochrome P450 71A4-like               142   1e-35   
ref|XP_009344940.1|  PREDICTED: premnaspirodiene oxygenase-like         142   1e-35   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         142   1e-35   
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         142   2e-35   
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         141   2e-35   
gb|ACN40859.1|  unknown                                                 141   2e-35   
ref|XP_007209908.1|  hypothetical protein PRUPE_ppa004332mg             141   2e-35   
gb|AGT17102.1|  flavonoid 3-monooxygenase                               139   2e-35   
ref|XP_012073921.1|  PREDICTED: cytochrome P450 71B34-like              141   2e-35   
ref|XP_004308347.1|  PREDICTED: cytochrome P450 CYP736A12-like          141   3e-35   
gb|KDP36605.1|  hypothetical protein JCGZ_08421                         139   3e-35   
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         141   3e-35   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             140   3e-35   
ref|XP_010911520.1|  PREDICTED: cytochrome P450 71A9-like               140   3e-35   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             141   3e-35   
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               141   3e-35   
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         141   3e-35   
ref|XP_007036499.1|  Cytochrome P450, putative                          140   3e-35   
ref|XP_011034037.1|  PREDICTED: cytochrome P450 71B10-like              140   4e-35   
emb|CBI14925.3|  unnamed protein product                                140   4e-35   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               140   4e-35   
ref|XP_012073929.1|  PREDICTED: cytochrome P450 71B36-like              139   5e-35   
ref|XP_012076029.1|  PREDICTED: cytochrome P450 71B34-like              140   5e-35   
emb|CAN67678.1|  hypothetical protein VITISV_035274                     140   5e-35   
ref|XP_008779328.1|  PREDICTED: cytochrome P450 71A1-like               140   5e-35   
ref|XP_003615678.1|  Cytochrome P450                                    140   5e-35   
ref|XP_002540268.1|  cytochrome P450, putative                          136   5e-35   
gb|ABR18019.1|  unknown                                                 137   5e-35   
ref|XP_006351420.1|  PREDICTED: cytochrome P450 71A22-like              140   5e-35   
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         140   5e-35   
ref|XP_007146609.1|  hypothetical protein PHAVU_006G054600g             140   5e-35   
gb|AAK62343.2|  elicitor-inducible cytochrome P450                      140   6e-35   
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         140   6e-35   
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    140   6e-35   
ref|XP_006364814.1|  PREDICTED: premnaspirodiene oxygenase-like         140   7e-35   
ref|XP_010663080.1|  PREDICTED: cytochrome P450 71A25                   140   7e-35   
ref|XP_010100350.1|  Cytochrome P450                                    140   7e-35   
ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               140   8e-35   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                140   8e-35   
ref|XP_006841362.1|  PREDICTED: cytochrome P450 71A1                    136   9e-35   
ref|XP_008368444.1|  PREDICTED: premnaspirodiene oxygenase-like         140   9e-35   
ref|XP_010046631.1|  PREDICTED: cytochrome P450 71B36-like              138   9e-35   
ref|XP_011462021.1|  PREDICTED: cytochrome P450 71A6-like               134   9e-35   
ref|XP_002315656.2|  hypothetical protein POPTR_0010s05910g             139   9e-35   
gb|KCW86630.1|  hypothetical protein EUGRSUZ_B03258                     139   1e-34   
ref|XP_009344943.1|  PREDICTED: premnaspirodiene oxygenase-like         139   1e-34   
ref|XP_009375474.1|  PREDICTED: cytochrome P450 71A1-like               139   1e-34   
gb|KJB31102.1|  hypothetical protein B456_005G1760002                   139   1e-34   
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    139   1e-34   
ref|XP_008809621.1|  PREDICTED: cytochrome P450 71A1-like               139   1e-34   
gb|KJB34359.1|  hypothetical protein B456_006G062100                    139   1e-34   
ref|XP_003615666.1|  Cytochrome P450                                    139   1e-34   
ref|XP_012070987.1|  PREDICTED: premnaspirodiene oxygenase-like         139   1e-34   
ref|XP_012079956.1|  PREDICTED: cytochrome P450 71A26-like              139   1e-34   
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    139   1e-34   
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         139   2e-34   
ref|XP_009371645.1|  PREDICTED: premnaspirodiene oxygenase-like         139   2e-34   
ref|XP_006367730.1|  PREDICTED: premnaspirodiene oxygenase-like         136   2e-34   
ref|XP_004499226.1|  PREDICTED: cytochrome P450 71B37-like              139   2e-34   
gb|KJB42408.1|  hypothetical protein B456_007G151200                    139   2e-34   
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               139   2e-34   
gb|KHM99472.1|  Cytochrome P450 71D11                                   139   2e-34   
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         139   2e-34   
gb|ABR16325.1|  unknown                                                 139   2e-34   
gb|KEH34025.1|  cytochrome P450 family 71 protein                       139   2e-34   
gb|ABA01477.1|  cytochrome P450 DDWF1                                   139   2e-34   
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               139   2e-34   
ref|XP_010916817.1|  PREDICTED: cytochrome P450 71A1-like               139   2e-34   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              139   2e-34   
ref|XP_004236286.1|  PREDICTED: cytochrome P450 71A22-like              139   2e-34   
emb|CDP19793.1|  unnamed protein product                                134   2e-34   
ref|XP_011071981.1|  PREDICTED: cytochrome P450 71A8-like               139   2e-34   
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g             138   2e-34   
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    138   2e-34   
gb|ACN40196.1|  unknown                                                 139   2e-34   
ref|XP_009617877.1|  PREDICTED: premnaspirodiene oxygenase-like         138   2e-34   
gb|AGT17103.1|  flavonoid 3-monooxygenase                               138   2e-34   
ref|XP_010045518.1|  PREDICTED: cytochrome P450 71A3-like               138   2e-34   
gb|EYU21982.1|  hypothetical protein MIMGU_mgv1a026917mg                138   2e-34   
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         138   2e-34   
ref|XP_004299156.1|  PREDICTED: cytochrome P450 71A24-like              138   2e-34   
ref|XP_011085047.1|  PREDICTED: cytochrome P450 71A21-like              138   3e-34   
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         138   3e-34   
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               138   3e-34   
ref|XP_010042767.1|  PREDICTED: cytochrome P450 71A22-like              138   3e-34   
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    138   3e-34   
ref|XP_006290955.1|  hypothetical protein CARUB_v10017071mg             138   3e-34   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               138   3e-34   
ref|XP_008777462.1|  PREDICTED: cytochrome P450 71A1-like               138   3e-34   
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         138   3e-34   
ref|XP_012071260.1|  PREDICTED: cytochrome P450 71D9-like               138   3e-34   
ref|XP_009609720.1|  PREDICTED: premnaspirodiene oxygenase              136   3e-34   
ref|XP_009344942.1|  PREDICTED: premnaspirodiene oxygenase-like         138   3e-34   
ref|XP_004232610.1|  PREDICTED: premnaspirodiene oxygenase-like         138   3e-34   
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              138   3e-34   
ref|XP_004305999.2|  PREDICTED: uncharacterized protein LOC101299609    141   3e-34   
gb|AIU56748.1|  cytochrome P450 CYP71B40v3                              138   4e-34   
ref|XP_010027123.1|  PREDICTED: cytochrome P450 71A22-like              138   4e-34   
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         138   4e-34   
ref|XP_012076035.1|  PREDICTED: cytochrome P450 71B35-like              137   4e-34   
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               138   4e-34   
ref|XP_004303697.2|  PREDICTED: cytochrome P450 71A1-like               138   4e-34   
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg                138   4e-34   
ref|NP_001147572.1|  flavonoid 3-monooxygenase                          138   4e-34   
gb|KCW86633.1|  hypothetical protein EUGRSUZ_B03261                     137   4e-34   
emb|CBI35858.3|  unnamed protein product                                137   4e-34   
ref|XP_002312660.2|  hypothetical protein POPTR_0008s18810g             137   4e-34   
ref|XP_009357363.1|  PREDICTED: premnaspirodiene oxygenase-like         137   4e-34   
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               138   4e-34   
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    137   4e-34   
emb|CAN77776.1|  hypothetical protein VITISV_021888                     137   4e-34   
emb|CAC24711.1|  cytochrome P450                                        137   4e-34   
ref|XP_006856371.2|  PREDICTED: premnaspirodiene oxygenase              137   4e-34   
gb|KHG22812.1|  Cytochrome P450                                         137   5e-34   
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               137   5e-34   
ref|XP_006445536.1|  hypothetical protein CICLE_v10004106mg             135   5e-34   
ref|XP_006856442.1|  PREDICTED: cytochrome P450 71A1                    137   5e-34   
ref|XP_010046630.1|  PREDICTED: cytochrome P450 71B36-like              137   5e-34   
ref|XP_009795889.1|  PREDICTED: premnaspirodiene oxygenase-like         137   5e-34   
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               137   5e-34   
ref|XP_010243385.1|  PREDICTED: cytochrome P450 71A1-like               137   5e-34   
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             137   5e-34   
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like               137   5e-34   
gb|ERN17838.1|  hypothetical protein AMTR_s00047p00189560               137   5e-34   
gb|KCW83844.1|  hypothetical protein EUGRSUZ_B00712                     137   6e-34   
gb|KHM99473.1|  Cytochrome P450 71D11                                   137   6e-34   
gb|KJB23394.1|  hypothetical protein B456_004G095700                    137   6e-34   
ref|XP_008372133.1|  PREDICTED: premnaspirodiene oxygenase-like         135   6e-34   
ref|XP_011470494.1|  PREDICTED: cytochrome P450 71A24-like              134   6e-34   
ref|XP_002523238.1|  cytochrome P450, putative                          137   6e-34   
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             137   6e-34   
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              137   7e-34   
ref|XP_002312665.2|  hypothetical protein POPTR_0008s18870g             137   7e-34   
gb|ABC69405.1|  CYP71D51v3                                              137   7e-34   
gb|KGN58496.1|  hypothetical protein Csa_3G651800                       134   7e-34   
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    137   7e-34   
emb|CDP22135.1|  unnamed protein product                                134   7e-34   
ref|XP_002300725.2|  hypothetical protein POPTR_0002s02730g             137   7e-34   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             137   7e-34   
gb|ABK94709.1|  unknown                                                 137   7e-34   
gb|KHM99474.1|  Cytochrome P450 71D11                                   137   7e-34   
gb|AIU56749.1|  cytochrome P450 CYP71B63v2                              137   7e-34   
gb|ABC69403.1|  CYP71D51v1                                              137   7e-34   
gb|EYU22202.1|  hypothetical protein MIMGU_mgv1a005074mg                137   7e-34   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         137   7e-34   



>ref|XP_011078642.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDLH +A+ HGPIM++RFG V N+IVSS +AAE FLKTHDL+FA+RPPHQAAKY+S+
Sbjct  51   NPHQDLHRIAQKHGPIMYMRFGLVPNVIVSSPKAAELFLKTHDLIFASRPPHQAAKYLSW  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +Q+NLSFG YGPYWRNMRKLCTLELLSN KI+ FQ+MRREE+ + +ESLKQA+R+G  VD
Sbjct  111  DQRNLSFGAYGPYWRNMRKLCTLELLSNLKISCFQTMRREELGIFIESLKQAARDGIPVD  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+S++AEMSCRMVFGKKYEDKDI ++GFK VI E M LAA+PN
Sbjct  171  LSAKVSSLTAEMSCRMVFGKKYEDKDIDERGFKTVIQEGMKLAAVPN  217



>gb|AJD25256.1| cytochrome P450 CYP736A121 [Salvia miltiorrhiza]
Length=496

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDLH +AK HGPIM+++FGFV NI+VSS EAAE FLKTHDLVFA+RPPHQAAKY+S+
Sbjct  49   NPHQDLHRIAKDHGPIMYMQFGFVPNIVVSSPEAAELFLKTHDLVFASRPPHQAAKYISW  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +Q+NLSFG YGPYWRNMRKLCTLELLS  KINSFQ MRREE+ L VESLK A+    AVD
Sbjct  109  DQRNLSFGAYGPYWRNMRKLCTLELLSTLKINSFQPMRREELRLFVESLKGAAGERVAVD  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KVAS++AEMSCRMVFGKKY+D+DI ++GFK VI E M LAA+PN
Sbjct  169  LSDKVASLTAEMSCRMVFGKKYDDQDIDERGFKKVIQEGMKLAAVPN  215



>gb|EYU24031.1| hypothetical protein MIMGU_mgv1a004909mg [Erythranthe guttata]
Length=505

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL+ +AK HGPI+ +RFG+V +I+VSS ++AE FLKTHDLVFA+RPPHQAA+ MS+
Sbjct  52   NPHQDLYTIAKEHGPIVFMRFGWVPHIVVSSNKSAELFLKTHDLVFASRPPHQAAEIMSW  111

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNLSFG+YGPYWR+MRKLCTLELLS  KINSFQ MR+EE+ L VESLK + R   AVD
Sbjct  112  GQKNLSFGKYGPYWRSMRKLCTLELLSTLKINSFQPMRKEELGLFVESLKLSCRGKAAVD  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK++S++AEMSCRMVFGKKYEDKD+G +GFK+VI E M LAALPN
Sbjct  172  LSAKISSLTAEMSCRMVFGKKYEDKDMGGRGFKSVIEEGMKLAALPN  218



>ref|XP_007159748.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31742.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=389

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+LA  +GP+M+LR GFV  ++VSS +AAE FLKTHDLVFA+RPPH+AAKY+S+
Sbjct  45   NPHRDLHQLALKYGPVMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASRPPHEAAKYISW  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +Q+NLSF EYG YWRNMRK+CTLELLS  KINSF+SMR EE+ LLV+ L++A+  G AVD
Sbjct  105  DQRNLSFAEYGSYWRNMRKMCTLELLSQSKINSFRSMRTEELDLLVKVLREAADVGAAVD  164

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+++SA+M+CRMV GKKY D+D+ +KGFKAV+ E M L+A PN
Sbjct  165  LSAKVSTVSADMACRMVLGKKYMDRDLDEKGFKAVMQEGMHLSATPN  211



>ref|XP_003524281.2| PREDICTED: cytochrome P450 71A1-like isoform X1 [Glycine max]
 ref|XP_006580303.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Glycine max]
 ref|XP_006580304.1| PREDICTED: cytochrome P450 71A1-like isoform X3 [Glycine max]
Length=497

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+LA+ +GP+MHLR GFV  I+VSS +AAE FLKTHDLVFA+RPP +AAKY+S+
Sbjct  46   NPHRDLHQLAQKYGPVMHLRLGFVPTIVVSSPQAAELFLKTHDLVFASRPPLEAAKYISW  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NLSF EYG YWRN+RK+CTLELLS+ KINSF+SMR EE+ L+V+ L++A+++G  VD
Sbjct  106  EQRNLSFAEYGSYWRNVRKMCTLELLSHTKINSFRSMREEELDLMVKLLREAAKDGAVVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+++SA+MSCRMV GKKY D+D+ +KGFKAV+ E M LAA PN
Sbjct  166  LSAKVSTLSADMSCRMVLGKKYMDRDLDEKGFKAVMQEGMHLAATPN  212



>ref|XP_003532846.1| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=500

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLHELA+ +GP+M+LR GFV  IIVSS +AAE FLKTHDLVFA RPPH+AAKYM++
Sbjct  47   NPHRDLHELAQKYGPVMYLRLGFVPAIIVSSPQAAELFLKTHDLVFAGRPPHEAAKYMAW  106

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL+FGEYG YWRN+RK+CTLELLS  KINSF+ MR EE+ LL+++L+ AS +G  VD
Sbjct  107  EQKNLAFGEYGSYWRNVRKMCTLELLSQTKINSFRPMREEELDLLIKNLRGASNDGAVVD  166

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKVA++SA+MSCRM+ GKKY D+D+  KGFKAV+ E + LAA PN
Sbjct  167  LSAKVATLSADMSCRMILGKKYMDQDLDQKGFKAVMQEVLHLAAAPN  213



>ref|XP_007159749.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31743.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=483

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+LA  +GP+M+LR GFV  ++VSS +AAE FLKTHDLVFA+RPPH+AAKY+S+
Sbjct  45   NPHRDLHQLALKYGPVMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASRPPHEAAKYISW  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +Q+NLSF EYG YWRNMRK+CTLELLS  KINSF+SMR EE+ LLV+ L++A+  G AVD
Sbjct  105  DQRNLSFAEYGSYWRNMRKMCTLELLSQSKINSFRSMRTEELDLLVKVLREAADVGAAVD  164

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+++SA+M+CRMV GKKY D+D+ +KGFKAV+ E M L+A PN
Sbjct  165  LSAKVSTVSADMACRMVLGKKYMDRDLDEKGFKAVMQEGMHLSATPN  211



>emb|CDP12933.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LAK HGPIMH+RFG+V  IIVSS EAAE+FLKT+D VFA+RP H+++ Y+SY
Sbjct  50   NPHQDLEKLAKKHGPIMHMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHESSWYVSY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL+FG+YGPYWRNMRKLC L+LLS+HKINSF  MRREEV  LV+SLKQA+ +G AVD
Sbjct  110  EQRNLTFGQYGPYWRNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQAASDGAAVD  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSA ++S+ A MSC M+FGKKY DKD  D+GF+ VI E + +AA+PN
Sbjct  170  LSASISSLGANMSCLMIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPN  216



>ref|XP_010041191.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Eucalyptus 
grandis]
Length=400

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DLH+LAK +GP+M+LR GFV  I++SS E AEQFLKTHDL+FA+RPPH+AAK++SY
Sbjct  49   NPHHDLHKLAKKYGPLMYLRLGFVPTILISSPEVAEQFLKTHDLIFASRPPHEAAKHISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q++L+F  YGPYWRN+RK+CTLELLSN KI SF+SMRR+EV LLV  LK ASR+  A+D
Sbjct  109  EQRSLAFAPYGPYWRNIRKMCTLELLSNAKIYSFKSMRRDEVGLLVNFLKDASRDHMAID  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK++S+SA+MSC MVFGKKY D++  ++GFKAV+ E M L A PN
Sbjct  169  LSAKISSLSADMSCLMVFGKKYMDREFDERGFKAVVQEVMVLTATPN  215



>emb|CDP18035.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH D H+L+K HGPIMHLRFGFV NIIVSS  AAEQFLKT+DLVFA+RPPH+AAKY+S+
Sbjct  50   NPHHDFHKLSKQHGPIMHLRFGFVSNIIVSSPHAAEQFLKTYDLVFASRPPHEAAKYISF  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NLSFG+YGPYWRNMRKLCTL LLSN KINSFQSMR +E+ LL+ESLKQA+RN   VD
Sbjct  110  GQRNLSFGQYGPYWRNMRKLCTLNLLSNLKINSFQSMRMQELELLLESLKQAARNCDVVD  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SA+VA+++A MSC MV GKKY DK+  ++GFKAVI E M L+A PN
Sbjct  170  ISAEVAALNANMSCLMVLGKKYADKEFDERGFKAVIKEGMQLSATPN  216



>ref|XP_010027781.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54384.1| hypothetical protein EUGRSUZ_I00335 [Eucalyptus grandis]
Length=500

 Score =   247 bits (630),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DLH+LA+ +GP+M+LR GFV  I+VSS E AEQFLKTHDLVFA+RPPH+A+K++SY
Sbjct  50   NPHHDLHKLAQKYGPLMYLRLGFVHTIVVSSPELAEQFLKTHDLVFASRPPHEASKHISY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q++L+F  YGPYWRN+RK+CTLELLSN KINSF+SMRREEV LLV  LK A+ +  A+D
Sbjct  110  EQRSLAFAPYGPYWRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAID  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            L++K+ S+SA+MSCRMVFGKKY DK+  ++GFKAVI E M L A PN
Sbjct  170  LTSKIFSLSADMSCRMVFGKKYMDKEFDERGFKAVIQEGMVLGATPN  216



>ref|XP_010027875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54512.1| hypothetical protein EUGRSUZ_I00454 [Eucalyptus grandis]
Length=500

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NP+ DLH+LA+ +GP+M+LR GFV  I+VSS E AEQFLKTHDLVFA+RPPH+A+K++SY
Sbjct  50   NPNHDLHKLAQKYGPLMYLRLGFVHTIVVSSPEVAEQFLKTHDLVFASRPPHEASKHISY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q++L+F  YGPYWRN+RK+CTLELLSN KINSF+SMRREEV LLV  LK A+ +  A+D
Sbjct  110  EQRSLAFAPYGPYWRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAID  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS+K++S+SA+MSCRMVFGKKY DK+  ++GFKAVI E M L A PN
Sbjct  170  LSSKISSLSADMSCRMVFGKKYMDKEFDERGFKAVIQEFMVLGATPN  216



>ref|XP_004236729.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=501

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL+ LAK +GPIM+L+ GFVDNII SS   AEQFLKT+D  FA+RPPH+AAKY+SY
Sbjct  50   NPHQDLNNLAKKYGPIMYLKLGFVDNIIASSPHVAEQFLKTYDQNFASRPPHEAAKYISY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +QKNL+FG YGPYWRNMRKLCTLELLS  KINSFQSMRREE+ LL+E+LK+ S     VD
Sbjct  110  DQKNLTFGTYGPYWRNMRKLCTLELLSTLKINSFQSMRREELNLLIETLKKKSHEKIVVD  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS  V  +S ++SCRM+FGKKY+D++ G KGFK+V++E + LAA PN
Sbjct  170  LSEIVTRLSVDISCRMIFGKKYKDEEFGCKGFKSVVNEGLQLAAAPN  216



>emb|CDP01384.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DL +LAK HGP+M+LRFG+V  IIVSS EAAE+FLKT+D VFA+RP H+A+ Y+SY
Sbjct  50   NPHHDLAKLAKKHGPLMYLRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHEASWYVSY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL+FG+YGPYWRNMRKLC L+LLS+HKINSF  MRREEV  LV+SLKQA+ +G AVD
Sbjct  110  EQRNLTFGQYGPYWRNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQAASDGAAVD  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSA ++S+ A MSC M+FGKKY DKD  D+GF+ VI E + +AA+PN
Sbjct  170  LSAAISSLGANMSCLMIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPN  216



>ref|XP_010030392.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54382.1| hypothetical protein EUGRSUZ_I00333 [Eucalyptus grandis]
Length=499

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DLH+LAK +GP+M+LR GFV  I+VSS E AEQFLKTHDL+FA+RPPH+AAK++SY
Sbjct  49   NPHHDLHKLAKKYGPLMYLRLGFVPTILVSSPEVAEQFLKTHDLIFASRPPHEAAKHISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q++L+F  YGPYWRN+RK+CTLELLSN KI SF+SMRR+EV LLV  LK AS +  A+D
Sbjct  109  EQRSLAFAPYGPYWRNIRKMCTLELLSNAKIYSFRSMRRDEVSLLVNFLKDASHDHMAID  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK++S+SA+MSC MVFGKKY D++  ++GFKAV+ E M L A PN
Sbjct  169  LSAKISSLSADMSCLMVFGKKYMDREFDERGFKAVVQEVMVLTATPN  215



>ref|XP_002532045.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF30335.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++LH LA+ +GPIMHLR G V  I+VSS +AAE FLKTHDL FA+RPPHQAAK++SY 
Sbjct  59   PHRELHRLAQKYGPIMHLRLGLVSTIVVSSPQAAESFLKTHDLAFASRPPHQAAKFISYE  118

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNLSF  YG YWRN+RK+CTLELLSN K+NSF+SMR+EE+ LL++ +K AS    AVDL
Sbjct  119  QKNLSFAPYGSYWRNVRKMCTLELLSNVKVNSFKSMRKEELDLLIDCIKNASCQRVAVDL  178

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKVAS+SA+MSCRMVFGKKY DK+  ++GFKAVI E M L A PN
Sbjct  179  SAKVASLSADMSCRMVFGKKYMDKEFDERGFKAVIQEGMHLGAAPN  224



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM++R GFV  I+VSS +AAEQFLKTHDLVFA RPPH+ +++M Y+
Sbjct  47   PHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLYD  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K +SF  YGPYWR+MRKLCTLELL++ KINSF+ MRREEV LL++S ++A+R G AVD+
Sbjct  107  GKGISFSGYGPYWRSMRKLCTLELLTSRKINSFKPMRREEVGLLIKSFEEAARAGAAVDV  166

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKVA +SA+MSCRMVFGKKY DKD+ ++GFKAVI EAM LAA PN
Sbjct  167  SAKVALLSADMSCRMVFGKKYMDKDLDERGFKAVIQEAMQLAATPN  212



>gb|ACM89788.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89833.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM++R GFV  I+VSS +AAEQFLKTHDLVFA RPPH+ +++M Y+
Sbjct  48   PHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLYD  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K +SF  YGPYWR+MRKLC LELLS+HKINSF+ MRREEV LL++S ++A+R G AVD+
Sbjct  108  GKGISFSGYGPYWRSMRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEAARAGAAVDV  167

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKVA +SA+MSCRMVFGKKY DKD+ ++GFKAVI E M LAA PN
Sbjct  168  SAKVALLSADMSCRMVFGKKYMDKDLDERGFKAVIKEVMQLAATPN  213



>emb|CDP01387.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LAK HGP+M++RFG+V  IIVSS EAAE+FLKT+D VFA+RP H+++ ++SY
Sbjct  50   NPHQDLAKLAKKHGPLMYMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHESSWHVSY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NLSF +YGPYWRNMRKLC L+LLS+HKINSF  MRREEV  LV+SLKQA+ +G AVD
Sbjct  110  EQRNLSFAQYGPYWRNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQAASDGAAVD  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSA ++S+ A MSC M+FGKKY DKD  D+GF+ VI EA+ L A PN
Sbjct  170  LSAAISSLGANMSCLMIFGKKYMDKDFDDRGFRDVIQEALRLGATPN  216



>ref|XP_012075327.1| PREDICTED: cytochrome P450 CYP736A12-like [Jatropha curcas]
 gb|KDP35215.1| hypothetical protein JCGZ_09374 [Jatropha curcas]
Length=499

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH+LA+ +GPI HLR G V  I+VSS  AAE FLKT+D+VFA+RPPH++AKY+SY 
Sbjct  53   PHRALHQLAQKYGPITHLRLGLVTTIVVSSPNAAESFLKTNDIVFASRPPHESAKYISYQ  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNLSF  YGPYWRN+RK+CTLELLSNHKINSF+ +R+EE+ LL++ +K+AS    AVDL
Sbjct  113  QKNLSFASYGPYWRNVRKMCTLELLSNHKINSFKFIRKEELDLLIKYIKEASFQREAVDL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKVAS+SA+MSCRMVFGKKY D +   +GFK VI E M LAA PN
Sbjct  173  SAKVASLSADMSCRMVFGKKYMDDEFDARGFKVVIQEGMKLAAAPN  218



>ref|XP_004504031.1| PREDICTED: cytochrome P450 750A1-like [Cicer arietinum]
Length=502

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DLH+L+K +GPIMHLR G V  I+VSS +AAE FLKTHDLVFA+RPP +AAK++S+
Sbjct  50   NPHIDLHKLSKKYGPIMHLRLGLVPTIVVSSPQAAELFLKTHDLVFASRPPTEAAKHISW  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNG-GAV  558
             Q+N+SFGEYG YWRNMRK+CTLELLS+ KINSF+SMR EE+ +L+  +++ + +G   V
Sbjct  110  EQRNMSFGEYGSYWRNMRKMCTLELLSHTKINSFRSMREEELDILINFIREVANDGTTTV  169

Query  559  DLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            D+SAKV+++SA+MSCRMVFGKKY DKD+ +KGFK+VI E M LAA PN
Sbjct  170  DISAKVSTLSADMSCRMVFGKKYMDKDLDEKGFKSVIQEGMHLAATPN  217



>gb|ACM89789.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89832.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM++R GFV  I+VSS +AAEQFLKTHDLVFA RPPH+ +++M ++
Sbjct  48   PHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLHD  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K +SF  YGPYWR+MRKLC LELLS+HKINSF+ MRREEV LL++S ++A+R G AVD+
Sbjct  108  GKGISFSGYGPYWRSMRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEAARAGAAVDV  167

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKVA +SA+MSCRMVFGKKY DKD+ ++GFKAVI E M LAA PN
Sbjct  168  SAKVALLSADMSCRMVFGKKYMDKDLDERGFKAVIKEVMQLAATPN  213



>ref|XP_003630098.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04574.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=477

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+L++ +GPIMHLR G +  I+VSS +AAE FLKTHDLVFA+RPPH AAK +S+
Sbjct  47   NPHRDLHQLSQKYGPIMHLRLGLIPTIVVSSPQAAELFLKTHDLVFASRPPHLAAKIISW  106

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +Q+NLSFGEYG YWRNMRK+CTLELLS+ KINSF++MR +E+ LL+  LK  + +G  VD
Sbjct  107  DQRNLSFGEYGSYWRNMRKMCTLELLSHAKINSFKTMREQELDLLIMFLK--ANDGTKVD  164

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV++++A+MSCRMV GKKY DKD+ +KGFKAV+ E M LAA PN
Sbjct  165  LSAKVSTLAADMSCRMVLGKKYIDKDLDEKGFKAVMQEGMHLAATPN  211



>ref|XP_002280620.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=498

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQDL  LAK +GPIM++RF  V  I+VSS +AAEQFLKT+DLVFA RPPH+ ++ +SY+
Sbjct  51   PHQDLLRLAKKYGPIMYMRFALVPTIVVSSPQAAEQFLKTNDLVFAGRPPHEGSRIVSYD  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            +K +SF +YGPYWRNMRKLCTL LLSN +I+SFQ +RREE+ LL++SLK+A+    AVDL
Sbjct  111  RKGISFTDYGPYWRNMRKLCTLGLLSNLRISSFQPLRREELDLLIKSLKEAALARTAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAK++S+SA+MSCRM+FGKKY DKDI ++GFKAVI E M LA  PN
Sbjct  171  SAKISSLSADMSCRMIFGKKYMDKDIDERGFKAVIQEGMQLAGAPN  216



>ref|XP_007213194.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
 gb|EMJ14393.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
Length=494

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH LA+ +G IMH+R G V  I+VSS +AAE FLKTHDLVFATRPPH+ AK++S+ 
Sbjct  47   PHRDLHRLAQKYGDIMHMRLGLVPTIVVSSPQAAELFLKTHDLVFATRPPHEGAKHLSFG  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            Q+NLSF EYG YWR++RK+CTLELLSNHKINSF+SMR+EEV L +ES+++A+ NG  A+D
Sbjct  107  QRNLSFVEYGSYWRDIRKMCTLELLSNHKINSFKSMRKEEVALFIESIQEAANNGHVAID  166

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS +V+S+S +MSCRMV GKKY D+++ ++GFK++I E M LAA PN
Sbjct  167  LSDRVSSLSVDMSCRMVLGKKYRDEELDERGFKSLIKEGMQLAAAPN  213



>emb|CBI21489.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQDL  LAK +GPIM++RF  V  I+VSS +AAEQFLKT+DLVFA RPPH+ ++ +SY+
Sbjct  79   PHQDLLRLAKKYGPIMYMRFALVPTIVVSSPQAAEQFLKTNDLVFAGRPPHEGSRIVSYD  138

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            +K +SF +YGPYWRNMRKLCTL LLSN +I+SFQ +RREE+ LL++SLK+A+    AVDL
Sbjct  139  RKGISFTDYGPYWRNMRKLCTLGLLSNLRISSFQPLRREELDLLIKSLKEAALARTAVDL  198

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAK++S+SA+MSCRM+FGKKY DKDI ++GFKAVI E M LA  PN
Sbjct  199  SAKISSLSADMSCRMIFGKKYMDKDIDERGFKAVIQEGMQLAGAPN  244



>ref|XP_010027782.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54386.1| hypothetical protein EUGRSUZ_I00339 [Eucalyptus grandis]
Length=498

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DLH+LA+ +GP+MHLR GFV  I+VSS E AEQFLKTHD+VFA RPPH+A+K++SY
Sbjct  50   NPHHDLHKLAQKYGPLMHLRLGFVHTIVVSSPEVAEQFLKTHDIVFAGRPPHEASKHISY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q++L+F  YGPYWRN+RK+CTLELLSN KINSF+SMRREEV LLV  LK A+ +  A+D
Sbjct  110  EQRSLAFSSYGPYWRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAID  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK++S+SA+MSCRM+FGKKY DK+  +  F AV+ E + L A PN
Sbjct  170  LSAKISSLSADMSCRMIFGKKYMDKEFDE--FMAVMQEGVVLGATPN  214



>ref|XP_007159747.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
 gb|ESW31741.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
Length=497

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH++LH+LA  +GP+M LR GF+  ++VSS +AAE FLKTHDLVFA+RP +QA KY+S+
Sbjct  45   NPHRNLHQLALKYGPVMFLRLGFMPTVVVSSPQAAELFLKTHDLVFASRPRYQAEKYVSW  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL+F EYG YWRNMRKLCTLELLS  KINSF+SMR EE+ LL++ L++A+  G  VD
Sbjct  105  GQRNLAFAEYGSYWRNMRKLCTLELLSQTKINSFRSMREEELDLLIKLLREAANAGATVD  164

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK++++SA+MSCRMV GKKY D+D+ +KGFKAV+ EAM L A PN
Sbjct  165  LSAKLSTLSADMSCRMVLGKKYMDQDLDEKGFKAVMQEAMRLLATPN  211



>ref|XP_002310007.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90457.2| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQDLH+LA  +GPIM++R G V  ++VSS  AAE  LKTHDLVFA RPP++AAK++SY 
Sbjct  51   PHQDLHQLANKYGPIMYMRLGLVPTVVVSSPRAAELILKTHDLVFANRPPNEAAKHISYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF  YG YWRN+RK+CTLELLSNHKINSF S R+EE+ LL++ +K ASR   AVDL
Sbjct  111  QKSLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSSRKEELDLLIDYIKDASRERVAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            SAKV+S+SA++SCRMVFGKKY +K+  DKGFK VIHE M LAA
Sbjct  171  SAKVSSLSADISCRMVFGKKYMEKEFDDKGFKPVIHEGMRLAA  213



>ref|XP_003596030.1| Cytochrome P450 [Medicago truncatula]
 gb|AES66281.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DLH+L++ +GPIMHLR G V  I+VSS +AAE FLKTHD+VFA+RPP +AA+ M Y
Sbjct  26   NPHLDLHKLSQKYGPIMHLRLGLVPTIVVSSPQAAELFLKTHDIVFASRPPIEAAQLMFY  85

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQK++SF  YG YWRNMRK+CTLELLS+ KINSF+SMR +E+ LL++ +++A+ +G  VD
Sbjct  86   NQKDVSFSVYGSYWRNMRKMCTLELLSHTKINSFRSMREQELDLLIKFIREAANDGTTVD  145

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAKVA+++A+M+C +VFGKKY DKD+ +KGFKA + E MSLAA PN
Sbjct  146  ISAKVAALTADMTCIIVFGKKYSDKDLNEKGFKASMQELMSLAATPN  192



>ref|XP_011025622.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Populus euphratica]
Length=493

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH+LA+ +GPIMHLR G V  I+VSS EAAE FLKTHDLVFA RPPH+AA+Y+SY 
Sbjct  47   PHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHEAARYISYG  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK ++F +YGPYWRNMRK+CT+ELLS+ KI SF+S R EE+ LL++  ++ASR   AVDL
Sbjct  107  QKGMTFAQYGPYWRNMRKMCTIELLSSLKITSFKSTRMEELDLLIKYTQEASRERVAVDL  166

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV+S++A+MSCRMVFGKKY D+D+ ++GFK+V+ E M L+A P+
Sbjct  167  SAKVSSLNADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPH  212



>ref|XP_011013422.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=493

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH+LA+ +GPIMHLR G V  I+VSS EAAE FLKTHDLVFA RPPH+AA+Y SY 
Sbjct  47   PHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHEAARYFSYG  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK ++F +YGPYWRNMRK+CT+ELLS+ KI SF+S R EE+ LL++ +++A+R   AVDL
Sbjct  107  QKGMTFAQYGPYWRNMRKMCTIELLSSLKITSFKSTRMEELDLLIKYIQEAARERVAVDL  166

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV+S++A+MSCRMVFGKKY D+D+ ++GFK+V+ E M L+A P+
Sbjct  167  SAKVSSLNADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPH  212



>ref|XP_003531375.1| PREDICTED: cytochrome P450 750A1-like isoform X1 [Glycine max]
Length=498

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+ LH+LA+ +GPIMHLR GFV  I++SS +AAE FLKTHDLVFA+RPPH+A KY+++
Sbjct  45   NPHRGLHQLAQKYGPIMHLRLGFVPTIVISSPQAAELFLKTHDLVFASRPPHEAIKYIAW  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNG-GAV  558
             Q+NL F EYG YWRNMRK+CTLELLS  KINSF+ +R EE+ L ++ L++AS +G  AV
Sbjct  105  EQRNLGFAEYGSYWRNMRKMCTLELLSQTKINSFRIVREEELDLSIKLLREASNDGAAAV  164

Query  559  DLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            D+SAKVA +SA+++CRMV GKKY D+D+ +KGFKAV+ E M L A PN
Sbjct  165  DISAKVARISADVACRMVLGKKYMDQDLDEKGFKAVVQEVMHLLATPN  212



>ref|XP_003531374.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=493

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+LA+ +GP+MHLR GFV  I+VSS ++AE FLKTHDLVFA+RP   A +Y+S+
Sbjct  45   NPHRDLHKLAQKYGPVMHLRLGFVPTIVVSSPKSAELFLKTHDLVFASRPRFVADQYISW  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F EYG YWRNMRK+CTLELLS  KINSF+ MR EE+ LL++ +++A+ +G AVD
Sbjct  105  GQRNLGFAEYGSYWRNMRKMCTLELLSQSKINSFRRMREEELDLLIKLVREAANDGAAVD  164

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KVA++ A+MSCRM+ GKKY D+D+  +GFKAVI EAM L A PN
Sbjct  165  LSVKVATLIADMSCRMILGKKYMDQDMCGRGFKAVIQEAMRLLATPN  211



>gb|KHN29102.1| Cytochrome P450 71A1 [Glycine soja]
Length=493

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+LA+ +GP+MHLR GFV  I+VSS ++AE FLKTHDLVFA+RP   A +Y+S+
Sbjct  45   NPHRDLHKLAQKYGPVMHLRLGFVPTIVVSSPKSAELFLKTHDLVFASRPRFVADQYISW  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F EYG YWRNMRK+CTLELLS  KINSF+ MR EE+ LL++ +++A+ +G AVD
Sbjct  105  GQRNLGFAEYGSYWRNMRKMCTLELLSQSKINSFRRMREEELDLLIKLVREAANDGAAVD  164

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KVA++ A+MSCRM+ GKKY D+D+  +GFKAVI EAM L A PN
Sbjct  165  LSVKVATLIADMSCRMILGKKYMDQDMCGRGFKAVIQEAMRLLATPN  211



>ref|XP_010099912.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB80841.1| Cytochrome P450 71A1 [Morus notabilis]
Length=500

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DL +LAK +GPIMH+R G +  +IVSS EAAE FLKTHDLVFATRPPH+AAK++S+ 
Sbjct  52   PHHDLQKLAKQYGPIMHMRLGLIPTVIVSSPEAAELFLKTHDLVFATRPPHEAAKHISWE  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NLSF  YG YWR++RK+CTLELLS+HKI++F  MR+EE+ L ++S+++A+ +  AVDL
Sbjct  112  QRNLSFAPYGSYWRDIRKMCTLELLSSHKISTFSEMRKEEIGLSIKSIREAALDHVAVDL  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SA++  ++A+M+CRMVFGKKY D++  ++GFKAV+ E M LAA PN
Sbjct  172  SARITCLNADMTCRMVFGKKYSDEEFDERGFKAVVQEGMHLAATPN  217



>ref|XP_008246192.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Prunus mume]
Length=294

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH LA+ HG IM+LR G    ++ SS +AAE FLKTHDLVFA+RPP QAA+++SY 
Sbjct  51   PHRDLHRLAQKHGDIMYLRLGLAPVVVASSPQAAELFLKTHDLVFASRPPLQAAEHISYG  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NLSFG YG YWR MRK+CTLELLS+HKINSF+ MR+EE+ +L + +++A+ +   VDL
Sbjct  111  QRNLSFGAYGSYWRTMRKMCTLELLSSHKINSFKPMRKEELSILTKFIQEAACDRVTVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S KVAS++A+MSC MVFGKKY DK+  ++GFKAVI E M LAA PN
Sbjct  171  SGKVASLTADMSCLMVFGKKYMDKEFDERGFKAVIQEGMHLAATPN  216



>ref|XP_011025649.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=315

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DLH+LAK +GPIM++R G V  ++VSS +AAE  LKT+DLVFA RPP++AAK++SY 
Sbjct  51   PHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPQAAELILKTNDLVFANRPPNEAAKHISYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF  YG YWRN+RK+CTLELLSNHKINSF S R+EE+ LL++ +K ASR   AVD+
Sbjct  111  QKSLSFAPYGTYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDI  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
             +KV+S+SA++SCRMVFGKKY +++  +KGFK VIHE M LAA
Sbjct  171  GSKVSSLSADISCRMVFGKKYLEREFDEKGFKPVIHEGMRLAA  213



>gb|AFK79031.1| cytochrome P450 CYP736A54 [Bupleurum chinense]
Length=497

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA+ HGPIM +RFGFV NIIVSS EAA+QFLKTHDL FA RP  +AAKY+SY
Sbjct  49   NPHQDLQKLAEKHGPIMSMRFGFVPNIIVSSPEAAKQFLKTHDLNFAGRPSLEAAKYISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NLSF  YGPYWRNMRKLCTLELLSN KINSFQ+MR++E+  +V+ ++QA++   AVD
Sbjct  109  EQRNLSFSTYGPYWRNMRKLCTLELLSNLKINSFQAMRKKEIANVVDIIEQAAQERVAVD  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            +S +++SM++++SC+MVFGKK+EDK+  ++GFK VI   M +A 
Sbjct  169  ISQRISSMNSDISCQMVFGKKFEDKEFDERGFKGVIQVGMQMAV  212



>ref|XP_002310015.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90465.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQDLH+LAK +GPIM++R G V  ++VSS  AAE  LKT+DLVFA RPP++AAK+++Y 
Sbjct  51   PHQDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFANRPPNEAAKHITYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNLSF  YG YWRN+RK+CTLELLSNHKINSF S R+EE+ LL++ +K ASR   AVDL
Sbjct  111  QKNLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            SAKV+S+SA++SCRMVFGKKY +K+  +KGFK + HEAM L A
Sbjct  171  SAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPLTHEAMRLTA  213



>ref|XP_006354724.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=385

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA  HGPIM++R G V  II SSA+AAE+ LKT+D +FATRP H+A++Y+SY
Sbjct  97   NPHQDLQKLANKHGPIMYVRLGLVPTIIASSADAAEKVLKTYDHIFATRPHHEASQYLSY  156

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL F +YG YWRNMRKLCT+ LLSN+KINSFQS+R++EV LL+ESLK+ + +   VD
Sbjct  157  GQKNLIFAKYGVYWRNMRKLCTVHLLSNNKINSFQSIRKQEVELLIESLKKEAHDRVVVD  216

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+ S+SA ++C MVFGKKY D+D+  +GFK+V+ + + LAA PN
Sbjct  217  LSAKITSLSANLTCLMVFGKKYMDEDLDKRGFKSVVQDVVHLAATPN  263



>ref|XP_004143494.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=501

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH L++ +GPIMH++ G V+ IIVSS  AAE FLKTHDL+FA+RP    +K++SY 
Sbjct  54   PHRDLHRLSQKYGPIMHIKLGLVNTIIVSSPPAAELFLKTHDLIFASRPLTMVSKFLSYG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNL F +YG YWRN+RK+CTLELLSNHKINSF+SMR+EEV LL+E LK+A+ +G +V++
Sbjct  114  QKNLVFAQYGSYWRNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEAANDGVSVNI  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S+KV S+S +M+C MVFG+K+ D+++ D+GFKA+I E M L A PN
Sbjct  174  SSKVVSLSTDMTCLMVFGRKFGDEELDDRGFKAMIQEVMQLVAAPN  219



>ref|XP_006585306.1| PREDICTED: cytochrome P450 750A1-like isoform X2 [Glycine max]
Length=410

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+ LH+LA+ +GPIMHLR GFV  I++SS +AAE FLKTHDLVFA+RPPH+A KY+++
Sbjct  45   NPHRGLHQLAQKYGPIMHLRLGFVPTIVISSPQAAELFLKTHDLVFASRPPHEAIKYIAW  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNG-GAV  558
             Q+NL F EYG YWRNMRK+CTLELLS  KINSF+ +R EE+ L ++ L++AS +G  AV
Sbjct  105  EQRNLGFAEYGSYWRNMRKMCTLELLSQTKINSFRIVREEELDLSIKLLREASNDGAAAV  164

Query  559  DLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAAL  696
            D+SAKVA +SA+++CRMV GKKY D+D+ +KGFKAV+ E M L ++
Sbjct  165  DISAKVARISADVACRMVLGKKYMDQDLDEKGFKAVVQEDMLLGSM  210



>ref|XP_011100884.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=496

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL+ LA+ HGPIM LR GFV  ++VSS   AE  LKTHDLVFA+RPPH+AAKY+ Y
Sbjct  48   NPHQDLYHLARKHGPIMSLRLGFVPAVVVSSPAGAELVLKTHDLVFASRPPHEAAKYIGY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q++L F  YGPYWRNMRKLCTLELLSN +I+ F++MR+ E+ LLV SLKQAS  G  VD
Sbjct  108  EQRDLVFLPYGPYWRNMRKLCTLELLSNLRIDQFRAMRKAELSLLVSSLKQASELGEIVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            LSA+V+ +S +M C M+FG+KY D+D+ +KGFKAVI E +++AA
Sbjct  168  LSARVSGLSGDMICLMIFGRKYADRDLDEKGFKAVISETVAIAA  211



>ref|XP_002310011.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
 gb|EEE90461.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
Length=493

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+  H+LA+ +GPIMHLR G V  I+VSS EAAE FLKTHDLVFA RPPH++A+Y+SY 
Sbjct  47   PHRAFHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHESARYISYG  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+++F +YG YWRNMRK+CT+ELLS+ KI SF+S R EE+ LL++ +++A++   AVDL
Sbjct  107  QKSVTFSQYGSYWRNMRKMCTVELLSSLKITSFKSTRMEELDLLIKYIQEAAQERVAVDL  166

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV+S+SA+MSCRMVFGKKY D+D+ ++GFK+V+ E M L+A PN
Sbjct  167  SAKVSSLSADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPN  212



>ref|XP_002310005.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
 gb|EEE90455.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
Length=500

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH+LA+ +GPIMHLR G V  I+VSS EAAE FLKTHDLVFA RPPH+AA+Y+SY 
Sbjct  47   PHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHEAARYISYG  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK ++F +YG YWRNMRK+CT+ELLS+ KI SF+ MR EE+ LL++ +++A++   AVD+
Sbjct  107  QKGMAFAQYGSYWRNMRKMCTVELLSSLKITSFKPMRMEELDLLIKYIQEAAQERVAVDM  166

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV+S+SA+MSCRMVFGKKY D+D+ ++GFK+V+ E M L A P+
Sbjct  167  SAKVSSLSADMSCRMVFGKKYVDEDLDERGFKSVMQEVMHLTAAPH  212



>ref|XP_008227118.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = +1

Query  67   AWILaaiaviaavsffsGFLKNRSKRlppgpkglpilghlhligkNPHQDLHELAKTHGP  246
             WI A I ++A V     + KN+ KRLPPGP G PI G LHL+G+ PH+DLH LA+ +G 
Sbjct  2    VWIWATIGLLALVHILQAWWKNKKKRLPPGPTGFPIFGSLHLLGEFPHKDLHRLARKYGH  61

Query  247  IMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWR  426
            IM++R G +  I++SS EAAE FLKTHDLVFA+RPPH+++K++S+ QKNL F EYG YWR
Sbjct  62   IMYMRLGLMHTIVISSPEAAELFLKTHDLVFASRPPHESSKHISFGQKNLIFSEYGVYWR  121

Query  427  NMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVDLSAKVASMSAEMSC  603
            + RK+CT+ELLSNHKINSF+SMRREEV L VES++ A+ N G AVDLS KV+S+S +MSC
Sbjct  122  DTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNRGVAVDLSDKVSSLSVDMSC  181

Query  604  RMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            RMV GKKY+D++  ++GFK+V+ E + LA+ PN
Sbjct  182  RMVLGKKYKDEEFDERGFKSVVREGIQLASAPN  214



>ref|XP_007211842.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
 gb|EMJ13041.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
Length=497

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH LA+ +G IM++R G +  I++SS EAAE FLKTHDLVFA+RPPH+ +K++S+ 
Sbjct  48   PNKDLHRLARKYGDIMYMRLGLMSTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRN-GGAVD  561
            QKNLSF EYG YWR+ RK+CT+ELLSNHKINSF+SMRREEV L VES++ A+ N G AVD
Sbjct  108  QKNLSFSEYGVYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNIGVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV+S+S +MSCRMV GKKY D++  ++GFK+V+ E + LA+ PN
Sbjct  168  LSDKVSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVREGIQLASAPN  214



>emb|CDP12853.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +1

Query  250  MHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRN  429
            MHLRFGF+ NIIVSS  AAEQFLKT+DLVFA+RPPH+AAKY+ + Q++L+FG+YGPYWRN
Sbjct  1    MHLRFGFISNIIVSSPHAAEQFLKTYDLVFASRPPHEAAKYLMFGQRSLAFGKYGPYWRN  60

Query  430  MRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVASMSAEMSCRM  609
            MRKLCTL LLSN KI SFQS+R+EE+ L VESLKQA+ N   VD+ A+VA++SA M+C M
Sbjct  61   MRKLCTLNLLSNLKIGSFQSVRKEELGLFVESLKQAALNQDVVDIGAEVAALSANMTCLM  120

Query  610  VFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            VFGKKY DK+  ++GFKAVI EAM L A PN
Sbjct  121  VFGKKYADKEFDERGFKAVIKEAMQLMATPN  151



>ref|XP_008347028.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008356594.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH LA+ HG IM+LR G    II SS +AAE FLKTHDL FA+RPP +AAK++S+ 
Sbjct  50   PHRDLHRLAQKHGDIMYLRLGLAPVIIASSPQAAELFLKTHDLNFASRPPLEAAKHISWG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NLSFGEYG YWR MRK+CTLELLS HKINSF+S R+EE+ LL+  +++A+R+   V+L
Sbjct  110  QRNLSFGEYGSYWRTMRKMCTLELLSAHKINSFKSTRKEELALLINFIQEAARDRVTVNL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV+S+SA++SC MVFGKKY+DK++ +KGFKAV+ E M LAA PN
Sbjct  170  SAKVSSLSADISCLMVFGKKYKDKELDEKGFKAVVQEGMHLAATPN  215



>dbj|BAP15886.1| cytochrome P450 71AU50 [Prunus mume]
Length=497

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH LA+ +G IM++R G +  I++SS EAAE FLKTHDLVFA+RPPH+ +K++S+ 
Sbjct  48   PNKDLHRLARKYGDIMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            QKNL F EYG YWR+ RK+CT+ELLSNHKINSF+SMRREEV L VES++ A+ N G AVD
Sbjct  108  QKNLIFSEYGAYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNRGVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV+S+S +MSCRMV GKKY D++  ++GFK+V+ EA+ LA+ PN
Sbjct  168  LSDKVSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVREAIQLASAPN  214



>ref|XP_009782203.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=494

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA  HGPIM++R G V  I+ SSA+AAE+ LKT+D +FA+RP H+A++YM+Y
Sbjct  48   NPHQDLQKLANKHGPIMYMRLGLVPTIVASSADAAEKVLKTYDHIFASRPHHEASQYMAY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL F +YGPYWRNMRKLCT+ LLS+HKINSFQSMR+++V LL++SLK+ + +  AVD
Sbjct  108  GQKNLIFAKYGPYWRNMRKLCTVHLLSSHKINSFQSMRKQQVQLLIDSLKREAHDHVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+ S++A ++C MVFGKKY D D+  +GFKAV+ + + LAA PN
Sbjct  168  LSAKITSLNANLTCLMVFGKKYMDADLDKRGFKAVVQDVVHLAATPN  214



>ref|XP_002310008.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
 gb|EEE90458.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
Length=493

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH+LA+ +GPIMHLR G V  I+VSS EAAE FLKTHDLVFA RPPH++A+Y+SY 
Sbjct  47   PHRALHQLAQKYGPIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHESARYISYG  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK ++F +YG YWRN+RK+CT+ELLS+ KI SF+ MR EE+ LL++ +++A++   AVDL
Sbjct  107  QKGMAFAQYGSYWRNIRKMCTVELLSSLKITSFKPMRMEELDLLIKYIQEAAQERVAVDL  166

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV+S+SA+MSCRMVFGKKY D+D+ ++GFK+V+ E M L+A P+
Sbjct  167  SAKVSSLSADMSCRMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPH  212



>ref|XP_011025648.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=300

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DLH+LAK +GPIM++R   V  ++VSS  AAE  LKTHDLVFA+RPP++AAK+++Y 
Sbjct  51   PHHDLHQLAKKYGPIMYMRLSLVPTVVVSSPRAAELILKTHDLVFASRPPNEAAKHITYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK L+F  YG YWRN+RK+CTLELLSNHKINSF S R+EE+ LL++ +K ASR   AVD+
Sbjct  111  QKGLTFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDI  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
             +K++S+SA++SCRMVFGKKY +K+  + GFK V HE M LAA
Sbjct  171  GSKISSLSADISCRMVFGKKYLEKEFDEMGFKPVTHELMRLAA  213



>ref|XP_008227094.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH LA+ +G IM++R G +  I++SS EAAE FLKTHDLVFA+RPPH+ +K++S+ 
Sbjct  48   PNKDLHRLARKYGDIMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            QKNL F EYG YWR+ RK+CT+ELLSNHKINSF+SMRREEV L VES++ A+ N G AVD
Sbjct  108  QKNLIFSEYGAYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNRGVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV+S+S +MSCRMV GKKY D++  ++GFK+V+ E + LA+ PN
Sbjct  168  LSDKVSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVRELIQLASAPN  214



>ref|XP_006367702.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=542

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LAK HGPIM++R G V  I+VSSA+AAE+ L+ +D +FA+RP HQ ++Y+SY
Sbjct  92   NPHQDLQKLAKKHGPIMYVRLGLVPTIVVSSADAAEKVLRRYDHIFASRPHHQTSQYLSY  151

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL+F +YGPYW NMRKLCT+ LLSNHKI+SFQSMR++EV LL+ES+K  + +  AVD
Sbjct  152  GQKNLAFAKYGPYWHNMRKLCTVHLLSNHKIHSFQSMRKQEVELLIESIKMEAHHHVAVD  211

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+ S++A ++C MVFGKKY D+D   +GFK V+ +A+ LAA+PN
Sbjct  212  LSAKITSLNANLTCLMVFGKKYMDEDFDKRGFKTVVQDAVHLAAMPN  258



>gb|EYU24037.1| hypothetical protein MIMGU_mgv1a005167mg [Erythranthe guttata]
Length=494

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQ+LH LA+ HGPIM LR GFV  ++VSS  AAE  LKTHDLVFA+RP   AA+YMSY
Sbjct  46   NPHQNLHRLARKHGPIMGLRLGFVPAVVVSSPAAAELVLKTHDLVFASRPKSAAAEYMSY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKN+ FG YGPYWR+MRKLCTLELLS+ +I+ FQ++R  E+CLLV+SLKQA+  G  VD
Sbjct  106  QQKNIVFGPYGPYWRDMRKLCTLELLSSLRISQFQALRAAELCLLVDSLKQAAELGEIVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            LSA+V+ ++ +M+C M+FG+KY DKD  DKGFK V  EAM ++A
Sbjct  166  LSARVSGVNGDMNCLMIFGRKYADKDFDDKGFKDVFMEAMEISA  209



>ref|XP_004304846.1| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=499

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DLH L++ HG IM+LR G V  I+VSS +AAE FLKTHD  FATRPPH+AAK++SY 
Sbjct  51   PHVDLHRLSQKHGDIMYLRLGLVPTIVVSSPQAAELFLKTHDHSFATRPPHEAAKHISYG  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NLS+ EYGPYWR +RK+CTLELLSNHKINS + MR+EE+ L +  +++A R+  AVDL
Sbjct  111  QRNLSYAEYGPYWRTIRKMCTLELLSNHKINSLKPMRKEELDLFMNFIQEACRDRAAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV+S++ +M+CR+VFGKKY DK+  +KGF+A I E M LA  PN
Sbjct  171  SAKVSSLNTDMTCRLVFGKKYMDKEFDEKGFQAWIVEGMHLAGTPN  216



>ref|XP_009770873.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   226 bits (577),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK +GPIM +RFG V  I+ SS  AAEQFLK HDLVFA+RP ++  +YM Y
Sbjct  51   NLHQDLYKIAKKYGPIMTIRFGLVPVIVASSPHAAEQFLKNHDLVFASRPYNEVPQYMFY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             ++NL   +YGPYWRNMRKLCTL+LLSN KI+ FQ MR++E+ +LV  LKQA+  G  +D
Sbjct  111  ERRNLVSAKYGPYWRNMRKLCTLQLLSNAKIHQFQPMRKQELGILVNFLKQAASEGTVID  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKVAS+SA MSC M+FGKKY D+D+GDKGFKA+I + + +AALPN
Sbjct  171  LSAKVASLSANMSCLMIFGKKYMDEDLGDKGFKALIQDILHIAALPN  217



>ref|XP_008234579.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=498

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH LA+ HG IM+LR G    ++ SS +AAE FLKTHDLVFA+RPP QAA+++SY 
Sbjct  51   PHRDLHRLAQKHGDIMYLRLGLAPVVVASSPQAAELFLKTHDLVFASRPPLQAAEHISYG  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NLSFG YG YWR MRK+CTLELLS+HKINSF+ MR+EE+ +L + +++A+ +   VDL
Sbjct  111  QRNLSFGAYGSYWRTMRKMCTLELLSSHKINSFKPMRKEELSILTKFIQEAACDRVTVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S KVAS++A+MSC MVFGKKY DK+  ++GFKAVI E M LAA PN
Sbjct  171  SGKVASLTADMSCLMVFGKKYMDKEFDERGFKAVIQEGMHLAATPN  216



>gb|KHN38214.1| Cytochrome P450 71A1 [Glycine soja]
Length=436

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +1

Query  250  MHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRN  429
            MHLR GFV  I+VSS +AAE FLKTHDLVFA+RPP +AAKY+S+ Q+NLSF EYG YWRN
Sbjct  1    MHLRLGFVPTIVVSSPQAAELFLKTHDLVFASRPPLEAAKYISWEQRNLSFAEYGSYWRN  60

Query  430  MRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVASMSAEMSCRM  609
            +RK+CTLELLS+ KINSF+SMR EE+ L+V+ L++A+++G  VDLSAKV+++SA+MSCRM
Sbjct  61   VRKMCTLELLSHTKINSFRSMREEELDLMVKLLREAAKDGAVVDLSAKVSTLSADMSCRM  120

Query  610  VFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            V GKKY D+D+ +KGFKAV+ E M LAA PN
Sbjct  121  VLGKKYMDRDLDEKGFKAVMQEGMHLAATPN  151



>ref|XP_002310014.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90464.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   226 bits (575),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DLH+LAK +GPIM++R G V  ++VSS  AAE  LKT+DLVFA+RP ++AAK++SY 
Sbjct  51   PHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRNEAAKHISYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNLSF  YG YWRN+RK+CTLELLSNHKINSF S R+EE+ LL++ +K ASR   AVDL
Sbjct  111  QKNLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
             AKV+S+SA++SCRMVFGKKY +K+  +KGFK V HE M LAA
Sbjct  171  GAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPVTHELMRLAA  213



>ref|XP_008364815.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=499

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH+L++ +G IM+LR G V  ++VSS  AAE FLKTHDLVFA+RPPH+ +K++S+ 
Sbjct  52   PNRDLHQLSRKYGDIMYLRLGLVPTVVVSSPRAAELFLKTHDLVFASRPPHEGSKHISFG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            Q+NLSF EYG YWR++RK+CTLELLSNHKINSF+SMRREEV LL++S+++ +  G  A+D
Sbjct  112  QRNLSFAEYGSYWRDIRKMCTLELLSNHKINSFKSMRREEVALLIQSVEEDANXGRVAID  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV+S+S +M+CRMVFGKKY+D++  ++GF AV+ E + L+A PN
Sbjct  172  LSVKVSSLSVDMTCRMVFGKKYKDEEFDERGFTAVMKEGLKLSAGPN  218



>ref|XP_002310016.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
 gb|EEE90466.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
Length=497

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DLH+LAK +GPIM++R G V  ++VSS  AAE  LKT+DLVFA+RP ++AAK++SY 
Sbjct  51   PHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRNEAAKHISYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNLSF  YG YWRN+RK+CTLELLSNHKINSF S R+EE+ LL++ +K ASR   AVDL
Sbjct  111  QKNLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
             AKV+S+SA++SCRMVFGKKY +K+  +KGFK V HE M LAA
Sbjct  171  GAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPVTHELMRLAA  213



>ref|XP_007208656.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
 gb|EMJ09855.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
Length=498

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 132/166 (80%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH LA+ HG IM++R G    ++ SS +AAE FLKTHDLVFA+RPP QAA+++SY 
Sbjct  51   PHRDLHRLAQKHGDIMYMRLGLAPVVVASSPQAAELFLKTHDLVFASRPPLQAAEHISYG  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NLSFG YG YWR MRK+CTLELLS+HK NSF+ MR+EE+ LL + +++A+ +   VDL
Sbjct  111  QRNLSFGAYGSYWRTMRKMCTLELLSSHKTNSFKPMRKEELALLTKFIQEAASDRVTVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S KVAS++A+MSC MVFGKKY DK+  ++GFKAVI E M LAA PN
Sbjct  171  SGKVASLTADMSCLMVFGKKYMDKEFDERGFKAVIQEGMHLAATPN  216



>ref|XP_006354722.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=494

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA  HGPIM++R G V  II SSA+AAE+ LKT+D +FATRP H+A++Y+SY
Sbjct  48   NPHQDLQKLANKHGPIMYVRLGLVPTIIASSADAAEKVLKTYDHIFATRPHHEASQYLSY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL F +YG YWRNMRKLC + LLSN+KINSFQSMR++EV LL+ESLK+ + +  AVD
Sbjct  108  GQKNLIFAKYGVYWRNMRKLCVVHLLSNNKINSFQSMRKQEVELLIESLKKEAHDRVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+ S++A ++C MVFGKKY D+D+  +GFK+V+ + + LAA PN
Sbjct  168  LSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKSVVQDVVHLAATPN  214



>ref|XP_007214404.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
 gb|EMJ15603.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
Length=496

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH LA+ +G IM++R G +  I+VSS +AA+ FLKTHDLVFA+RPPH+ AK++S+ 
Sbjct  49   PNKDLHRLAQKYGDIMYMRLGLMPTIVVSSPQAAKLFLKTHDLVFASRPPHEGAKHISFG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            Q+NLSF EYGPYWR+MRK+CTLELLSNHKINSF+SMRREEV L VES++ A+  G  AVD
Sbjct  109  QRNLSFAEYGPYWRDMRKMCTLELLSNHKINSFKSMRREEVALCVESIRDAAYKGRVAVD  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS  V+S+S +MSCRMV GKKY D+D   +GF++VI E + LA   N
Sbjct  169  LSDIVSSLSVDMSCRMVLGKKYRDEDFDARGFRSVIKEGIQLAGASN  215



>ref|XP_008227122.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=496

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH LA+ +G +M++R G +  I+VSS +AA+ FLKTHDLVFA+RPPH+ AK++S+ 
Sbjct  49   PNKDLHRLAQKYGDVMYMRLGLMPTIVVSSPQAAKLFLKTHDLVFASRPPHEGAKHISFG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNG-GAVD  561
            Q+NLSF EYGPYWR+MRK+CTLELLSNHKINSF+SMRREEV L VES++ A+  G  AVD
Sbjct  109  QRNLSFAEYGPYWRDMRKMCTLELLSNHKINSFKSMRREEVALCVESIRDAAYKGHVAVD  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS  V+S+S +MSCRMV GKKY D+D   +GF++VI E + LA   N
Sbjct  169  LSDIVSSLSVDMSCRMVLGKKYRDEDFDTRGFRSVIKEGLQLAGASN  215



>ref|XP_007212357.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
 gb|EMJ13556.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
Length=497

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH LA+ +G IM++R G +  I++SS EAAE FLKTHDLVFA+RPPH+ +K++S+ 
Sbjct  48   PNKDLHRLARKYGDIMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQAS-RNGGAVD  561
            QKNL F EYG YWR+ RK+CT+ELLSNHKINSF+SMRREEV L VES++ A+ + G AVD
Sbjct  108  QKNLIFSEYGVYWRDTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANKRGVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV+S+S +MSCRMV GKKY D++  ++GFK+V+ E + LA+ PN
Sbjct  168  LSDKVSSLSVDMSCRMVLGKKYRDEEFDERGFKSVVREGIQLASAPN  214



>ref|XP_004143566.2| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=507

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH L++ +GPIMH++ G V+ I+VSS +AAE FLKTHDL+FA+RP    +K++SY 
Sbjct  59   PHRDLHRLSQKYGPIMHIKLGLVNTIVVSSPQAAELFLKTHDLIFASRPLTMVSKFLSYG  118

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNL F +YG YWRN+RK+CTLELLSNHKINSF+SMR+EEV LL+E LK+A+ +G ++++
Sbjct  119  QKNLVFAQYGSYWRNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEAASDGVSINI  178

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S+K AS+  +M+C MVFG+K+ D+++ D+GFKA++ E M L A PN
Sbjct  179  SSKAASLITDMTCLMVFGRKFGDEELDDRGFKAMMQEVMQLIAAPN  224



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DL +LA+ +GPIMHLRFG +  I+VSS EAAEQFLKT+DLVFA+RPPH+ +KY+ YN
Sbjct  51   PHRDLQQLAQKYGPIMHLRFGSMPVIVVSSPEAAEQFLKTYDLVFASRPPHEGSKYICYN  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+N+SF  YG YWRNMRK+CTLELLSN KINSF+SMR+EE+ L ++ +++A+    AVDL
Sbjct  111  QQNISFSPYGSYWRNMRKMCTLELLSNLKINSFRSMRKEELHLFIDCIQEAASARVAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            +A V+S+S  +SCRMV GKKY + D  +KGF+A+I E M + A
Sbjct  171  TATVSSLSTNISCRMVLGKKYNNDDFDEKGFEAIIREGMQIGA  213



>ref|XP_011090597.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=495

 Score =   224 bits (570),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQD H LA+ +GPIM+LRFGFV  I+VSS  AAE  LKTHDL+FA R  HQAAK +SY
Sbjct  48   NPHQDFHNLAQKYGPIMYLRFGFVPTIVVSSPAAAELVLKTHDLIFAGRAHHQAAKEISY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +++N+ F +YG YWRNMRKLCTLELLSN KIN FQ MRR E+ + VESL++A+     VD
Sbjct  108  DKRNIVFAQYGIYWRNMRKLCTLELLSNFKINQFQPMRRAEIEVFVESLQRAAGKRETVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SA++++M  +M+C MVFG+K+ D D+ +KGFKAVI E + +AALPN
Sbjct  168  ISARISAMIGDMTCLMVFGRKFADGDLDEKGFKAVIGETLQVAALPN  214



>gb|KGN48794.1| hypothetical protein Csa_6G501340 [Cucumis sativus]
Length=313

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+D H L++ +GPIMH++ G V  IIVSS +AAE FLKTHDLVFA+RP  +A+K M+Y 
Sbjct  50   PHRDFHILSQKYGPIMHIKLGLVPTIIVSSPKAAELFLKTHDLVFASRPLLEASKQMNYG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNL F  YGPYWRNMRK+CTLELLSN KINSF  MR+ E+ LL+E LK+A+ N   V+L
Sbjct  110  QKNLVFAPYGPYWRNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEAAHNKAVVNL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV S++ ++ C M FGKKY D++I ++GFKA I E   LAA PN
Sbjct  170  SAKVTSLTTDLICLMAFGKKYGDEEIDERGFKATIQEGSQLAATPN  215



>ref|XP_006380462.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
 gb|ERP58259.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
Length=497

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DLH+LAK +GPIM++R G V  ++VSS  AAE  LKT+DLVFA+RP ++AAK++SY 
Sbjct  51   PHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRNEAAKHISYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNLSF  YG YWRN+RK+CTLELLSNHKIN F S R+EE+ LL++ +K ASR+  AVDL
Sbjct  111  QKNLSFAPYGSYWRNVRKMCTLELLSNHKINFFMSTRKEELDLLIDYIKDASRDRVAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
             AKV+S+SA++SCRMVFGKKY +K+  +KGFK V HE M LAA
Sbjct  171  GAKVSSLSADISCRMVFGKKYLEKEFDEKGFKPVTHELMRLAA  213



>ref|XP_009372714.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH+L++ +G IM+LR G V  ++VSS  AAE FLKTHDLVFA+RPPH+ +K++S+ 
Sbjct  52   PNRDLHQLSRKYGDIMYLRLGLVPTVVVSSPRAAELFLKTHDLVFASRPPHEGSKHISFG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            Q+NLSF EYG YWR++RK+CTLELLSNHKINSF+SMRREEV LL++S+++ + NG  A+D
Sbjct  112  QRNLSFAEYGSYWRDIRKMCTLELLSNHKINSFKSMRREEVALLIQSVQEDANNGRVAID  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV+S+S +M+C+MVFGKKY+ ++  ++GF AV+ EA+ L+A PN
Sbjct  172  LSDKVSSLSVDMTCQMVFGKKYKYEEFDERGFTAVMKEALKLSAGPN  218



>ref|XP_009802012.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK HGPIM +RFG V  I+ SS  AAE FLK HDLVFA+RP + AA+Y+ Y
Sbjct  51   NLHQDLYQIAKKHGPIMSMRFGLVPIIVASSPHAAELFLKKHDLVFASRPYNTAAQYIGY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+NL+FG+YGPYWRNMRKLCTLELLS+ KINSFQ+MR++E+   V  L +A+ NG  VD
Sbjct  111  NQRNLTFGKYGPYWRNMRKLCTLELLSSLKINSFQAMRKQEIGNFVTFLNRAASNGIEVD  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAK+AS+SA M+C MVFGKKY D++  ++GFK VI E + + A PN
Sbjct  171  ISAKLASLSANMACLMVFGKKYMDEEFDERGFKDVIQETLVITATPN  217



>ref|XP_009615258.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA  HGPIM++R G V  I+ SSA+AAE+ LKT+D +FA+RP H+A++YM+Y
Sbjct  48   NPHQDLQKLANKHGPIMYMRLGLVPAIVASSADAAEKVLKTNDHIFASRPHHEASQYMAY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKN  F +YGPYWRN+RKLCT+ LLS+HKINSFQSMR+++V LL++SLK+ + +   VD
Sbjct  108  GQKNFIFAKYGPYWRNIRKLCTVHLLSSHKINSFQSMRKQQVQLLIDSLKREAHDRIVVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+ S++A ++C MVFGKKY D+D+  +GFKAV+ + + LAA PN
Sbjct  168  LSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKAVVQDVLHLAATPN  214



>ref|XP_004488758.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=496

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+L++ +GPIMH+R G +  I+VSS +AA+ FLKTHDLVFA+RP  +AAKY+ +
Sbjct  47   NPHRDLHQLSQKYGPIMHMRLGLIPTIVVSSPQAAKHFLKTHDLVFASRPYVEAAKYIFW  106

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QK+++F EYG YWRNMRK+CTLEL+S  KINSF+SMR EEV +L++ L++AS +G  VD
Sbjct  107  EQKDVAFCEYGSYWRNMRKMCTLELMSQSKINSFRSMREEEVDILIKFLREASNDGTKVD  166

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAKV+++  +M+CRMV GKKY DK++ +KGFK ++ EAM+L   PN
Sbjct  167  ISAKVSTLMVDMTCRMVVGKKYMDKELDEKGFKLMMDEAMNLLGTPN  213



>ref|XP_009586899.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=500

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK HGPIM +RFG V  I+ SS  +AE FLK HDLVFA+RP + AA+Y+ Y
Sbjct  51   NLHQDLYQIAKKHGPIMSMRFGLVPVIVASSPHSAELFLKKHDLVFASRPYNTAAQYIGY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+NL+FG+YGPYWRNMRKLCTLELLS  KINSFQSMR++E+   V  L +A+ NG  VD
Sbjct  111  NQRNLTFGKYGPYWRNMRKLCTLELLSTLKINSFQSMRKQEIGNFVTFLNRAASNGIEVD  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAK+AS+SA M+C MVFGKKY D++  ++GFK VI E + + A PN
Sbjct  171  ISAKLASLSANMACLMVFGKKYMDEEFDERGFKDVIQETLVITATPN  217



>ref|XP_006428071.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
 ref|XP_006464323.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41311.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
Length=498

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH+LA+ +GPIMHLR G    I+VSS +AAE FLKTHDL+FA+RPP +AAK++SY 
Sbjct  52   PHRALHKLAERYGPIMHLRLGLTPTIVVSSPQAAELFLKTHDLIFASRPPLKAAKHISYE  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK L+   YG YWR +RK+CTLELLS+ KINSFQ+MR+EE+ LL+ S+K+A+     VDL
Sbjct  112  QKGLALSPYGSYWRTIRKICTLELLSSFKINSFQAMRKEELDLLIASIKEAACARCVVDL  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S KV++MSA+M+CRMVFGKKY D +  ++GFK VI E M LAA PN
Sbjct  172  STKVSAMSADMTCRMVFGKKYSDDEFDERGFKTVIQEGMELAAKPN  217



>ref|XP_011090598.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQD H LA+ +GPIM+LRFGFV  I+VSS  AAE  LKTHDL+FA R  HQAAK +SY
Sbjct  48   NPHQDFHNLAQKYGPIMYLRFGFVPTIVVSSPAAAELVLKTHDLIFAGRAHHQAAKEISY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +++N+ F +YG YWRNMRKLCTLELLSN KIN FQ MRR E+ + VESL++A+     VD
Sbjct  108  DKRNIVFAQYGIYWRNMRKLCTLELLSNFKINQFQPMRRAEIEVFVESLQRAAGKRETVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAK++++  +M+C MVFG+K+ D D+ +KGFKAVI E + +AALPN
Sbjct  168  ISAKISALIGDMTCLMVFGRKFADGDLDEKGFKAVIGETLQVAALPN  214



>ref|XP_009607200.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=497

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK +GPIM +RFG V  I+ SS  AAEQFLK HD  FA+RP H+ ++Y+ Y
Sbjct  46   NLHQDLYKIAKKYGPIMTIRFGLVPVIVASSPHAAEQFLKNHDSTFASRPYHEVSQYIFY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL   +YGPYWRNMRKLCTL+LLSN KI+ FQ MR++EV +LV  L+ A+  G  +D
Sbjct  106  EQRNLVSAKYGPYWRNMRKLCTLQLLSNAKIHQFQPMRKQEVGILVNFLRHAASEGTVID  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKVAS+SA MSC M+FGKKY D+D+G+KGFKA+I + + LAALPN
Sbjct  166  LSAKVASLSANMSCLMIFGKKYMDEDLGEKGFKALIQDILHLAALPN  212



>ref|XP_004237615.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=492

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA  HGPIM++R G V   + SSA+AAE+ LKT+D VFA+RP H+A++Y+SY
Sbjct  45   NPHQDLQKLANKHGPIMYMRLGLVPTFVASSADAAEKVLKTYDHVFASRPHHEASQYLSY  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL F +YG YWRNMRKLCT+ LLSN+KINSFQSMR+++V LL+ESLK+ + +  AVD
Sbjct  105  GQKNLIFAKYGVYWRNMRKLCTVHLLSNNKINSFQSMRKQQVQLLIESLKKEAHDRVAVD  164

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+ S++A ++C MVFGKKY D+D+  +GFK+++ + + LAA PN
Sbjct  165  LSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKSIVQDVVHLAATPN  211



>ref|XP_009607201.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=498

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDLH++AK +GPIM +RFG V  I+ SS  AAEQFLK HDLVFA+RP ++  +++ Y
Sbjct  51   NLHQDLHKIAKKYGPIMTIRFGLVPVIVASSPHAAEQFLKNHDLVFASRPYNEVPQHIFY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             ++NL   +YGPYWRNMRKLCTL+LLSN KI+ FQ MR++E+ +LV  LK A+  G  +D
Sbjct  111  ERRNLVSAKYGPYWRNMRKLCTLQLLSNAKIHQFQPMRKQELGILVNFLKHAASEGTVID  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKVAS+SA MSC M+FGKKY D+D+GDKGFKA+I + + +AALPN
Sbjct  171  LSAKVASLSANMSCLMIFGKKYMDEDLGDKGFKALIQDILHIAALPN  217



>gb|KJB37875.1| hypothetical protein B456_006G224300 [Gossypium raimondii]
Length=499

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH D   LA+ +GPIM+LRFG +  I+VSS EAAE FLKTHDLVFA+RPPH  +K++SY
Sbjct  51   NPHHDFQRLAQKYGPIMYLRFGLMPVIVVSSPEAAELFLKTHDLVFASRPPHDCSKHISY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+NL F  YGPYWRNMRK+CTLELLSNHKINSF+SMR EE+   V+ +++ +   G V+
Sbjct  111  NQQNLVFSPYGPYWRNMRKMCTLELLSNHKINSFRSMRMEELHGCVQYIREVAATAGVVN  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS+ V+S S E+SCRM+ GKKY+  D  +KGF+ +I EAM +AA  N
Sbjct  171  LSSMVSSFSTEISCRMIIGKKYDRGDFSEKGFEVMIREAMQIAATFN  217



>ref|XP_009588170.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=494

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA  HGPIM++R G V  I+ SSA+AAE+ LKT+D +FA+RP H+A++YM+Y
Sbjct  48   NPHQDLQKLANKHGPIMYMRLGLVPAIVASSADAAEKVLKTNDHIFASRPHHEASQYMAY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKN  F +YGPYWRNMRKLCT+ LLS+HKINSFQS R ++V LL++SLK+ + +   VD
Sbjct  108  GQKNFIFAKYGPYWRNMRKLCTVHLLSSHKINSFQSTRNQQVQLLIDSLKREAHDRVVVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+ S++A ++C MVFGKKY D+D+  +GFKAV+ + + LAA PN
Sbjct  168  LSAKITSLNANLTCLMVFGKKYMDEDLDKRGFKAVVQDVLHLAATPN  214



>ref|XP_008440668.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++LH+L++ +GPIM ++ G V  IIVSS +AA+ FLKTHDL+FA+RP  QA+K++SY 
Sbjct  53   PHRNLHKLSQKYGPIMSMKLGLVPTIIVSSPQAAKLFLKTHDLIFASRPSSQASKHISYQ  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NL F  YGPYWRNMRK+CTLELLSNHKINSF  +R+ E+ LL+E  K+A+ N   V+L
Sbjct  113  QQNLVFAPYGPYWRNMRKMCTLELLSNHKINSFMPIRKHELGLLIEYFKEAAHNKTVVNL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV S++ ++ C M FGKKY D+D  ++GFKAVI E M LAA PN
Sbjct  173  SAKVTSLTTDIICLMAFGKKYGDEDFDERGFKAVIQEGMQLAAAPN  218



>ref|XP_006363549.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
 ref|XP_006363550.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=499

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDLH++AK +GPIM +RFGFV  I+ SS  AAEQFLK HDL+FA+RP + AAK+++Y
Sbjct  51   NVHQDLHKIAKKYGPIMSMRFGFVPVIVASSPHAAEQFLKNHDLIFASRPNNIAAKFIAY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +Q+NL+FG+YGPYWRNMRKLCTLELLS  KINSFQ+MR++EV   V  +  A+ +G  +D
Sbjct  111  DQRNLTFGKYGPYWRNMRKLCTLELLSTLKINSFQAMRKQEVTNFVTFINGAASSGVEID  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAK+A+++  M+C MVFGKKY D +  ++GFK VI E + L A PN
Sbjct  171  ISAKLATLNTNMTCLMVFGKKYMDDEFDERGFKYVIQETLVLTATPN  217



>ref|XP_009608339.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=495

 Score =   220 bits (561),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQ  + LAK +GP M+LR G V  I+VSS E  E+ LKT+D VFA+RP H+A++Y+ Y
Sbjct  48   NPHQTFYRLAKKYGPFMYLRLGLVPTIVVSSPETVEKVLKTYDHVFASRPHHEASQYICY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F +YG YWRNMRKLCTL+LL++ KINS+QS R+EEV +LV+S+KQA+++G AVD
Sbjct  108  GQRNLIFSKYGSYWRNMRKLCTLQLLTSQKINSYQSSRKEEVSILVKSIKQAAQDGVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+S++A +SC MVFGKK+ D+D+  +GFK+++ E + LAA PN
Sbjct  168  LSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKSIVQEVVHLAATPN  214



>ref|XP_007159750.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
 gb|ESW31744.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
Length=497

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 135/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH+LA+ +GPIMHLR GFV  I+VSS  AA+ FLKTHDL++A+RPP + A Y+S+ 
Sbjct  47   PHRDLHQLAQKYGPIMHLRLGFVPTIVVSSPHAAQLFLKTHDLIYASRPPLEVANYISWG  106

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q+NL+F +YG YWR+ RK+CT ELLS+ KINSF+ +R EE+ LLV+ L++A+++G  VD+
Sbjct  107  QRNLAFAQYGSYWRSTRKMCTSELLSHAKINSFRPLREEELDLLVKHLREAAKDGAVVDV  166

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKVA++SA+ +CRM+ GKKY D+++ + GFKAV+ E M LAA PN
Sbjct  167  SAKVAALSADSACRMILGKKYMDQELDEMGFKAVMKELMYLAAAPN  212



>ref|XP_010099909.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB80838.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=498

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            H DLH+LAK +GPIMH+R G +  IIVSS EAAE FLKTHDLVFA+RP  +AAKYM +  
Sbjct  53   HHDLHKLAKKYGPIMHMRLGLIPTIIVSSPEAAELFLKTHDLVFASRPHIEAAKYMFWEY  112

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
            ++L F  YG YWR MRK+CTLELL++ KI+SF+++R+EE+  L++++++A+R   +VDLS
Sbjct  113  RDLVFAPYGSYWRYMRKMCTLELLNSVKISSFKAIRKEEIGQLIDTIQKAARERVSVDLS  172

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            AKV +++A+MSCRMVFGKKY DK+  ++GFK VI EAM LAA+PN
Sbjct  173  AKVTTLNADMSCRMVFGKKYLDKEFDERGFKVVIQEAMHLAAIPN  217



>ref|XP_008440671.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 129/166 (78%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++LH+L++ +GPIM ++ G V  IIVSS +AA+ FLKTHDL+FA RP  QA+K++SY 
Sbjct  53   PHRNLHKLSQKYGPIMSMKLGIVPTIIVSSPQAAKLFLKTHDLIFANRPSLQASKHISYQ  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNL F  YGPYWRNMRK+CTLELLSNHKINSF  +R+ E+ LL+E  K+A+ N   V+L
Sbjct  113  QKNLVFSPYGPYWRNMRKMCTLELLSNHKINSFMPIRKHELGLLIEYFKEAAHNKTVVNL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV S++ ++ C M FGKKY D+D  ++GFKAVI E M LAA PN
Sbjct  173  SAKVTSLTTDIICLMAFGKKYGDEDFDERGFKAVIQEGMQLAAAPN  218



>ref|XP_004237505.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DL  LAK HGPIM++R G V  II SSA+AAE+ LKT+D +FA+RP H+A+++++Y
Sbjct  48   NPHKDLQNLAKKHGPIMYMRLGLVPTIIASSADAAEKVLKTYDHIFASRPHHEASQHLAY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL F +Y  YWRN+RKLCT+ LLSN KI+SFQSMR++EV LL+ESLKQ +R+   +D
Sbjct  108  GQKNLVFAKYDVYWRNIRKLCTVHLLSNQKIHSFQSMRKQEVELLIESLKQEARDRVVID  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV S++A ++C MVFGKKY D+D+  +GFKA++ + + LA +PN
Sbjct  168  LSAKVTSLNANLTCLMVFGKKYMDEDLDKRGFKAIVQDVVHLAGMPN  214



>emb|CDP12934.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LAK HGPIM++RFG+V  IIVSS EAAE+FLKT+D VFA RP H+A+ Y++Y
Sbjct  52   NPHQDLAKLAKKHGPIMYMRFGYVPTIIVSSPEAAEKFLKTYDQVFAGRPYHEASWYIAY  111

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL+FG+YGPYW+NM KLC L+LLS+HKINSF+ MRR+EV  LV+SLKQA+ +G AVD
Sbjct  112  EQRNLTFGQYGPYWQNMCKLCILQLLSSHKINSFRPMRRQEVGTLVKSLKQAASDGAAVD  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDK  651
            LSA ++S+   MSC M+FG+KY DKD  D+
Sbjct  172  LSALISSLGTNMSCLMIFGQKYMDKDFDDR  201



>ref|XP_006380460.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
 gb|ERP58257.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
Length=497

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DLH+LAK +GPIM++R G V  ++VSS  AAE  LKTHDLVFA RPP++AAK+++Y 
Sbjct  51   PHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILKTHDLVFANRPPNEAAKHITYE  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK L+F  YG YWRN+RK+CTLELLSNHKINSF S R+EE+ LL++ +K ASR+  AVDL
Sbjct  111  QKGLTFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRDRVAVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            SAKV+S++A++SCRM+FGKK  +K+  ++GF+ + HE + +AA
Sbjct  171  SAKVSSLNADISCRMIFGKKDLEKEFDERGFEPLTHEGIRIAA  213



>gb|KJB37877.1| hypothetical protein B456_006G224400 [Gossypium raimondii]
Length=499

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH D   LA+ +GPIMHLR G +  I+VSSAEAAE FLKTHDLVFA+RPPH+ +K + Y
Sbjct  51   NPHHDFQRLAQKYGPIMHLRLGLMPVIVVSSAEAAELFLKTHDLVFASRPPHEGSKLICY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+NL F  YG YWRNMRK+CTLELLSNHKIN+F+SMR EE+   V+ +++A+  G  VD
Sbjct  111  NQQNLVFSPYGSYWRNMRKMCTLELLSNHKINTFRSMRMEELHGCVQYIREAATAGCVVD  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS+ ++S S ++SCRM+ GKKY+  D  +KGFKA + E M + A  N
Sbjct  171  LSSTISSFSTDISCRMIIGKKYDHDDFSEKGFKATLREGMQIGATIN  217



>ref|XP_008440675.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=494

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DL  L+K +G IM++R G V  +IVSS +AAE FLKTHD VFA+RP  QA+KYMSY 
Sbjct  48   PHRDLRSLSKKYGSIMYMRLGLVPTVIVSSPQAAELFLKTHDTVFASRPFVQASKYMSYG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNL F +YGPYWRNMRK+CTLELLS+ K+ SF+SMR EE+ LLV+ L+ A++    V+L
Sbjct  108  QKNLGFAQYGPYWRNMRKMCTLELLSSVKVKSFRSMRMEELGLLVDYLRDAAKKRVIVNL  167

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S+K+ S++ +M+C MVFGKKYED++  ++GFK+VI EAM L A PN
Sbjct  168  SSKICSLNTDMTCLMVFGKKYEDQEFDERGFKSVIQEAMQLVASPN  213



>ref|XP_009767392.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL++LAK +GP M+LR G V  IIVSS E  E+ LKT+D VFA+RP ++A++Y+SY
Sbjct  48   NAHQDLYKLAKKYGPFMYLRLGLVPTIIVSSPETVEKVLKTYDHVFASRPHNEASQYISY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F +YG YWRNMRKLCTL+LL++ K+NS+QS R+EEV +LV+S+KQA+++G AVD
Sbjct  108  GQRNLIFSKYGSYWRNMRKLCTLQLLTSQKVNSYQSSRKEEVYILVKSIKQAAQDGVAVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+S++A +SC MVFGKK+ D+D+  +GFK+++ E   LA  PN
Sbjct  168  LSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKSIVQEVAHLAVTPN  214



>ref|XP_011657998.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=497

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+D H L++ +GPIMH++ G V  IIVSS +AAE FLKTHDLVFA+RP  +A+K M+Y 
Sbjct  50   PHRDFHILSQKYGPIMHIKLGLVPTIIVSSPKAAELFLKTHDLVFASRPLLEASKQMNYG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNL F  YGPYWRNMRK+CTLELLSN KINSF  MR+ E+ LL+E LK+A+ N   V+L
Sbjct  110  QKNLVFAPYGPYWRNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEAAHNKAVVNL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAKV S++ ++ C M FGKKY D++I ++GFKA I E   LAA PN
Sbjct  170  SAKVTSLTTDLICLMAFGKKYGDEEIDERGFKATIQEGSQLAATPN  215



>ref|XP_011090604.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=497

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NP+QDLH LA+ +GPIM++RFG V  IIVSS  AAE FLK HDL FA +P H+A+ Y+SY
Sbjct  49   NPYQDLHRLARKYGPIMYMRFGTVPTIIVSSPAAAELFLKKHDLTFANKPHHEASNYLSY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+N+ FG YGPYWRNMRKL TLELLSN KI+ FQ MR+ E+ +LV SLK A+  G  VD
Sbjct  109  EQRNIVFGRYGPYWRNMRKLATLELLSNLKISQFQPMRKAEIDILVGSLKSAAEIGETVD  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            +S ++AS+SA+M+C MVFG+KY DKD+ D+G K V+ E +  AA
Sbjct  169  MSVRIASVSADMTCLMVFGRKYADKDLNDEGLKEVMKETVEEAA  212



>gb|EYU31078.1| hypothetical protein MIMGU_mgv1a004963mg [Erythranthe guttata]
Length=502

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDLH LA+ HGPIMH+RFG VD IIVSS  AAE FLKTHDLVFA RP H+A+ Y+ Y
Sbjct  53   NPHQDLHRLARKHGPIMHMRFGSVDTIIVSSPAAAELFLKTHDLVFANRPHHEASTYIGY  112

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+N+ FG YGPYWRNMRKL TLELLS  KIN FQ MR+ E+ L V+SLK+A      VD
Sbjct  113  EQRNIVFGPYGPYWRNMRKLVTLELLSGSKINQFQPMRKAELGLFVDSLKRAGPGREPVD  172

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            +S ++ S++A+M+C MV+G+K+  KD+ ++GFK V+   M  AA
Sbjct  173  MSERIMSLAADMTCLMVYGRKFAGKDLDERGFKEVMKMTMEEAA  216



>ref|XP_009631554.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=503

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NP QD ++L+K HGPIM+L+ G V   ++SS E+AE+ LKT+D VFA+RP ++ A+Y+SY
Sbjct  57   NPTQDFYKLSKKHGPIMYLKLGLVPTYVISSPESAEKILKTYDHVFASRPHNETAQYISY  116

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F +YG YWRNMRKLCT+ LLSNHKINS++S R EEV L+++S+K ++++G  VD
Sbjct  117  GQRNLIFSKYGAYWRNMRKLCTVHLLSNHKINSYRSTRSEEVALMIKSIKPSAQDGVVVD  176

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+S+SA +SC MVFGKK+ D+D+  +GFK+++ E   LAA PN
Sbjct  177  LSAKVSSLSANLSCLMVFGKKFMDEDLDKRGFKSLVQEVTHLAATPN  223



>ref|XP_009586693.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Nicotiana 
tomentosiformis]
Length=290

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK +GPIM +RFG V  I+ SS  AAEQFLK HDL+FA+RP H A  Y+ Y
Sbjct  46   NLHQDLYKIAKKYGPIMTIRFGLVPTIVASSPHAAEQFLKNHDLIFASRPYHAACHYIFY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+NL   +Y PYWRNMRKLCTL+LLS  KINSFQ MR++E+ +LV  LK A+ N   VD
Sbjct  106  NQRNLIMAKYSPYWRNMRKLCTLQLLSRVKINSFQPMRKQELEILVNFLKNAALNQDEVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKVA +SA M+C MVFGKKY + D  +KGFK VI E   +AA PN
Sbjct  166  LSAKVAYLSANMACLMVFGKKY-NIDEDNKGFKGVIQETSHIAATPN  211



>gb|AJD25257.1| cytochrome P450 CYP736A122 [Salvia miltiorrhiza]
Length=502

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDLH LA+ HGPIM+ RFG +  IIVSS  AAE FLKTHDL+FA RP H+AA Y+ Y
Sbjct  52   NPHQDLHRLARKHGPIMYTRFGSIPTIIVSSPSAAELFLKTHDLIFADRPHHEAAYYLGY  111

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+N+ FG YGPYWRNMRKLCTLELLS  +I+ FQ MRR E+   V+ L++A+  G  VD
Sbjct  112  EQRNIVFGRYGPYWRNMRKLCTLELLSGLRIDEFQPMRRAEIMRAVDGLRRAAEEGEVVD  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDK-GFKAVIHEAMSLAALPN  702
            +SA+V+ +  +M+C MVFG+K+ D+D+  + GFK VI E   +AA PN
Sbjct  172  VSARVSGLVGDMNCLMVFGRKFVDRDLDQELGFKDVIEETTRVAAQPN  219



>ref|XP_009770688.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 131/167 (78%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NP QD ++L+K HGPIM+L+ G V   ++SS E+AE  L+T D VFA+RP ++ A+Y+SY
Sbjct  49   NPTQDFYKLSKKHGPIMYLKLGLVPTYVISSPESAENILRTFDHVFASRPHNETAQYISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F +YG YWRNMRKLCT+ LLSNHKINS++S R EEV L+++S+K ++ +G  VD
Sbjct  109  GQRNLIFSKYGAYWRNMRKLCTVHLLSNHKINSYRSTRSEEVALMIKSIKPSAEDGVVVD  168

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKV+S+SA +SC M+FGKK+ D+D+G +GFK+++ E   LAA PN
Sbjct  169  LSAKVSSLSANLSCLMIFGKKFMDEDLGKRGFKSLVQEVTHLAATPN  215



>gb|AHN09742.1| biphenyl-4-hydroxylase [Sorbus aucuparia]
Length=499

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DL++LA+ +G IM++R G   N+++SS+ AAE FLKTHDL FA+RPPH+ AK++ + 
Sbjct  52   PNRDLYQLAQKYGDIMYMRLGLHHNVVISSSRAAELFLKTHDLTFASRPPHEGAKHIIFG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGA-VD  561
            QKN+SF EYG YWR+MRK+C LELLSNHKINSF++MRREEV LL++S+++ + N    ++
Sbjct  112  QKNMSFAEYGSYWRDMRKMCMLELLSNHKINSFKAMRREEVSLLIQSVQEDANNRRVPIN  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK++S+  +++CRMVFGKKY+D++  ++GF AV+ EA+ L A PN
Sbjct  172  LSAKISSLGVDLTCRMVFGKKYKDEEFDERGFTAVMKEAIQLVAAPN  218



>ref|XP_004252512.2| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=346

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DL +LA THGP M++R G V  IIVSSA AAE+ LKT+D +FA+RP  +A+ Y++Y
Sbjct  46   NPHKDLQKLANTHGPFMYVRLGLVPTIIVSSAGAAEKVLKTYDHIFASRPHMEASYYLAY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKNL   ++GPYWRNMRKLCT  LLSN KINSFQSMRRE+V L+++SLK   R     D
Sbjct  106  EQKNLISAKHGPYWRNMRKLCTQHLLSNQKINSFQSMRREQVELMIKSLKNDDR--VVFD  163

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAK++S+SA+++C MVFGKKY D+D+  +GFKAV+ E   L+A PN
Sbjct  164  VSAKISSLSADLTCMMVFGKKYMDEDLDKRGFKAVVKEVEHLSATPN  210



>ref|XP_009378500.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DL++LAK +G IM++R G   N+++SS  AAE FLKTHDL FA+RPPH+ AK++ + 
Sbjct  52   PNRDLYQLAKKYGDIMYMRLGLHHNVVISSPRAAELFLKTHDLTFASRPPHEGAKHIIFG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGA-VD  561
            QKN+SF EYG YWR+MRK+C LELLSNHKINSF++MRREEV LL++S+++ + N    ++
Sbjct  112  QKNMSFAEYGSYWRDMRKMCMLELLSNHKINSFKAMRREEVSLLIQSVQEEANNRRVPIN  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS K++S+  +++CRMVFGKKY+D +  ++GF AV+ EA+ L A PN
Sbjct  172  LSGKISSLGVDLTCRMVFGKKYKDDEFDERGFTAVMKEAIQLVAAPN  218



>ref|XP_008385982.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P+++L++LA+ +G IM++R G   NI++SS  AAE FLKTHDL FA+RPPH+ AK++ + 
Sbjct  52   PNRNLYQLAQKYGDIMYMRLGLQHNIVISSPRAAELFLKTHDLNFASRPPHEGAKHVIFG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGA-VD  561
            Q N+SF +YGPYWR+MRK+CTLELLSNHKINSF++MRREEV LL++S+++ + +    ++
Sbjct  112  QTNMSFAKYGPYWRDMRKMCTLELLSNHKINSFKAMRREEVSLLIQSVQEDANBRRVPIN  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS K+AS+S +++CR+VFGKKY+D+D  ++GF AV+ E++ + A PN
Sbjct  172  LSDKIASLSVDLTCRLVFGKKYKDEDFDERGFTAVLKESIQIVAAPN  218



>ref|XP_011658487.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=494

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 131/166 (79%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DL  L++ +G IM++R G V  IIVSS +AAE FLKTHD VFA+RP  QA+KYM+Y 
Sbjct  48   PHRDLQSLSEKYGSIMYMRLGLVPTIIVSSPQAAELFLKTHDSVFASRPFVQASKYMAYG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKNL+F +YGPYWRN+RK+CTLELLS+ K+ SF+SMR EE+ L V+ L+ A+R    V+L
Sbjct  108  QKNLAFSQYGPYWRNLRKMCTLELLSSVKVKSFRSMRMEELGLFVDYLRDAARKRVIVNL  167

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S+K+ S++ +M+C MVFGKKY+D++  ++GFK+VI EAM + A PN
Sbjct  168  SSKICSLNTDMTCLMVFGKKYKDQEFDERGFKSVIQEAMQIVASPN  213



>ref|XP_008440670.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=497

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH L++ +GPIMH++ G V  IIVSS  AA+ FLKTHD VFA+RP    +  MSY 
Sbjct  49   PHRDLHHLSQKYGPIMHMKLGLVHTIIVSSPHAAKLFLKTHDQVFASRPLIHTSNIMSYG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+L F  YG YWRN+RK+CTLEL S  KINSF+SMR+EEV  L+E LK ASR+  AV +
Sbjct  109  QKDLVFAPYGSYWRNIRKMCTLELFSPVKINSFKSMRKEEVRELIEYLKTASRDRVAVRV  168

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S+KV+S+SA+M+C M FGKKY D++ G++GFKAVI EAM LA  PN
Sbjct  169  SSKVSSLSADMTCLMAFGKKYRDEEFGERGFKAVIQEAMQLAIAPN  214



>gb|EYU24036.1| hypothetical protein MIMGU_mgv1a005182mg [Erythranthe guttata]
Length=494

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NP  +LH LA+ HGPIM LR GFV  ++VSS  AAE  LKTHDLVFA+RP   AA+YMSY
Sbjct  46   NPPHNLHRLARKHGPIMGLRLGFVPAVVVSSPAAAELILKTHDLVFASRPKSAAAEYMSY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKN+ FG YGPYWR+MRK+CTLELLS+ +I+ FQ+MR  E+ L+V+SLKQA+  G  VD
Sbjct  106  QQKNIIFGPYGPYWRDMRKICTLELLSSLRISQFQAMRAAELRLMVDSLKQAAELGEIVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            LSA+V+ ++ +M+C M+FG+KY D+D  +KGFKAV  E + ++A
Sbjct  166  LSARVSGVNGDMNCLMIFGRKYADEDFDEKGFKAVFTEVVEMSA  209



>ref|XP_009600860.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=487

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 130/168 (77%), Gaps = 2/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N H  L+++AK HGPIM +RFG V  ++ SS  AAEQFLK HDLVFA+RP  + ++Y+ Y
Sbjct  40   NLHHYLYKIAKKHGPIMSMRFGLVPVVVASSPYAAEQFLKNHDLVFASRPYSEVSQYIFY  99

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG--A  555
            NQ+NL   +YGPYWRNMRKLCTL+LLSN KI+SFQ MR++EV +LV  LKQA+ + G   
Sbjct  100  NQRNLVSSKYGPYWRNMRKLCTLQLLSNVKIHSFQPMRKQEVGILVNFLKQAAASDGDVV  159

Query  556  VDLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALP  699
            V+LS K+ S+SA M+C MVFGKKY D+D+G+KGFKA++ E M + ++P
Sbjct  160  VNLSDKIGSLSANMACMMVFGKKYMDEDLGEKGFKALVQETMRIISMP  207



>gb|KCW54385.1| hypothetical protein EUGRSUZ_I00337 [Eucalyptus grandis]
Length=298

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 122/167 (73%), Gaps = 7/167 (4%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DL +LA+ +GPIM+LR GF+  IIVSS EAAE  LKTHDLVFA+RPP +A K+M Y
Sbjct  51   NPHHDLRKLAQKYGPIMYLRLGFMPTIIVSSPEAAELVLKTHDLVFASRPPQEAMKHMLY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NLSF  YGPYWRN+RK+CTLELLSN K+ SF+ +RRE           AS +   ++
Sbjct  111  EQRNLSFSPYGPYWRNVRKMCTLELLSNAKVKSFECIRREGSA-------YASLDRATIN  163

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS K++S+S +M+CRM+FGKKY D++   +GFKA I E M L A PN
Sbjct  164  LSGKISSLSTDMNCRMIFGKKYLDEEFDKRGFKAWIQEGMILTATPN  210



>ref|XP_006428070.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
 ref|XP_006493870.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41310.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
Length=498

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P + LH+LAK +GPIMHLR G +  I+VSS +AAEQFLKTHDL+FA+RPP QA+KYMSY 
Sbjct  52   PPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQASKYMSYQ  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN +   YG YWR +RK+CT  LLSN KIN FQ +R+EE+ LL+E  K+A R    VD+
Sbjct  112  QKNFAMAPYGSYWRKVRKICTQNLLSNAKINYFQPIRKEELDLLIEYFKEAVRARCVVDI  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAK++++SA M+CRMV GKK  D +  ++GF+ V+ E M L   PN
Sbjct  172  SAKLSALSANMTCRMVLGKKCSDDEFDERGFENVVQEGMELVGKPN  217



>ref|XP_008385983.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008359286.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P+++L++LA+ +G IM++R G   NI++SS  AAE FLKTHDL FA+RPPH+ AK++ + 
Sbjct  52   PNRNLYQLAQKYGDIMYMRLGLHHNIVISSPRAAELFLKTHDLTFASRPPHEGAKHVIFG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGA-VD  561
            Q N+SF EYGPYWR+MRK+C LELLSNHKINSF++MRREEV LL++S++  + N    ++
Sbjct  112  QTNMSFAEYGPYWRDMRKMCMLELLSNHKINSFKAMRREEVSLLIQSVQXDANNRRVPIN  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS K+AS+  +++CR+VFGKKY+D +  ++GF AV+ EA+ L A PN
Sbjct  172  LSXKIASLGVDLTCRLVFGKKYKDVEFDERGFTAVMKEAIQLVAAPN  218



>ref|XP_006346619.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=493

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 126/167 (75%), Gaps = 2/167 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH D   LAK HGPIM++R G V  IIVSS + AE+ LKT+D +FA +P ++AA Y++Y
Sbjct  48   NPHHDFQNLAKKHGPIMYMRLGLVPTIIVSSTDVAEKILKTYDHIFANKPHNEAAHYLAY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QKN+ F +YGPYWRNMRKLCT  LL+N KINSFQS+RR++V L+++SL+   R    VD
Sbjct  108  GQKNIIFAKYGPYWRNMRKLCTQHLLTNQKINSFQSLRRQQVELMIKSLQNEGR--VVVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS +VAS++A M+C MVFGKKY D+D   +GFKAV+ E + LAA+ N
Sbjct  166  LSERVASLNANMTCLMVFGKKYMDQDFDKRGFKAVLQEVVHLAAITN  212



>ref|XP_004252295.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=496

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH D   LAK +GPIM++R G V  I+VSS++ AE+FLKT+D +FA +P ++AA Y++Y
Sbjct  48   NPHHDFQNLAKKYGPIMYMRLGLVPTIVVSSSDVAEKFLKTYDHIFANKPHNEAAHYLAY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AV  558
             QKN+ F +YGPYWRNMRKLCT  LL+N KINSFQS+R ++V L++ESL+  SR     V
Sbjct  108  GQKNIIFAKYGPYWRNMRKLCTQHLLTNQKINSFQSLRSQQVELMIESLQNESRGERVVV  167

Query  559  DLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            DLS +VAS++A M+C MVFGKKY D+D   +GFKAV+ E + LAA+ N
Sbjct  168  DLSERVASLNANMTCLMVFGKKYMDEDFDKRGFKAVLQEVVHLAAITN  215



>ref|XP_006346716.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDLH++AK +GPIM ++FG +  I+ SS   AEQFLK HDLVFA+RP ++A + ++Y
Sbjct  51   NIHQDLHKIAKKYGPIMSMKFGVIPIIVASSPHVAEQFLKKHDLVFASRPNNRAMQIVAY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+NL+FG+YGPYWRNMRKLCTLELLS  KINSFQ MR+++V   V  + +A+ +   VD
Sbjct  111  NQRNLTFGKYGPYWRNMRKLCTLELLSPLKINSFQDMRKQQVTNFVTFINRAASSHVEVD  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SA +A +SA MSC M+FGK+Y D +  ++GFK VI EA+ +A  PN
Sbjct  171  ISANLALLSANMSCLMIFGKEYMDDEFDERGFKDVIQEALIIAGTPN  217



>ref|XP_006366158.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=498

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQD  +LAKTHGP+M++R G V  I+VSSA+ AE+FLKT+D +FA+RP ++AA Y++Y
Sbjct  49   NPHQDFLKLAKTHGPLMYVRLGLVPTIVVSSADTAEKFLKTYDHIFASRPHNEAAYYLAY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLK-QASRNGGAV  558
             QKNL   ++GPYWR+MRKLCT  L  N KINSFQSMR+++V ++++SLK +A  +   V
Sbjct  109  GQKNLISAKHGPYWRSMRKLCTQHLFGNQKINSFQSMRKQQVEVMIKSLKNEACDHRVVV  168

Query  559  DLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            DLSAK++S++A+++C MVFGKKY D+D+  +GFKA++ E   LAA PN
Sbjct  169  DLSAKISSLNADLTCLMVFGKKYMDEDLDKRGFKALVKEVEHLAATPN  216



>ref|XP_009790894.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=209

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N H D +++AK +GPIM +RFG V  ++ S   AAEQFLK HDLVFA+RP  + ++Y+ Y
Sbjct  40   NLHLDFYKIAKEYGPIMSMRFGLVPVVVASFPYAAEQFLKNHDLVFASRPYSEVSQYIFY  99

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG--A  555
            NQ+NL   +YGPYWRNMRKLCTL+LLSN KI+SFQ MR+++V  LV  LKQA+ + G   
Sbjct  100  NQRNLVSSKYGPYWRNMRKLCTLQLLSNVKIHSFQPMRKQQVGTLVNFLKQAAASDGDVV  159

Query  556  VDLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEA  678
            V+LS K+ S+S  M+C M+FGKKY D+D+G+KGFKA++ E 
Sbjct  160  VNLSDKIGSLSTNMACMMLFGKKYMDEDLGEKGFKALVQET  200



>ref|XP_009372721.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P  DLH+LA+ +G IM+LR G    ++VS+A AAE FLKTHDL FA+RPP++ AK++ + 
Sbjct  50   PTMDLHQLAQKYGDIMYLRLGLQHTVVVSTARAAELFLKTHDLNFASRPPNEGAKHLIFG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF EYG YW NMR++C LELLSN KINSF+SMRREEV LL++S+++ + N    +L
Sbjct  110  QKSLSFAEYGSYWTNMRRICMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            + KV S+  +M+CRMVFGKKY+D++ G +G  +V+ E M LAA PN
Sbjct  170  TDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIASVMKEGMKLAAAPN  215



>ref|XP_004252382.1| PREDICTED: cytochrome P450 CYP736A12 [Solanum lycopersicum]
Length=493

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 125/166 (75%), Gaps = 1/166 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH DL  LAK +GP  ++R G +   I SS + AE+FLKT+D +FATRP ++AAKY+SY 
Sbjct  49   PHHDLQNLAKKYGPFFYIRLGLIPTYIASSVDTAEKFLKTYDHIFATRPHNEAAKYLSYG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             KNL FG YGPYWRNMRKL TL+LL++ KINSFQS+R E+V L+++SLK     G  VDL
Sbjct  109  HKNLVFGTYGPYWRNMRKLVTLDLLTHQKINSFQSVRTEQVDLMIQSLKNDG-GGCVVDL  167

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SA+V+ +SA+++C MVFGKKY D+++G +GFK ++ E + L A PN
Sbjct  168  SARVSKLSADITCLMVFGKKYMDEELGKRGFKGILQEVVHLGATPN  213



>ref|XP_011100886.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=520

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQ+L+ LA+ HGPIM LR GFV  ++VSS   AE  LKTHDLVFA RP ++A+KY+ Y
Sbjct  71   NPHQNLYHLAQKHGPIMGLRLGFVPTVVVSSPAGAELVLKTHDLVFANRPRNEASKYIMY  130

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             QK+L+FG+YGPYWRNMRKLCTLELLSN +IN F +MR+ E+ LLV SLK+A+     VD
Sbjct  131  EQKDLAFGQYGPYWRNMRKLCTLELLSNRRINEFGAMRKVELELLVSSLKRAAEMREIVD  190

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIG-DKGFKAVIHEAMSLAA  693
            LSA+V+ +  +++C MVF +KY DKD+  +KGFK +I EA+  A 
Sbjct  191  LSARVSGLIGDVTCLMVFRRKYADKDLDHEKGFKTLIMEALEFAG  235



>ref|XP_008344234.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=496

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P  DL +LA+ +G IM+LR G    ++VSSA AAE FLKTHDL FA+RPP++ AK++ + 
Sbjct  50   PTMDLRQLAQKYGDIMYLRLGLQYTVVVSSARAAELFLKTHDLNFASRPPNEGAKHLIFG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF EYG YW NMRK+C LELLSN KINSF+SMRREEV LL++S+++ + N    +L
Sbjct  110  QKSLSFAEYGSYWTNMRKICMLELLSNQKINSFKSMRREEVALLIKSVQEDTNNRRIANL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            + KV S+  +M+CRMVFGKKY+D++ G +G  +V+ E + LAA PN
Sbjct  170  TDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAAAPN  215



>gb|EYU27291.1| hypothetical protein MIMGU_mgv1a023536mg [Erythranthe guttata]
Length=497

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQ+LH LA+ +GPIM LR G V   +VSS   AE FLKTHDL FA R P QAA+++SY
Sbjct  51   NPHQNLHRLAQKYGPIMFLRLGMVPAFVVSSPAGAELFLKTHDLSFANRHPSQAAEHISY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              +N++   YGPYWRNMRKL T+ LLSN KIN FQ+MR+ E+  LV  L++AS N   VD
Sbjct  111  GSRNIASAPYGPYWRNMRKLSTVNLLSNIKINQFQAMRKGELGALVNRLRRASDNREIVD  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +   V +++ +M C MVFG+KY D D+GDKGFKAVI EA+ +AA PN
Sbjct  171  VGKMVTTLTGDMICMMVFGRKYGDSDLGDKGFKAVIEEALDIAAAPN  217



>ref|XP_008364814.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=498

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P  DLH+LA+ +G IM+LR G    ++VSS  AAE FLKTHDL FA+RPP++ AK++ + 
Sbjct  52   PTMDLHQLAQKYGDIMYLRLGLQHTVVVSSTRAAELFLKTHDLNFASRPPNEGAKHLIFG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q++LSF EYG YW NMRK+C LELLSN KINSF+SMRREEV LL++S++  + +    ++
Sbjct  112  QRSLSFAEYGSYWTNMRKICMLELLSNQKINSFKSMRREEVALLIKSVQDDANSRRIANV  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            + KV+S+   M+CRMVFGKKY+D++ G +GF +V+ E M LAA PN
Sbjct  172  TDKVSSLGINMTCRMVFGKKYKDEEFGGRGFASVMKEGMKLAAAPN  217



>ref|XP_008441066.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=499

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            H+DLH L++ +GPIMH++ G +  IIVSSA A E FLKTHDL FA+RP    + ++SY +
Sbjct  54   HKDLHYLSQIYGPIMHIQLGLLPAIIVSSARATELFLKTHDLHFASRPLTITSNHISYGR  113

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
            K + F +YGPYWRN+RK+CTLELLS+ KINSF SMR++EV  L++ L+ A+ +G AVDL+
Sbjct  114  KGIVFAQYGPYWRNIRKMCTLELLSSLKINSFSSMRKQEVGSLIKGLEDAATDGVAVDLT  173

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +K++S+  +M C MV G+KYED ++G+KGFK +I EA  LAA PN
Sbjct  174  SKISSVIGDMICVMVLGRKYEDNELGEKGFKGLIREATQLAAAPN  218



>ref|XP_009372725.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P  DL +LA+ +G IM+LR G    ++VSSA AAE FLKTHDL FA RPP++ AK++ + 
Sbjct  50   PTMDLRQLAQKYGDIMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPNEGAKHLIFG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF EYG YW NMRKLC LELLSN KINSF+SMRREEV LL++S+++ + N    +L
Sbjct  110  QKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            + KV S+  +M+CRMVFGKKY+D++ G +G  +V+ E + LA  PN
Sbjct  170  TDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPN  215



>ref|XP_006354708.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=493

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 127/167 (76%), Gaps = 3/167 (2%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL +++K +GPIM + FG V  I+ SS  AAEQFLK HDL+FA+RP +  A+ + Y
Sbjct  49   NLHQDLGKISKKYGPIMSIHFGLVPVIVASSPHAAEQFLKIHDLIFASRPSNDVAETVFY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            N++NL    YGPYWRNMRKLCTL LLSN KI SFQ MR+++V +LV+ +KQ  RN   +D
Sbjct  109  NRRNLVSSNYGPYWRNMRKLCTLHLLSNAKIQSFQPMRKKQVQILVDLMKQ-ERN--VID  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAK+AS+SA MSC M+FGKKY D+D+G+KGF A+I + + +A LPN
Sbjct  166  VSAKIASLSANMSCLMIFGKKYMDEDLGEKGFNALIQDILCIAGLPN  212



>ref|XP_009372726.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P  DL +LA+ +G IM+LR G    ++VSSA AAE FLKTHDL FA RPP++ AK++ + 
Sbjct  50   PTMDLRQLAQKYGDIMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPNEGAKHLIFG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF EYG YW NMRKLC LELLSN KINSF+SMRREEV LL++S+++ + N    +L
Sbjct  110  QKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            + KV S+  +M+CRMVFGKKY+D++ G +G  +V+ E + LA  PN
Sbjct  170  TDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPN  215



>gb|EYU31073.1| hypothetical protein MIMGU_mgv1a004944mg [Erythranthe guttata]
Length=503

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 125/168 (74%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQD+H L++ HGPIMHLR GF+  ++VSS   AE FLKTHDLVFA RP HQAAK+M Y
Sbjct  53   NPHQDMHRLSEKHGPIMHLRLGFLPTVVVSSPAGAELFLKTHDLVFAGRPLHQAAKHMVY  112

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            + ++++FG+YG YWR++RKLCTL LLS+HKIN F+  R+ E+ L V S ++A+    A+D
Sbjct  113  DGRDIAFGQYGSYWRDIRKLCTLNLLSSHKINQFRHTRKAELSLFVGSFRRAACQREALD  172

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGD-KGFKAVIHEAMSLAALPN  702
            +S  +  +S +M C  VFG+K+ D D+ + KGFK+VI E + L A+PN
Sbjct  173  VSKMITGLSWDMICMTVFGRKFADSDLDETKGFKSVIEEILQLVAIPN  220



>ref|XP_009372727.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P  DL +LA+ +G IM+LR G    ++VS+A AAE FLKTHDL FA+RPP++ AK++ + 
Sbjct  50   PTMDLRQLAQKYGDIMYLRLGLQHTVVVSTARAAELFLKTHDLNFASRPPNEGAKHLIFG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF EYG YW NMRKLC LELLSN KINSF+SMRREEV LL++S+++ + N    +L
Sbjct  110  QKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            + KV S+  +M+CRMVFGKKY+D++ G +G  +V+ E + LA  PN
Sbjct  170  TDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPN  215



>ref|XP_006428068.1| hypothetical protein CICLE_v10027567mg, partial [Citrus clementina]
 gb|ESR41308.1| hypothetical protein CICLE_v10027567mg, partial [Citrus clementina]
Length=430

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 121/166 (73%), Gaps = 1/166 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P + LH+LAK +GPIMHLR G +  I+VSS +AAE FLKTHDL+FA+RPP QA KY+SY 
Sbjct  33   PPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAE-FLKTHDLIFASRPPLQATKYISYQ  91

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN +   YG YWR +RKLCT  LL+N KIN FQ +R+EE+ LL+E  K+A+R    VD+
Sbjct  92   QKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDI  151

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAK++++SA M+CRMV GKK  D +  ++GF+ VI E   L   PN
Sbjct  152  SAKLSAVSANMTCRMVLGKKRSDDEFDERGFETVIQEDFELVGKPN  197



>ref|XP_006365792.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQ LH +AK HGPIM ++FG V  I+ SS  AAE FLK HD+ FA+RP + A +Y++Y
Sbjct  52   NLHQALHHIAKKHGPIMSMQFGLVPVIVASSPHAAELFLKKHDIAFASRPYNAAGQYIAY  111

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            + +++ F +YGP+WRNMRKLCT++LL+N KINSF+SMR++E+ + V SLKQA+ N   VD
Sbjct  112  DHRDIVFAKYGPHWRNMRKLCTIKLLTNIKINSFRSMRKQELGIFVNSLKQAASNHIEVD  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+AS+SA MSC MV GKKY +++  ++GFK ++ E + LAA PN
Sbjct  172  LSAKLASLSANMSCLMVLGKKYMEEEFDERGFKNIMEETVVLAASPN  218



>ref|XP_009372715.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 123/166 (74%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P  DL +LA+ +G IM+LR G    ++VSSA AAE FLKTHDL FA RPP++ AK++ + 
Sbjct  50   PTMDLRQLAQKYGDIMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPNEGAKHLIFG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QK+LSF EYG YW NMRKLC LELLSN KINSF+SMRREEV LL++S+++ + N    +L
Sbjct  110  QKSLSFAEYGSYWTNMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            + KV S+  +M+CRMVFGKKY+D++ G +G   V+ E + LA  PN
Sbjct  170  TDKVMSLGIDMTCRMVFGKKYKDEEFGGRGIVYVMKEGLKLAGAPN  215



>ref|XP_009770874.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=308

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK +GPIM +RFG V  I+ SS  AAE FLK HDL+FA+RP + A  Y+ Y
Sbjct  47   NLHQDLYKIAKKYGPIMTIRFGLVPTIVASSPHAAEHFLKNHDLIFASRPYNAACHYIFY  106

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+N+   +YGPYWRN RKLCTL+LLS+ K NSFQ MR++E+ +L+   K+A+ N   VD
Sbjct  107  NQRNVIMAKYGPYWRNKRKLCTLQLLSSVKFNSFQPMRKQELEILINFHKKAALNQDEVD  166

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SAKVA +SA M+C MVFGKKY + D  +KGFK VI E   +AA PN
Sbjct  167  ISAKVAYLSANMACLMVFGKKY-NIDEDNKGFKGVIQETSHIAARPN  212



>ref|XP_007214078.1| hypothetical protein PRUPE_ppa017849mg, partial [Prunus persica]
 gb|EMJ15277.1| hypothetical protein PRUPE_ppa017849mg, partial [Prunus persica]
Length=398

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++D+H LA+ +G IM++R G +  I++SS + AE FLKTHDL FA+ PPH+ AK++S+ 
Sbjct  29   PNKDIHRLAQKYGDIMYMRLGLIPTIVISSPKGAELFLKTHDLAFASSPPHEGAKHISFG  88

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            Q+NLSF EYGPYWR++RK+CTLE LSNHK NSF+SMRREEV + VE+++ A+ +G  AVD
Sbjct  89   QRNLSFAEYGPYWRDIRKMCTLEWLSNHKNNSFKSMRREEVAVCVEAIRAAANSGSIAVD  148

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAV  666
            LS   +S+S  MSCRMVFGKKY D +   +GF +V
Sbjct  149  LSDNASSLSVYMSCRMVFGKKYMDVEFDGRGFMSV  183



>ref|XP_006428066.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
 gb|ESR41306.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
Length=498

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P + LH+LAK +GPIMHLR G +  I+VSS +AAEQFLKTHDL+FA+RPP QA KYMSY 
Sbjct  52   PPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQATKYMSYQ  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN +   YG YWR +RK+CT  LLSN KIN FQ  R+E++ LL+E  K+A+     VD+
Sbjct  112  QKNFAMAPYGSYWRKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEAAHARCVVDI  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAK++++S  M+CRMV GKK  D +    GF+ VI E   L   PN
Sbjct  172  SAKLSALSTNMTCRMVLGKKRSDNEFDSGGFETVIREGFELVGKPN  217



>gb|EYU24035.1| hypothetical protein MIMGU_mgv1a020942mg [Erythranthe guttata]
Length=499

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 0/164 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDLH LA+ HGPIM  R GFV  ++VSS  AAE  LKTHD VFA+RP   A   +SY
Sbjct  50   NPHQDLHRLARKHGPIMGFRLGFVPAVVVSSPAAAELILKTHDAVFASRPKIIAVDSVSY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F  +GPYWRNMR+LCT ELL+  +I  FQ+ RR EV LLV SLK A+  G  VD
Sbjct  110  EQRNLVFAAHGPYWRNMRRLCTSELLNAARIAQFQAARRAEVRLLVTSLKSAAELGEIVD  169

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            LSA+V  +SA+M+C MVFG+KY+D D+G+ GFK+V  E   ++A
Sbjct  170  LSARVTGLSADMNCVMVFGRKYDDSDLGEMGFKSVFMETAEISA  213



>ref|XP_006493867.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Citrus sinensis]
 ref|XP_006493868.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Citrus sinensis]
Length=498

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 117/166 (70%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P + LH+LAK +GPIMHLR G +  I+VSS +AAEQFLKTHDL+FA+RPP QA KYMSY 
Sbjct  52   PPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQATKYMSYQ  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN +   YG YWR +RK+CT  LLSN KIN FQ  R+E++ LL+E  K+A+     VD+
Sbjct  112  QKNFAMAPYGSYWRKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEAAHARCVVDI  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SAK++++S  M+CRMV GKK  D +    GF+ VI E   L   PN
Sbjct  172  SAKLSALSTNMTCRMVLGKKRSDNEFDSGGFETVIREGFELVGKPN  217



>ref|XP_004237154.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=499

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDLH++AK +GPIM ++FG +  I+ SS  AAEQFLK HDL+FA+RP ++A + ++Y
Sbjct  51   NIHQDLHKIAKKYGPIMSMKFGVIPIIVASSPHAAEQFLKKHDLIFASRPNNRAMRIVAY  110

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            NQ+NL+F +YGPYWRN+RKLC LELLS  KI SFQ MR+++V   V  + +A+     VD
Sbjct  111  NQRNLTFAKYGPYWRNIRKLCMLELLSPIKIKSFQDMRKQQVTNFVTFINRAASCHDEVD  170

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +SA ++ +SA MSC M+FGKKY D +  ++GFK VI EA+ +AA PN
Sbjct  171  ISANLSLLSANMSCLMIFGKKYMDDEFNERGFKDVIQEALIIAATPN  217



>ref|XP_004153472.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
 gb|KGN48795.1| hypothetical protein Csa_6G501350 [Cucumis sativus]
Length=498

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH L++ +GPIMH++ G V  IIVSS  AA+ FLKTHD VFA+RP    +  M+Y 
Sbjct  50   PHRDLHRLSQKYGPIMHMKLGLVHTIIVSSPHAAKLFLKTHDHVFASRPLIHTSSIMTYG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            +K+L F  YG YWRN+RK+CTLEL S+ KINSF+SMR++EV  L+E LK AS +   V L
Sbjct  110  KKDLVFAPYGSYWRNIRKMCTLELFSSLKINSFKSMRKKEVRELIEYLKTASTDRMVVRL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S+KV S+ A+M+C M FGKKY D++ G++GFKAVI E M L   PN
Sbjct  170  SSKVTSLIADMTCLMAFGKKYRDEEFGERGFKAVIQEGMQLVIAPN  215



>gb|KDO59985.1| hypothetical protein CISIN_1g036759mg, partial [Citrus sinensis]
Length=176

 Score =   190 bits (483),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 115/153 (75%), Gaps = 1/153 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P + LH+LAK +GPIMHLR G +  I+VSS +AAE FLKTHDL+FA+RPP QA KY+SY 
Sbjct  25   PPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAE-FLKTHDLIFASRPPLQATKYISYQ  83

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN +   YG YWR +RKLCT  LL+N KIN FQ +R+EE+ LL+E  K+A+R    VD+
Sbjct  84   QKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDI  143

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKA  663
            SAK++++SA M+CRMV GKK  D +  ++GF+ 
Sbjct  144  SAKLSAVSANMTCRMVLGKKRSDDEFDERGFET  176



>ref|XP_004237617.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK HGPIM + FG +  I+ SS  AA+QFLK HD +FA+RP H A  Y+ Y
Sbjct  46   NLHQDLYKIAKKHGPIMTIYFGLIPTIVASSPYAAQQFLKDHDQIFASRPYHAACYYIFY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL  G+YGPYWR+MRKLCTL+LL+N KINSFQSMR++EV +LV  L +A+ N   VD
Sbjct  106  KQRNLIMGKYGPYWRHMRKLCTLQLLNNVKINSFQSMRKQEVQILVNFLIKAASNRDVVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+AS+SA M+C MV GKKY + D GD  FK +I +   +AA PN
Sbjct  166  LSAKLASLSANMACLMVIGKKYNNVD-GD--FKDMIQQTSHMAATPN  209



>ref|XP_004237435.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=500

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 128/172 (74%), Gaps = 5/172 (3%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQD ++LAK +GP MH++ G V  I+VSS    E+ LKT+D VFA+RP H+A++++ Y
Sbjct  49   NPHQDFYKLAKRYGPFMHIQLGLVPTIVVSSPNTIEKVLKTYDHVFASRPHHEASQHVCY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG---  552
             Q+NL F +YGPYWRNMRKL T+ L+S+ KINS+Q  R+EEV L+V+S+K  + +     
Sbjct  109  GQRNLIFSKYGPYWRNMRKLTTMNLVSSQKINSYQPSRKEEVSLMVKSIKHVADHNDQQH  168

Query  553  --AVDLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
              AVDLSAKV+S++A +SC MVFGKK+ D D+  +GFK+++ E + LAA PN
Sbjct  169  VVAVDLSAKVSSLNANLSCLMVFGKKFMDDDLDKRGFKSLVQEVVHLAATPN  220



>ref|XP_007221131.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
 gb|EMJ22330.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
Length=494

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 126/167 (75%), Gaps = 2/167 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++DLH LA+ +G IM++R G +  I+VSS +AAE FLKTHDLVFA+RPPH+ A+++S+ 
Sbjct  48   PNKDLHRLAQKYGDIMYMRLGLMHTIVVSSPQAAELFLKTHDLVFASRPPHEGAEHISFG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG-AVD  561
            Q +L F EYG YWR+MRK+CTLELLSNHKINSF+SMRR+ + L VES++  + NG  AVD
Sbjct  108  Q-SLVFSEYGAYWRDMRKMCTLELLSNHKINSFKSMRRDAIALCVESIRATADNGRVAVD  166

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS  V+S+S  +SCRMV GK Y D++   +G ++VI E + L    N
Sbjct  167  LSDNVSSLSEVISCRMVLGKMYRDEEFDARGIRSVIKEGIQLIVAAN  213



>ref|XP_009629564.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=431

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +1

Query  250  MHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRN  429
            M+++ G V  I+ SSA+AAE+ LKT+D +FA+RP ++A++YMSY QKN+ F +YGPYWRN
Sbjct  1    MYIQLGLVPAIVASSADAAEKVLKTYDHIFASRPHNEASQYMSYGQKNMIFAKYGPYWRN  60

Query  430  MRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVASMSAEMSCRM  609
            MRKLC + LLSNHKINSFQSMR++EV LL+ESLK+ + +   VDLSAKV S++A ++C M
Sbjct  61   MRKLCIVHLLSNHKINSFQSMRKQEVELLIESLKEQAHDRAVVDLSAKVTSLNASLTCLM  120

Query  610  VFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            VFGKKY D+D   +GFKAV+ E +     PN
Sbjct  121  VFGKKYMDEDFDKRGFKAVVQEVVHFGGRPN  151



>ref|XP_006348217.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
 ref|XP_006354706.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=492

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 124/167 (74%), Gaps = 3/167 (2%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++AK +GPIM + FG V  II SS  AA+QFLK HD +FA+RP H A  Y+ Y
Sbjct  46   NLHQDLYKIAKKYGPIMTIYFGLVPTIIASSPHAAQQFLKNHDQIFASRPYHAACYYIFY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL  G+YGPYWR+MRKLCT +LLSN KINSFQSMR++E+ +LV  L++A+ N   VD
Sbjct  106  KQRNLIMGKYGPYWRHMRKLCTQQLLSNVKINSFQSMRKQELQILVNFLEKAASNRDVVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAK+AS+SA M+C MV GKKY + D GD  FK ++ E   +AA PN
Sbjct  166  LSAKLASLSANMACLMVIGKKYNNVD-GD--FKDMVKETSRMAATPN  209



>ref|XP_006354701.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=496

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 128/171 (75%), Gaps = 4/171 (2%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQD ++LAK +GP MHL+ G V  I+VSS +  E+ LKT+D VFA+RP H+A++++ Y
Sbjct  46   NPHQDFYKLAKKYGPFMHLQLGLVPTIVVSSPKTIEKVLKTYDHVFASRPHHEASQHVCY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGG---  552
             Q+NL F +YG YWRNMRKL T+ L+S+ KINS+Q  R+EEV LLV+S+K  + +     
Sbjct  106  GQRNLIFSKYGSYWRNMRKLTTMNLVSSQKINSYQPSRKEEVSLLVKSIKHVADHDQEHV  165

Query  553  -AVDLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
             AVDLSAKV+S++A +SC MVFGKK+ D+D+  +GFK ++ E + LAA PN
Sbjct  166  VAVDLSAKVSSLNANLSCLMVFGKKFMDEDLDKRGFKYLVQEVVHLAATPN  216



>ref|XP_006365796.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=482

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQ LH +AK HGPIM ++FG V  I+ SS  AAE FLK HD+ FA RP + AA+Y++Y
Sbjct  52   NLHQALHHIAKKHGPIMSMQFGLVPVIVASSPHAAELFLKKHDIAFANRPYNAAAQYIAY  111

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            + +++ F +YGP+WRNMRKLC ++LLSN KINSF+SMR++E+ + V  LKQA+ N   VD
Sbjct  112  DHRDIVFAKYGPHWRNMRKLCKMKLLSNIKINSFRSMRKQELGIFVNFLKQAASNRVEVD  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSA +AS+  +MSC MVFGKKY +++  ++GFK + +EA  L A PN
Sbjct  172  LSADLASLIVDMSCLMVFGKKYMEEEFDERGFKNIFYEASFLVASPN  218



>gb|KDO59987.1| hypothetical protein CISIN_1g025878mg [Citrus sinensis]
Length=247

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = +1

Query  250  MHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRN  429
            MHLR G +  I+VSS +AAEQFLKTHDL+FA+RPP QA+KYMSY QKN +   YG YWR 
Sbjct  1    MHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQASKYMSYQQKNFAMAPYGSYWRK  60

Query  430  MRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVASMSAEMSCRM  609
            +RK+CT  LLSN KIN FQ +R+EE+ LL++  K+A+R    VD+SAK++++SA M+CRM
Sbjct  61   VRKICTQNLLSNAKINYFQPIRKEELDLLIDYFKEAARARCVVDISAKLSALSANMTCRM  120

Query  610  VFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            V GKK  D +  ++GF+ V+ E M L   PN
Sbjct  121  VLGKKCSDYEFDERGFENVVQEGMELIGKPN  151



>ref|XP_006365795.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQ LH +AK HGPIM ++FG V  I+ SS  AAE FLK HD+ FA RP + AA+Y++Y
Sbjct  52   NLHQALHHIAKKHGPIMSMQFGLVPVIVASSPHAAELFLKKHDIAFANRPYNAAAQYIAY  111

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            + +++ F +YGP+WRNMRKLC ++LLSN KINSF+SMR++E+ + V  LKQA+ N   VD
Sbjct  112  DHRDIVFAKYGPHWRNMRKLCKMKLLSNIKINSFRSMRKQELGIFVNFLKQAASNRVEVD  171

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSA +AS+  +MSC MVFGKKY +++  ++GFK + +EA  L A PN
Sbjct  172  LSADLASLIVDMSCLMVFGKKYMEEEFDERGFKNIFYEASFLVASPN  218



>emb|CDP01385.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 114/167 (68%), Gaps = 26/167 (16%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LAK HGPIM+LRFG V  I+VSS EAAE                        
Sbjct  52   NPHQDLAKLAKKHGPIMYLRFGCVPEIVVSSPEAAE------------------------  87

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              KNL+FG+YGPYWRNMRKLC L+LLS+HKINSF+ MR+EEV  LV+SLKQA+ +G AVD
Sbjct  88   --KNLTFGQYGPYWRNMRKLCILQLLSSHKINSFRPMRKEEVGTLVKSLKQATSDGAAVD  145

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS   +S+ A MSC M+FG++Y DKD  D+GF  VI EA+ + + PN
Sbjct  146  LSGLTSSLGANMSCLMIFGQRYMDKDFDDRGFGEVIQEALHVGSTPN  192



>ref|XP_006354723.1| PREDICTED: cytochrome P450 71A2-like [Solanum tuberosum]
Length=429

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N   DLH+ +  +GPI++++FG V   ++SS E+AE+ LKT+D +FA+RP ++ A+Y+SY
Sbjct  49   NLTHDLHKFSLKYGPIIYMKFGLVPTYVISSPESAEKILKTYDHIFASRPHNETAQYISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGA-V  558
             Q+NL F +YG YWRNMRKLCT+ LLSN KINSFQS R EE+ ++++S+K+ ++     V
Sbjct  109  GQRNLIFSKYGAYWRNMRKLCTVHLLSNMKINSFQSTRSEEIAIMIKSIKEIAQGRRVDV  168

Query  559  DLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            DLSA+V+ +SA +SC MVFGKK+ D D+  +GFK ++ E  +LAA PN
Sbjct  169  DLSAQVSKLSANLSCLMVFGKKFTDDDLDKRGFKYLVQEVTTLAATPN  216



>ref|XP_006354704.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=497

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N   DLH+ +  +GPI++++FG V   ++SS E+AE+ LKT+D +FA+RP ++ A+Y+SY
Sbjct  49   NLTHDLHKFSLKYGPIIYMKFGLVPTYVISSPESAEKILKTYDHIFASRPHNETAQYISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGA-V  558
             Q+NL F +YG YWRNMRKLCT+ LLSN KINSFQS R EE+ ++++S+K+ ++     V
Sbjct  109  GQRNLIFSKYGAYWRNMRKLCTVHLLSNMKINSFQSTRSEEIAIMIKSIKEIAQGRRVDV  168

Query  559  DLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            DLSA+V+ +SA +SC MVFGKK+ D D+  +GFK ++ E  +LAA PN
Sbjct  169  DLSAQVSKLSANLSCLMVFGKKFTDDDLDKRGFKYLVQEVTTLAATPN  216



>emb|CDP12931.1| unnamed protein product [Coffea canephora]
Length=980

 Score =   196 bits (498),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 122/167 (73%), Gaps = 22/167 (13%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDL +LA+ HGPIM++RFG+V  IIVSS EAAE+FLKT+D VFA+RP H+A+ Y++Y
Sbjct  328  NPHQDLEKLARKHGPIMYMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHEASWYIAY  387

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL+FG+YGPYWRNM                      +EV  LV+SLKQA+ +G +VD
Sbjct  388  EQRNLTFGQYGPYWRNM----------------------QEVGKLVKSLKQAASDGASVD  425

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSA ++S+ A MSC M+FGK+Y DKD  D+GF+ VI E++ +AALPN
Sbjct  426  LSAAISSLGANMSCLMIFGKRYMDKDFDDRGFREVIQESLHVAALPN  472


 Score =   171 bits (433),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 113/151 (75%), Gaps = 2/151 (1%)
 Frame = +1

Query  256  LRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRNMR  435
            +RFG+V  IIVSS EAAE+FLKT D VFA+RP H+ + Y+++  +N +FG+YG +WRNMR
Sbjct  8    MRFGYVPAIIVSSPEAAEKFLKTSDQVFASRPHHEGSWYIAHELRNSTFGQYGTFWRNMR  67

Query  436  KLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVASMSAEMSCRMVF  615
            KLC L LLSN+KI  F  MR  E+ +LV+SLKQA+ +G AV+LSA ++S+ A M+C M+F
Sbjct  68   KLCILRLLSNYKIKLFLPMRIGEIGILVKSLKQAAFHGAAVNLSAAISSLGANMNCLMIF  127

Query  616  GKKYEDK--DIGDKGFKAVIHEAMSLAALPN  702
            GK   DK  D  D+GF+ VI EA+ +AA+ N
Sbjct  128  GKMCMDKDFDFDDRGFREVIEEALHVAAMAN  158


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            A+VA+++A MSC MVFGKKY +K+  ++GFKAV+ EAM LAA PN
Sbjct  649  AEVAALNANMSCLMVFGKKYAEKEFDERGFKAVMKEAMQLAATPN  693



>ref|XP_008440669.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Cucumis melo]
Length=287

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +1

Query  220  HELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLS  399
            H L + +G IMH++ G V+ I++SS+EAAE FLKTHDL FA  PP+ A K++S+ Q +L 
Sbjct  30   HRLFQKYGAIMHIKLGLVNTIVLSSSEAAELFLKTHDLDFANHPPNDAFKHISFGQSSLV  89

Query  400  FGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVA  579
              +YGPY RN+RK+CT+ELL++HK+NSF+SMR EEV L +E L++A+R+G  V+L++K++
Sbjct  90   VAKYGPYVRNVRKMCTVELLNSHKLNSFKSMRMEEVGLFIEELREAARSGLLVNLTSKLS  149

Query  580  SMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            S+SA M C  VFG+KYEDK++ +KGFK ++ E   L
Sbjct  150  SLSANMICLTVFGRKYEDKELDEKGFKRMVRETFKL  185



>gb|KGN49698.1| hypothetical protein Csa_5G075690 [Cucumis sativus]
Length=331

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH+L++ +GPIMH++ G +  IIVSS  AAE FLKT+D VFA+RP   A+ Y+ Y 
Sbjct  48   PHRDLHKLSQKYGPIMHIKLGIIPTIIVSSPNAAELFLKTYDHVFASRPHTNASNYLFYG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN  F +YG YWRNMRK+CT ELLSN K+ +F+ MR  EV LLVE+LK+A+R    V+L
Sbjct  108  QKNFGFSKYGSYWRNMRKMCTHELLSNQKVTTFEPMRSNEVGLLVENLKEAARTQVVVNL  167

Query  565  SAKVASMSAEMSCRMVFGKKY--EDKDIGDKGFKAVIHEAMSLAALPN  702
            S+KV  +  +M+C MVFGKK+  E+  + +K F   + E + L A PN
Sbjct  168  SSKVLCVVRDMTCLMVFGKKFVEEEMIMDEKSFHDAVKEVVQLVATPN  215



>gb|AJD25258.1| cytochrome P450 CYP736A123 [Salvia miltiorrhiza]
Length=488

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH DL  LA+ HGPIM LR GFV  ++VSS  AAE  LKTHDLVFA+RP   A+  MSY
Sbjct  45   NPHVDLCRLARKHGPIMGLRLGFVRAVVVSSPAAAELVLKTHDLVFASRPRSDASCRMSY  104

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            +Q+NL+F  YGPYWRNMRKLCTL+LLS  K+  F+ MR+ E+ LLV SLKQ SR+   VD
Sbjct  105  DQRNLAFAPYGPYWRNMRKLCTLQLLSASKMKQFEPMRKAELGLLVASLKQ-SRD--TVD  161

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDK-GFKAVIHEAMSLAA  693
            L A++++++ +M+C M+ G+KY D+D+ ++ GFKA+  EA+ + A
Sbjct  162  LRARISAVNGDMNCLMILGRKYSDRDLDEQDGFKALFSEALDITA  206



>ref|XP_004142333.2| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=497

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH+L++ +GPIMH++ G +  IIVSS  AAE FLKT+D VFA+RP   A+ Y+ Y 
Sbjct  48   PHRDLHKLSQKYGPIMHIKLGIIPTIIVSSPNAAELFLKTYDHVFASRPHTNASNYLFYG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN  F +YG YWRNMRK+CT ELLSN K+ +F+ MR  EV LLVE+LK+A+R    V+L
Sbjct  108  QKNFGFSKYGSYWRNMRKMCTHELLSNQKVTTFEPMRSNEVGLLVENLKEAARTQVVVNL  167

Query  565  SAKVASMSAEMSCRMVFGKKY--EDKDIGDKGFKAVIHEAMSLAALPN  702
            S+KV  +  +M+C MVFGKK+  E+  + +K F   + E + L A PN
Sbjct  168  SSKVLCVVRDMTCLMVFGKKFVEEEMIMDEKSFHDAVKEVVQLVATPN  215



>gb|KGN56080.1| hypothetical protein Csa_3G067750 [Cucumis sativus]
Length=302

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            H+DLH+L++T+GPIMH++ G    I+VSS  AA+ FLKTHD +FA RP  Q +  MSY+ 
Sbjct  51   HRDLHKLSQTYGPIMHMKLGLQSTIVVSSPNAAKLFLKTHDPIFANRPVPQTSNQMSYDH  110

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
            KN++F ++GPYW++MRK+C+  LL++ K+NSF S+RR+E+ LL+  LK+A+RN   VDLS
Sbjct  111  KNIAFVQFGPYWQSMRKICSSHLLTSSKVNSFSSIRRQELGLLIHHLKEAARNHAIVDLS  170

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +K++S++ ++ C M+FGKK+ DK++      A I E  SL+  PN
Sbjct  171  SKISSLTFDVICVMLFGKKFVDKEL-----TAAIREGTSLSGAPN  210



>ref|XP_008460602.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=528

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+DLH L++ +GPIMH++ G +  IIVSS  AAE FL+T+D VFA+RP   A+ Y+ Y 
Sbjct  77   PHRDLHTLSQKYGPIMHIKLGIIPTIIVSSPNAAELFLRTYDHVFASRPQTYASNYLFYG  136

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            QKN  F +YG YWRNMRK+CT ELLSN K++ F+ +RR +V LLVE+LK+A+R   AV+L
Sbjct  137  QKNFGFSKYGSYWRNMRKMCTHELLSNQKVSMFEPIRRNQVGLLVENLKEAARTQVAVNL  196

Query  565  SAKVASMSAEMSCRMVFGKKY-EDKD--IGDKGFKAVIHEAMSLAALPN  702
            S+KV  +  +M+C MVFGKKY ED++  + +K F   + E + L A PN
Sbjct  197  SSKVLCVVRDMTCLMVFGKKYVEDQEMIMDEKSFHDAVKEVVQLVATPN  245



>ref|XP_004253509.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=493

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 122/167 (73%), Gaps = 3/167 (2%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N  QDLH+ +  +G I++++FG V   ++SS ++AE+ LKT+D +FA+RP ++ A+Y+SY
Sbjct  49   NLTQDLHKFSLKYGAIIYMKFGLVPTYVISSPQSAEKILKTYDHIFASRPHNETAQYISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             Q+NL F +YG YWRNMRKLCT+ LLSN KI+SFQS R EE+ L+++ + Q       VD
Sbjct  109  GQRNLIFSKYGAYWRNMRKLCTVHLLSNMKIHSFQSTRSEEIALMIKEIAQGHVE---VD  165

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSA+V+ +SA +SC MVFGKK+ D D+  +GFK ++ E  +LAA PN
Sbjct  166  LSAQVSKLSANLSCLMVFGKKFTDDDLDKRGFKYLVQEVTTLAATPN  212



>ref|XP_006354705.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=504

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N  QDLH+ +  +GPI++++FG V   ++SS ++AE+ LKT+D +FA+RP  + ++Y+SY
Sbjct  49   NLTQDLHKFSLKYGPIIYMKFGLVPTYVISSPQSAEKILKTYDHIFASRPHSETSQYISY  108

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGA--  555
             Q+NL F ++G YWRNMRKLCT+ LLSN KINSFQS R EE+ ++++S+K+ ++  G   
Sbjct  109  GQRNLIFSKHGAYWRNMRKLCTVHLLSNMKINSFQSTRSEEIDIMIKSIKEIAQGQGQSQ  168

Query  556  ------VDLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
                  VDLSA+V+ ++A +SC MVFGKK+ D+D+  +GFK ++ E  +LAA PN
Sbjct  169  GQGHVEVDLSAQVSKLTANLSCLMVFGKKFTDEDLDKRGFKYLVQEVTTLAATPN  223



>ref|XP_009631583.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=189

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  304  AEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSF  483
            AE+FLKT+D +FA RP H+A++Y+ Y QKNL+F +YG YWRNMRKLCT+ LL++HK+NSF
Sbjct  47   AEKFLKTYDHIFAGRPHHEASQYLDYGQKNLTFAKYGAYWRNMRKLCTVHLLNSHKMNSF  106

Query  484  QSMRREEVCLLVESLKQASRNGGAVDLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKA  663
            +SMR++EV LL+ESLK+ + +  AVDLSAK+ S++A ++C MVFG KY D+D+  +GFKA
Sbjct  107  RSMRKQEVELLIESLKEQAHDCVAVDLSAKITSLNANLTCLMVFGNKYMDEDLDKRGFKA  166

Query  664  VIHEAMSLAALPN  702
            V+ + + LA  PN
Sbjct  167  VVQDVVHLAGTPN  179



>ref|XP_011658488.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=500

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+D H L+K +G IMH++ G V+ I+VSS+EAAE FLKTHDL FA  PP+ A K++S+ 
Sbjct  54   PHRDFHRLSKKYGAIMHIKLGLVNTIVVSSSEAAELFLKTHDLDFANHPPNDALKHISFG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q ++   + GPY R++RK+CT +LL++HK+NSF+SMR EEV L ++ L++A+R+G  V+L
Sbjct  114  QSSMVVAKDGPYVRSVRKMCTQKLLNSHKLNSFKSMRMEEVGLFIQELREAARSGLLVNL  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            ++K++S+ A M C  VFG+KY+DK++  KGFK ++ EA+ +    N
Sbjct  174  TSKLSSLGANMICLTVFGRKYKDKELDAKGFKRMVGEALKVIGAVN  219



>ref|XP_011652733.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=495

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            H+DLH+L++T+GPIMH++ G    I+VSS  AA+ FLKTHD +FA RP  Q +  MSY+ 
Sbjct  51   HRDLHKLSQTYGPIMHMKLGLQSTIVVSSPNAAKLFLKTHDPIFANRPVPQTSNQMSYDH  110

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
            KN++F ++GPYW++MRK+C+  LL++ K+NSF S+RR+E+ LL+  LK+A+RN   VDLS
Sbjct  111  KNIAFVQFGPYWQSMRKICSSHLLTSSKVNSFSSIRRQELGLLIHHLKEAARNHAIVDLS  170

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            +K++S++ ++ C M+FGKK+ DK++      A I E  SL+  PN
Sbjct  171  SKISSLTFDVICVMLFGKKFVDKEL-----TAAIREGTSLSGAPN  210



>ref|XP_002275714.2| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 119/163 (73%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++L  LAK +GPIM++R G V  +IVSSA+A + FLKTHD+VFA+RP  QA ++++Y 
Sbjct  53   PHRNLTRLAKKYGPIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKLQAFEHLTYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWRN+RKLCT+ELL+  KINSF S+R+EEV +LV+SLK+ +  G  VD+
Sbjct  113  TKGIAFSEYGPYWRNVRKLCTVELLNTAKINSFASVRKEEVGMLVQSLKEMAAAGEVVDI  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KVA +  ++S RMVFG+   +KD G    K ++ E   LA 
Sbjct  173  STKVAQVVEDISYRMVFGR---NKD-GMIDLKTLVREGTRLAG  211



>gb|EYU31075.1| hypothetical protein MIMGU_mgv1a005090mg [Erythranthe guttata]
Length=497

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 116/168 (69%), Gaps = 1/168 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDLH LA+ HGPIM+LRFGFV  ++ SS   AE  LKTHDLVFA RP  QAAK++SY
Sbjct  48   NPHQDLHRLAQKHGPIMYLRFGFVPTVVFSSPAGAELVLKTHDLVFAGRPSIQAAKHISY  107

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            + +N+ F +YG YWR+MRKL T+ LLS+ KI+ FQ +R+ E+ L V+SL++A+     VD
Sbjct  108  DGRNIVFAQYGSYWRDMRKLATINLLSSSKISQFQPVRKAELRLAVDSLRRAAAGRETVD  167

Query  562  LSAKVASMSAEMSCRMVFGKKY-EDKDIGDKGFKAVIHEAMSLAALPN  702
            +S  +     +M C MVFG+K+      G  GFK+VI E   +AA PN
Sbjct  168  VSEMIMGTIGDMVCLMVFGRKFAGGGLGGSGGFKSVIDETFQVAAKPN  215



>ref|XP_010094782.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB56947.1| Cytochrome P450 71A1 [Morus notabilis]
Length=507

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 114/163 (70%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM LR G V  ++VSS EAAE FLKT D  FA+RP  Q+++YMSY 
Sbjct  53   PHRGLQSLSKKYGPIMSLRLGQVPAVVVSSPEAAELFLKTFDTTFASRPRVQSSEYMSYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWRN+RKLCTL+LLS  KI SF ++RRE+V  +VESL+ ++     VD+
Sbjct  113  TKGMAFTEYGPYWRNVRKLCTLQLLSALKIESFAALRREDVASVVESLRASAAAREVVDI  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S K+  + A+MSCRM+ G   ED++      K ++HEAM L+ 
Sbjct  173  SRKIGELIADMSCRMILGISLEDRN----HLKELVHEAMFLSG  211



>ref|XP_009791748.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=237

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 114/167 (68%), Gaps = 18/167 (11%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            N HQDL+++A  +GPIM +RFG V  I+ SS  AAEQFLKTHDLVFA+RP ++  +YM Y
Sbjct  50   NLHQDLYKIANKYGPIMTIRFGLVPIIVASSPHAAEQFLKTHDLVFASRPYNEVPQYMFY  109

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
             ++NL   +                LSN KI+ F  MR++E+ +LV  LKQA+  G  +D
Sbjct  110  ERRNLVSAK----------------LSNAKIHQFHPMRKQELGILVNFLKQAACEGTVID  153

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LSAKVAS+SA MSC M+FGKKY D+D+GDKGFKA+  +   LAALPN
Sbjct  154  LSAKVASLSANMSCLMIFGKKYMDEDLGDKGFKALTQDI--LAALPN  198



>ref|XP_009337244.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 115/168 (68%), Gaps = 6/168 (4%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            +PH  L  LAK +GPIM +R G V  I+VSS +AAE FLKTHD VF++RP  QA++Y+SY
Sbjct  67   HPHHSLQHLAKKYGPIMSIRLGLVPTIVVSSPQAAELFLKTHDTVFSSRPKLQASEYISY  126

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              K ++F EYGPYWR++RKLCT++LL   KI  F  +RREEV LLV+SLK+A+  G  V+
Sbjct  127  GAKGIAFTEYGPYWRHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVN  186

Query  562  LSAKVASMSAEMSCRMVFGKKYEDK-DIGDKGFKAVIHEAMSLAALPN  702
            LS KV  +  +++ RMV G K +D  DI     K +I E MS+ A  N
Sbjct  187  LSEKVGELVEDITYRMVLGSKSDDMFDI-----KTIIREVMSVLAFFN  229



>ref|XP_009337218.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 115/168 (68%), Gaps = 6/168 (4%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            +PH  L  LAK +GPIM +R G V  I+VSS +AAE FLKTHD VF++RP  QA++Y+SY
Sbjct  67   HPHHSLQHLAKKYGPIMSIRLGLVPTIVVSSPQAAELFLKTHDTVFSSRPKLQASEYISY  126

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              K ++F EYGPYWR++RKLCT++LL   KI  F  +RREEV LLV+SLK+A+  G  V+
Sbjct  127  GAKGIAFTEYGPYWRHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVN  186

Query  562  LSAKVASMSAEMSCRMVFGKKYEDK-DIGDKGFKAVIHEAMSLAALPN  702
            LS KV  +  +++ RMV G K +D  DI     K +I E MS+ A  N
Sbjct  187  LSEKVGELVEDITYRMVLGSKSDDMFDI-----KTIIREVMSVLAFFN  229



>ref|XP_008393300.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=523

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 115/168 (68%), Gaps = 6/168 (4%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            +PH  L  LAK +GPIM +R G V  I+VSS +AAE FLKTHD VF +RP  QAA+Y+SY
Sbjct  67   HPHHSLQHLAKKYGPIMSIRLGLVPTIVVSSPKAAELFLKTHDTVFCSRPKLQAAEYISY  126

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              + ++F EYGPYWR++RKLCT++LL   KI  F  +RREEV LLV+SLK+A+  G  V+
Sbjct  127  GIRGIAFTEYGPYWRHIRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVN  186

Query  562  LSAKVASMSAEMSCRMVFGKKYEDK-DIGDKGFKAVIHEAMSLAALPN  702
            LS KV  +  +++ RMV G K +D  DI     K +I + MS+ AL N
Sbjct  187  LSEKVGELVEDITYRMVLGSKSDDMFDI-----KTIIRDVMSVLALFN  229



>ref|XP_011652735.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]
Length=495

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            H+DLH+L++T+GPIMH++ G    I+VSS  AA+ FLKTHD +FA RP  Q +  +SYN 
Sbjct  51   HRDLHKLSQTYGPIMHMKLGLQSTIVVSSPNAAKLFLKTHDPIFANRPISQTSNQLSYNH  110

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
            KN+++ ++GPYW+ MRK+C+ +LL++ KINSF S+R +E+   ++ L++A++N   VDLS
Sbjct  111  KNIAYAQFGPYWQTMRKICSFQLLTSSKINSFTSIRMQELGFFIDRLQEAAKNHVIVDLS  170

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
             +V+S+ A++ C M+FGKK+ DK+     F   IHE   LA   N
Sbjct  171  YQVSSLIADVICIMLFGKKFTDKE-----FMVAIHEGTFLAGASN  210



>dbj|BAD15331.1| cytochrome P450 [Panax ginseng]
Length=500

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G V  I+VSS +AAE FLKTHD +FA+RP  QAA+YMSY 
Sbjct  53   PHRTLQTLAKKYGPIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRPKLQAAEYMSYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K +SF  YGP+WRN+RK   LELL+  KINSF  MRREE+ ++V+S+K+AS     VDL
Sbjct  113  TKGMSFTAYGPHWRNIRKFVVLELLTPAKINSFVGMRREELGMVVKSIKEASAANEVVDL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            SAKVA++   M+ R++ G+  +D+       K +++EA++LA 
Sbjct  173  SAKVANIIENMTYRLLLGRTKDDR----YDLKGIMNEALTLAG  211



>gb|EYU31074.1| hypothetical protein MIMGU_mgv1a005121mg [Erythranthe guttata]
Length=496

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 114/169 (67%), Gaps = 2/169 (1%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPHQDLH LA+ HGPIM+LRFGFV  ++ SS   AE  LKTHDLVFA R  +QAAK++SY
Sbjct  46   NPHQDLHRLAQKHGPIMYLRFGFVPTVVFSSPAGAELVLKTHDLVFAGRASNQAAKHISY  105

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
            + +N+ F +YG YWR+MRKL TL LLS  K++ FQ +R+ E+ L V+SL++A+     VD
Sbjct  106  DGRNIVFAQYGSYWRDMRKLATLNLLSTSKVSQFQPVRKAELRLAVDSLRRAAAGRETVD  165

Query  562  LSAKVASMSAEMSCRMVFGKKY--EDKDIGDKGFKAVIHEAMSLAALPN  702
            +S  +     +M C MVFG+K+   +      GFK VI E   +AA PN
Sbjct  166  VSEMIMGTIGDMVCLMVFGRKFAGGELGGSGGGFKYVIDETFQVAAKPN  214



>ref|XP_008385725.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=510

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            +PH  L  LAK +GPIM +R G V  I+VSS +AAE FLKTHD VF++RP  QA++Y+SY
Sbjct  54   HPHHTLQHLAKQYGPIMSMRLGLVPTIVVSSPKAAELFLKTHDTVFSSRPKLQASEYISY  113

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              K ++F EYGPYWR++RKLCT++LL   KI  F  +RREEV LLV+SLK+A   G  V+
Sbjct  114  GAKGIAFTEYGPYWRHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAXEAGEVVN  173

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV  +  +++ RMV G K +D        K +I + MS+ AL N
Sbjct  174  LSEKVGELVEDITYRMVLGSKSDDM----FDJKTIIRDVMSVLALFN  216



>ref|XP_002275826.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=506

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 115/163 (71%), Gaps = 3/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++L  LA+ +GPIM +R G+V  I+VSS EAAE FLKTHD VFA+RP  QA++Y+ Y 
Sbjct  53   PHRNLSRLARKYGPIMSMRLGYVPTIVVSSPEAAELFLKTHDAVFASRPKIQASEYLCYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            +K ++F EYGPYWRN RKLCTLELL+  KI+SF +MR+EE+ +LV+SLKQ +     V++
Sbjct  113  RKGMAFTEYGPYWRNARKLCTLELLTKVKIDSFAAMRKEELGVLVQSLKQMAAAREVVNI  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +  +M+ RM+FG+    KD      KA++ E + L  
Sbjct  173  SKKVGELIEDMTHRMLFGRC---KDYQRADLKALVQETLILVG  212



>ref|XP_009339381.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=201

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            H+ L  LAK +GPIM +R G    I++SS +AAE FLKTHD +FA+RP  QA+KYMSY  
Sbjct  56   HRSLQNLAKKYGPIMSMRLGSKTTIVISSPKAAELFLKTHDTIFASRPQLQASKYMSYGT  115

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
            K ++F EYGPYW ++RKLCTL+LLS  +I +F  +RREEV LLV+SLK A+  G  VDLS
Sbjct  116  KAMAFSEYGPYWCHVRKLCTLQLLSPSRIEAFAPLRREEVGLLVQSLKVAAEAGEVVDLS  175

Query  568  AKVASMSAEMSCRMVFGKKYED  633
             KV  +   ++ RM+ G+K  D
Sbjct  176  EKVGELVVGITYRMLLGRKNND  197



>gb|KDP20096.1| hypothetical protein JCGZ_05865 [Jatropha curcas]
Length=510

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ L+ LAK HGPIM LR G+V  I+VSSA AA+ FLKTHD VF +RP  +A++YMSY 
Sbjct  60   PHQTLYNLAKLHGPIMSLRLGYVQTIVVSSANAAKLFLKTHDAVFGSRPKLRASRYMSYG  119

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCT++LLS  KI  F  +R+EE+   VESLK+A+     VD 
Sbjct  120  TKGMAFTEYGPYWRSVRKLCTVQLLSASKIEYFAPIRKEELGFYVESLKRAAAARKVVDF  179

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S  V  M   ++CRMVFG+        +   KA++ EA+ LA 
Sbjct  180  SVGVGDMIQNIACRMVFGEVNNH----ELDLKALVKEALLLAG  218



>emb|CAN69566.1| hypothetical protein VITISV_033535 [Vitis vinifera]
Length=1390

 Score =   176 bits (445),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 120/166 (72%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++L  LAK +GPIM++R G V  +IVSSA+A + FLKTHD+VFA+RP  QA ++++Y 
Sbjct  53   PHRNLTRLAKKYGPIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKLQAFEHLTYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWRN+RKLCT+ELL+  KINSF S+R+EEV +LV+SLK+ +  G  VD+
Sbjct  113  TKGIAFSEYGPYWRNVRKLCTVELLNTAKINSFASVRKEEVGMLVQSLKEMAAAGEVVDI  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S KVA +  ++S RMVFG+   +KD G    K ++ E   LA   N
Sbjct  173  STKVAQVVEDISYRMVFGR---NKD-GMIDLKTLVREGTRLAGTFN  214



>ref|XP_012092981.1| PREDICTED: cytochrome P450 CYP736A12-like [Jatropha curcas]
Length=540

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ L+ LAK HGPIM LR G+V  I+VSSA AA+ FLKTHD VF +RP  +A++YMSY 
Sbjct  90   PHQTLYNLAKLHGPIMSLRLGYVQTIVVSSANAAKLFLKTHDAVFGSRPKLRASRYMSYG  149

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCT++LLS  KI  F  +R+EE+   VESLK+A+     VD 
Sbjct  150  TKGMAFTEYGPYWRSVRKLCTVQLLSASKIEYFAPIRKEELGFYVESLKRAAAARKVVDF  209

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S  V  M   ++CRMVFG+        +   KA++ EA+ LA 
Sbjct  210  SVGVGDMIQNIACRMVFGEVNNH----ELDLKALVKEALLLAG  248



>ref|XP_004253368.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Solanum lycopersicum]
Length=176

 Score =   162 bits (409),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 98/124 (79%), Gaps = 2/124 (2%)
 Frame = +1

Query  331  LVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVC  510
            ++FA+RP ++AA+Y++Y QKNL   +YGPYWRNMRKLCT  LLSN KINSFQSMRRE+V 
Sbjct  2    IIFASRPHNEAAQYLAYGQKNLIAAKYGPYWRNMRKLCTQHLLSNQKINSFQSMRREQVE  61

Query  511  LLVESLKQASRNGGAVDLSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLA  690
            L+++SLK   R    VDLSAK++S+SA+++C MVFGKKY D+D+  +GFKAV+     LA
Sbjct  62   LMIKSLKNDDR--VVVDLSAKISSLSADLTCLMVFGKKYMDEDLDKRGFKAVVKNVEHLA  119

Query  691  ALPN  702
            A PN
Sbjct  120  ATPN  123



>ref|XP_008374738.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=529

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R GF+  I+VSS +AA+ FLKTHD +FA+RP  QA +YM+Y 
Sbjct  75   PHRSLQNLAKKYGPIMSMRLGFIPTIVVSSPKAAKLFLKTHDTIFASRPKLQAFEYMAYG  134

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+LL   KI  F  +RREEV LLV+SLK A+  G  VD 
Sbjct  135  SKVMAFIEYGPYWRHIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEGGEVVDF  194

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +   ++ RMV G+K  + D+ D   K +I EA+ L  
Sbjct  195  SEKVGELVEGITYRMVLGRK--NDDMFD--LKGIIEEALFLTG  233



>sp|H2DH18.1|C7A12_PANGI RecName: Full=Cytochrome P450 CYP736A12 [Panax ginseng]
 gb|AEY75215.1| cytochrome P450 CYP736A12 [Panax ginseng]
Length=500

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 113/163 (69%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G V  I+VSS +AAE FLKTHD +FA+RP  QAA+YMSY 
Sbjct  53   PHRTLQTLAKKYGPIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRPKLQAAEYMSYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
               +SF  YGP+WRN+RK   LELL+  KINSF  MRREE+  +V+S+K+AS     VDL
Sbjct  113  TMGMSFTAYGPHWRNIRKFVVLELLTPAKINSFVGMRREELGTVVKSIKEASAANEVVDL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            SAKVA++   M+ R++ G+  +D+       K +++EA++LA 
Sbjct  173  SAKVANIIENMTYRLLLGRTKDDR----YDLKGIMNEALTLAG  211



>gb|AAL66194.1|AF386512_1 cytochrome P450 [Pyrus communis]
Length=506

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G V  I+VSS + A+ FLKTHD +FA+RP  QA++YM+Y 
Sbjct  54   PHRSLQNLAKKYGPIMSMRLGSVPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+LL   KI SF  +RREEV LLV+SLK A+  G  VD 
Sbjct  114  TKAMAFTEYGPYWRHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDF  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +   ++ RMV G+K  + D+ D   K +I EA+ L  
Sbjct  174  SEKVGELVEGITYRMVLGRK--NDDMFD--LKGIIEEALFLTG  212



>ref|XP_009346975.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G +  I+VSS + A+ FLKTHD +FA+RP  QA++YM+Y 
Sbjct  54   PHRSLQNLAKKYGPIMSMRLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+LL   KI SF  +RREEV LLV+SLK A+  G  VD 
Sbjct  114  TKAMAFSEYGPYWRHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDF  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +   ++ RMV G+K  + D+ D   K +I EA+ L  
Sbjct  174  SEKVGELVEGITYRMVLGRK--NDDMFD--LKGIIEEALFLTG  212



>ref|XP_002514610.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47716.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 112/166 (67%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ L+ LAK HG IM L+ GFVD ++VSSA+AAE FLKTHD  FA RP    + Y+SY 
Sbjct  63   PHQSLYHLAKEHGQIMFLKLGFVDTVVVSSAQAAELFLKTHDAAFANRPKVLVSHYLSYG  122

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             + + F +YGPYWRN+RK+CTL+LLS+ KI SF  +R+EE+ L+V ++KQA+     VD+
Sbjct  123  SRGMIFDDYGPYWRNVRKVCTLQLLSSSKIESFAPLRKEELELMVATIKQAAERKEMVDV  182

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SA++   S  + CRM+FG++  D    +   + +I E++ L    N
Sbjct  183  SARLGDFSENLICRMIFGQRSND----EFDLRPLIKESLELIGAIN  224



>ref|XP_010663579.1| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 116/164 (71%), Gaps = 6/164 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++L  LAK +GPIM +R G V  I+VSS EAA+  +KTHD+VFA+RP  QA +Y+SY 
Sbjct  52   PHRNLSRLAKKYGPIMFMRLGCVPTIVVSSPEAAKLVMKTHDVVFASRPKLQAYEYLSYG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLC L L S+ KINSF S+R+ EV LLV+S+K+ +  G  VD+
Sbjct  112  AKGIAFTEYGPYWRHVRKLCALHLFSSAKINSFASVRKAEVGLLVKSVKEMASAGEVVDI  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKD-IGDKGFKAVIHEAMSLAA  693
            SAKVA +  +M+ RMVFG    +KD I D   K +I EA  LA 
Sbjct  172  SAKVAGVVEDMAYRMVFG---HNKDRIFD--LKTLIREATRLAG  210



>ref|XP_008374965.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=622

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 107/161 (66%), Gaps = 4/161 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R GF+  I+VSS +AAE FLKTHD +FA+RP  QA +YMSY 
Sbjct  55   PHRSLQNLAKKYGPIMSMRLGFIPTIVVSSPQAAELFLKTHDTIFASRPKLQAFEYMSYG  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR +RKLCTL+LL   KI +   +RREEV LLV+SLK A+     VDL
Sbjct  115  TKAMAFTEYGPYWRYIRKLCTLQLLCPSKIEASAPLRREEVGLLVQSLKVAAETDEVVDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            S KV  +   ++ RMV G+K +D        K +I E M L
Sbjct  175  SEKVGELVEGITYRMVLGRKKDDM----FDLKGIIDEGMFL  211


 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +1

Query  268  FVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRNMRKLCT  447
            F+  I+VSS + A+ FLKTHD +FA RP  QA+ YM+Y  K ++F EYGPYWR++RKLC 
Sbjct  244  FIPTIVVSSPKTAKLFLKTHDTIFANRPKLQASDYMAYGTKAMAFTEYGPYWRHIRKLCM  303

Query  448  LELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVASM  585
            L+LL   KI  F  +R+EEV LLV+SLK A+  G  VD S KV  +
Sbjct  304  LQLLCPSKIKGFAPLRKEEVGLLVQSLKVAADAGDVVDFSEKVGEL  349



>ref|XP_007209911.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
 gb|EMJ11110.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
Length=513

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G    I+VSS  AAE FLKTHD +FA+RP  QA++YMSY 
Sbjct  57   PHRSLQHLAKKYGPIMSMRLGNTPAIVVSSPTAAELFLKTHDTIFASRPKVQASEYMSYG  116

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+LL   KI  F  +RREEV L ++SLK+A+  G  VDL
Sbjct  117  TKGMAFTEYGPYWRHIRKLCTLQLLCPSKIEGFAPLRREEVGLFIQSLKKAAAAGEMVDL  176

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +  +++ RMV G K  + D+ D   K  I EA+ L+ 
Sbjct  177  SEKVGGLVEDITYRMVLGSK--NDDMFD--LKGTIEEALFLSG  215



>ref|XP_009337209.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 114/163 (70%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G    I+VSS +AAE FLKTHD +FA+RP  Q++K+MSY 
Sbjct  55   PHRSLQNLAKKYGPIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQSSKHMSYG  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+LLS  +I +F  +R+EEV LLV+SLK A+  G  VDL
Sbjct  115  TKAMAFSEYGPYWRHVRKLCTLQLLSPSRIEAFAPLRKEEVGLLVQSLKVAAEAGEVVDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV+ +   ++ RMV G+K  + ++ D   K +I E M L+ 
Sbjct  175  SEKVSDLVVGITYRMVLGRK--NNEMFD--LKGIIEEVMFLSG  213



>ref|XP_003630097.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=457

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 113/167 (68%), Gaps = 19/167 (11%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+L++ +GPIMHLR G V  I+VSS +AAE FLKTHDLVFA+RPP +AAK    
Sbjct  47   NPHRDLHKLSQKYGPIMHLRLGLVPIIVVSSPQAAELFLKTHDLVFASRPPIEAAKNHRL  106

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              + L F                    + KINSF++MR +E+ LL++ L++ + +   VD
Sbjct  107  GSEELEF-------------------CHAKINSFKTMREQELDLLIKFLREKTNDRTKVD  147

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV++++A+MSCRMV GKKY D D+ +KGFKAV+ E M L+A PN
Sbjct  148  LSTKVSTLTADMSCRMVLGKKYTDDDLDEKGFKAVMLETMHLSATPN  194



>emb|CBI15433.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 116/164 (71%), Gaps = 6/164 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++L  LAK +GPIM +R G V  I+VSS EAA+  +KTHD+VFA+RP  QA +Y+SY 
Sbjct  152  PHRNLSRLAKKYGPIMFMRLGCVPTIVVSSPEAAKLVMKTHDVVFASRPKLQAYEYLSYG  211

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLC L L S+ KINSF S+R+ EV LLV+S+K+ +  G  VD+
Sbjct  212  AKGIAFTEYGPYWRHVRKLCALHLFSSAKINSFASVRKAEVGLLVKSVKEMASAGEVVDI  271

Query  565  SAKVASMSAEMSCRMVFGKKYEDKD-IGDKGFKAVIHEAMSLAA  693
            SAKVA +  +M+ RMVFG    +KD I D   K +I EA  LA 
Sbjct  272  SAKVAGVVEDMAYRMVFG---HNKDRIFD--LKTLIREATRLAG  310



>ref|XP_009337234.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=504

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 109/167 (65%), Gaps = 6/167 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G    I+VSS + AE FLKTHD +FA+RP  Q++ Y+SY 
Sbjct  49   PHRSLQHLAKKYGPIMSMRLGSKTTIVVSSPKVAELFLKTHDTIFASRPKVQSSDYLSYG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K + F EYGPYWR++RKLCTL+LL   KI  F  +RREEV LLV+ LK+A++ G  VDL
Sbjct  109  TKGMGFSEYGPYWRHIRKLCTLQLLCQSKIEGFAPLRREEVGLLVQWLKKAAKAGEVVDL  168

Query  565  SAKVASMSAEMSCRMVFGKKYEDK-DIGDKGFKAVIHEAMSLAALPN  702
            S KV  +  +++ RMV G K +D  D+     K +I E M L    N
Sbjct  169  SEKVGELIEDITYRMVLGSKNDDTFDV-----KGIIEEVMLLTGAVN  210



>ref|XP_007211074.1| hypothetical protein PRUPE_ppa017688mg [Prunus persica]
 gb|EMJ12273.1| hypothetical protein PRUPE_ppa017688mg [Prunus persica]
Length=462

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L +LAK +GPIM +R G    I+VSS EAAE FLK+HD +FA+RP  Q++ Y+ Y 
Sbjct  48   PHRSLRDLAKKYGPIMSMRLGTKTTIVVSSPEAAELFLKSHDTIFASRPKVQSSDYLLYG  107

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K+++F EYGPYWR++RKLCTL+LL   KI +F  +RREEV  LVESLK+A+  G  VDL
Sbjct  108  SKDMAFSEYGPYWRHIRKLCTLQLLCPSKIETFAPLRREEVGSLVESLKKAAAEGQVVDL  167

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S KV  +  +++ RMV G K +D        K +I E + L    N
Sbjct  168  SEKVGELLEDITNRMVLGSKTDDT----CDMKGIIEELVLLMGAVN  209



>ref|XP_008360900.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=504

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 108/167 (65%), Gaps = 6/167 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G    I+VSS + AE FLKTHD +FA+RP  Q++ Y+SY 
Sbjct  49   PHRSLQHLAKKYGPIMSMRLGSKTTIVVSSPKVAELFLKTHDTIFASRPKVQSSDYLSYG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K + F EYGPYWR++RKLCTL+LL   KI  F  +RREEV LLV+SLK+A+  G  VDL
Sbjct  109  TKGMGFSEYGPYWRHIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKKATEAGEVVDL  168

Query  565  SAKVASMSAEMSCRMVFGKKYEDK-DIGDKGFKAVIHEAMSLAALPN  702
            S KV  +   ++ RMV G K +D  D+     K +I E M L    N
Sbjct  169  SEKVGELIEGITYRMVLGSKNDDTFDV-----KGIIEEIMLLTGAVN  210



>ref|XP_002511968.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF50637.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=501

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 107/163 (66%), Gaps = 3/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ LH LAK +GPIM +R G V  II+SS +AAE FLKT+D  FA+RP  QA+ Y+SY 
Sbjct  49   PHQALHHLAKKYGPIMSMRLGLVPTIIISSPQAAELFLKTYDTNFASRPNIQASHYLSYG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            +K L F EYG YWR+ RKLCTL+LLS  KI +F  MR+EE  L+V  LK+A+     V+L
Sbjct  109  RKGLVFSEYGSYWRSTRKLCTLQLLSASKIQAFAPMRKEEYGLMVGKLKKAAAAREVVNL  168

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S  V+ +   MSCRMVFG    +   GD   K+V+ E + L  
Sbjct  169  SVSVSDLIQNMSCRMVFGVSTNN---GDFRLKSVVEETLRLVG  208



>ref|XP_008240284.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=509

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G +  I+VSS  AAE FLKTHD +FA+RP  QA++YMSY 
Sbjct  53   PHRSLQHLAKKYGPIMSMRLGNIPAIVVSSPTAAELFLKTHDTIFASRPKVQASEYMSYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+LL   KI     +RREEV L ++SLK+A+  G  VDL
Sbjct  113  TKGMAFTEYGPYWRHIRKLCTLQLLCPSKIEGSAPLRREEVGLFIQSLKKAAAAGEVVDL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +  +++ RMV G K  + D+ D   K  I EA+ L+ 
Sbjct  173  SEKVGGLVEDITYRMVLGSK--NDDMFD--LKGTIQEALFLSG  211



>gb|KJB78920.1| hypothetical protein B456_013G025400 [Gossypium raimondii]
Length=507

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 109/166 (66%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ LH L K +GPIM ++ G+V  I+VSS EAAEQFLK HDLVFA+RP  Q+ +Y++Y+
Sbjct  55   PHQTLHHLGKKYGPIMSIKLGYVPTIVVSSPEAAEQFLKVHDLVFASRPNLQSTEYLTYS  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F  YG YWR  RKL TL  LS  KI  F  +R+EEV  LVES+++A   G  VDL
Sbjct  115  GKGLAFAHYGSYWRTARKLSTLHFLSASKIECFAPVRKEEVVSLVESVRKAVTAGETVDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S K+  +   M C+++FG+  +DK      FK ++ E M LA + N
Sbjct  175  SRKLGKVIEVMMCKLLFGQSMDDK----FQFKPLVDETMLLAGVFN  216



>ref|XP_009336569.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +  G +  I+VSS + A+ FLKTHD +FA+RP  QA++YM+Y 
Sbjct  54   PHRSLQNLAKKYGPIMSMHLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+LL   KI SF  +RREEV LLV+SLK A+  G  VD 
Sbjct  114  TKAMAFTEYGPYWRHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDF  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +   ++ RMV G+K  + D+ D   K +I EA+ L  
Sbjct  174  SEKVGELVEGITYRMVLGRK--NDDMFD--LKGIIEEALFLTG  212



>ref|XP_009337201.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=519

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G    I+VSS +AAE FLKTHD +FA+RP  QA+KYMSY 
Sbjct  68   PHRSLQNLAKKYGPIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQASKYMSYG  127

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYG YWR++RKLCTL+LL   +I +F  +RREEV LLV+SLK A+  G  VDL
Sbjct  128  TKAMAFSEYGSYWRHVRKLCTLQLLCPSRIEAFAPLRREEVGLLVQSLKVAAEAGKVVDL  187

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +   ++ +MV G++  + D+ D   K +I E M L  
Sbjct  188  SEKVGELVVGITYKMVLGRR--NNDMFD--LKGIIEETMFLTG  226



>gb|KJB78919.1| hypothetical protein B456_013G025300 [Gossypium raimondii]
Length=343

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ LH L K +GPIM ++ G+V  I+VSS EAAE FLK HDLVFA+RP  Q+ +Y+SY+
Sbjct  99   PHQTLHHLGKKYGPIMSIKLGYVPTIVVSSPEAAELFLKVHDLVFASRPNLQSTEYLSYS  158

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F  YG YWR ++KLCTL  LS  KI  F  +R+EEV  LVES+++A   G  V+L
Sbjct  159  GKGLAFSHYGSYWRTVQKLCTLHFLSASKIECFAPVRKEEVVSLVESVRKAVTAGETVNL  218

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S K+  +   M C+++FG+  +    G   FK +++E M LA + N
Sbjct  219  SRKLGKVIEVMMCKVLFGQSMD----GKFQFKPLVNETMLLAGVFN  260



>ref|XP_003627829.1| Cytochrome P450, partial [Medicago truncatula]
Length=591

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 113/167 (68%), Gaps = 19/167 (11%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSY  381
            NPH+DLH+L++ +GPIMHLR G V  I+VSS +AAE FLKTHDLVFA+RPP +AAK    
Sbjct  90   NPHRDLHKLSQKYGPIMHLRLGLVPIIVVSSPQAAELFLKTHDLVFASRPPIEAAKNHRL  149

Query  382  NQKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVD  561
              + L F                    + KINSF++MR +E+ LL++ L++ + +   VD
Sbjct  150  GSEELEF-------------------CHAKINSFKTMREQELDLLIKFLREKTNDRTKVD  190

Query  562  LSAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            LS KV++++A+MSCRMV GKKY D D+ +KGFKAV+ E M L+A PN
Sbjct  191  LSTKVSTLTADMSCRMVLGKKYTDDDLDEKGFKAVMLETMHLSATPN  237


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  202  NPHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPH  357
            NPH+DLH+L++ +GPIMHLR G +  I+VSS +AAE FLKTHDLVFA+RPPH
Sbjct  532  NPHRDLHQLSQKYGPIMHLRLGLIPTIVVSSPQAAELFLKTHDLVFASRPPH  583



>gb|KHN32022.1| Cytochrome P450 71A1 [Glycine soja]
Length=511

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM ++ G V  I+VSS E AE FLKTHD VFA+RP  QA++YMSY 
Sbjct  57   PHRSLQALAKKYGPIMSIKLGQVPTIVVSSPETAELFLKTHDTVFASRPKTQASEYMSYG  116

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EYGPYWRNMRK CT +LLS  K++ F  +RREE+ L V+SL++A+ +   V++
Sbjct  117  TKGLVFSEYGPYWRNMRKFCTTQLLSASKVDMFAPLRREELGLFVKSLEKAASSRDVVNI  176

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S +V  + + +  +M+ G+  +D+       K + HEA+ L+ + N
Sbjct  177  SEQVGELMSNIVYKMILGRNKDDR----FDLKGLTHEALHLSGVFN  218



>ref|XP_004490596.1| PREDICTED: uncharacterized protein LOC101501242 [Cicer arietinum]
Length=965

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 118/162 (73%), Gaps = 6/162 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH L+  +GPIM L+ G V  IIVSS++AAE FLKTHD+VFA+RP  QA+K +SY+
Sbjct  510  PHRSLHSLSIKYGPIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKIQASKLISYD  569

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EYGPYWR++RKLCTL+LLS  K+  F  +R+EE+ +LV+SL++AS  G  V++
Sbjct  570  SKGLAFSEYGPYWRSVRKLCTLKLLSPSKVEMFGPIRKEELGVLVKSLEKASMVGEVVNV  629

Query  565  SAKVASMSAEMSCRMVFGK-KYEDKDIGDKGFKAVIHEAMSL  687
            S  V ++  E+ C+++ G+ KYE  D+     K +I EA++L
Sbjct  630  SEVVGNLIEEIMCKIILGRSKYEQFDL-----KKLIQEALAL  666


 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 112/162 (69%), Gaps = 6/162 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH L+  +GPIM L+ G V  IIVSS++AAE FLKTHD+VFA+RP  Q  + +SY 
Sbjct  59   PHRSLHSLSIKYGPIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKIQGTELISYG  118

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EYGPYWR+MRKLCTL+LLS  K+  F  +R+EE+ +LV+SL++AS  G  V++
Sbjct  119  SKGLGFAEYGPYWRSMRKLCTLKLLSPSKVEMFGPIRKEELGVLVKSLEKASMVGEVVNV  178

Query  565  SAKVASMSAEMSCRMVFGK-KYEDKDIGDKGFKAVIHEAMSL  687
            S    ++  ++  +M+ GK KYE  D+     K ++ EAM+L
Sbjct  179  SEVAGNLIEDVIYKMILGKSKYEQFDL-----KKLVQEAMAL  215



>ref|XP_010094781.1| Cytochrome P450 71D8 [Morus notabilis]
 gb|EXB56946.1| Cytochrome P450 71D8 [Morus notabilis]
Length=508

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 112/165 (68%), Gaps = 7/165 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G V  ++VSS +AAE  L+THD +FA+RP  QA+ Y+SY 
Sbjct  51   PHRGLQALAKKYGPIMSMRLGRVPTVVVSSPQAAELILQTHDAIFASRPKVQASAYLSYG  110

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWRN+RK CTL+LL++ K  SF ++R  EV  LV SL+ A+  G  VD+
Sbjct  111  SKGMAFNEYGPYWRNVRKFCTLQLLTSSKTASFAALRAAEVASLVASLRAAAAAGEVVDV  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGF--KAVIHEAMSLAA  693
            S+KV  + A++SCR+V G     +++GD+ +  K ++ E M L  
Sbjct  171  SSKVGRLVADISCRIVLG-----RNVGDERYDLKRLVEEIMRLTG  210



>gb|KHN32024.1| Cytochrome P450 71A1 [Glycine soja]
Length=459

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM ++ G V  ++VSS E AE FLKTHD +FA+RP   A++YMSY 
Sbjct  6    PHRSLQALAKNYGPIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKTLASEYMSYG  65

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EYGPYWRN++KLCT +LLS  K+  F  +RREE+ + V+SL++A+ +   V+L
Sbjct  66   SKGLAFSEYGPYWRNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKAAASRDVVNL  125

Query  565  SAKVASMSAEMSCRMVFGKKYEDK  636
            S +V  + + + CRM+ G+  +D+
Sbjct  126  SEQVGELISNIVCRMILGRSKDDR  149



>ref|XP_003534174.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=977

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM ++ G V  I+VSS E AE FLKTHD VFA+RP  QA++YMSY 
Sbjct  523  PHRSLQALAKKYGPIMSIKLGQVPTIVVSSPETAELFLKTHDTVFASRPKTQASEYMSYG  582

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EYGPYWRNMRK CT +LLS  K++ F  +RREE+ L V+SL++A+ +   V++
Sbjct  583  TKGLVFSEYGPYWRNMRKFCTTQLLSASKVDMFAPLRREELGLFVKSLEKAASSRDVVNI  642

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S +V  + + +  +M+ G+  +D+       K + HEA+ L+ + N
Sbjct  643  SEQVGELMSNIVYKMILGRNKDDR----FDLKGLTHEALHLSGVFN  684


 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 104/163 (64%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L   A+ +GPIM L+ G V  I+VSS E AE FLKTHD VFA+RP  QA++Y+S+ 
Sbjct  49   PHRTLQTFARKYGPIMSLKLGQVQAIVVSSPETAELFLKTHDTVFASRPKIQASEYLSHG  108

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EY  YWR +RK+CTL+LLS  K++ F  +RR+E+ +LV+SL+ ++ +   VDL
Sbjct  109  TKGLVFSEYSAYWRKVRKVCTLQLLSASKVDMFAPLRRQELGVLVKSLRNSAASREVVDL  168

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S  +  +   +  +MV G+  + +       K ++H+ M+L  
Sbjct  169  SEVLGELMENIVYKMVLGRARDHR----FELKGLVHQVMNLVG  207



>ref|XP_003630839.1| Cytochrome P450 [Medicago truncatula]
 gb|AET05315.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=283

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 107/166 (64%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K HGPIM LR G V  IIVSS+ AAEQFLKTHD+VF++RP  +A  Y+SY 
Sbjct  56   PHRALQALSKKHGPIMLLRLGQVPTIIVSSSSAAEQFLKTHDVVFSSRPKLEATHYLSYG  115

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EYG YWRNMRK+CTL+LLS  K+ SF  +R+ E+ + +ESLK+A   G  VD+
Sbjct  116  SKGLVFAEYGAYWRNMRKVCTLQLLSASKVESFGPLRQRELKVALESLKKAVSLGEVVDV  175

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S  V  + A++  +MV G   ++    +   K  I + M L+   N
Sbjct  176  SEFVHGVIADIVYKMVLGCSVDE----EFDLKGQIQQGMELSGTFN  217



>ref|XP_008374739.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=508

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 107/163 (66%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R GF+  I+VSS + A+ FLKTHD +FA+ P  QA++YM+Y 
Sbjct  54   PHRSLQNLAKKYGPIMSMRLGFIPTIVVSSPKTAKLFLKTHDNIFASXPKLQASEYMAYG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYW  +RKL TL+LL   KI  F  +RREEV LLV+SLK A+  G  VD 
Sbjct  114  TKAMAFTEYGPYWXRIRKLYTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEAGEVVDF  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +   ++ RMV G+K  + D+ D   K +I EA+ L  
Sbjct  174  SEKVGELVEGITYRMVLGRK--NDDMFD--LKGIIEEALFLTG  212



>ref|XP_004490599.1| PREDICTED: uncharacterized protein LOC101502297 [Cicer arietinum]
Length=983

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 117/162 (72%), Gaps = 6/162 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH L+  +GPIM L+ G V  IIVSS++AAE FLKTHD+VFA+RP  Q  + +SY+
Sbjct  528  PHRSLHSLSIKYGPIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKIQGTELISYD  587

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EYGPYWR++RKLCTL+LLS  K+  F+ +R+EE+ +LV+SL++AS  G  V++
Sbjct  588  SKALAFSEYGPYWRSVRKLCTLKLLSPSKVEMFRPIRKEELGVLVKSLEKASMVGEVVNV  647

Query  565  SAKVASMSAEMSCRMVFGK-KYEDKDIGDKGFKAVIHEAMSL  687
            S  V ++  E+ C+++ G+ KYE  D+     K ++ EA++L
Sbjct  648  SEVVGNLIEEIMCKIILGRSKYEQFDL-----KKLVQEALAL  684


 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 112/162 (69%), Gaps = 6/162 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM L+FG +  I++SS++AAE FLKTHD+ FA+RP  Q ++ MSY 
Sbjct  57   PHRSLQLLSKKYGPIMSLQFGQIPFIVISSSKAAELFLKTHDIYFASRPKSQGSEIMSYG  116

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++  EYGPYWR++RKLCTL LLS  K+  F  +R+EE+ +LV+SL++AS  G  V++
Sbjct  117  SKGMAISEYGPYWRSVRKLCTLNLLSALKVEMFGPIRKEELGVLVKSLEKASLVGEVVNV  176

Query  565  SAKVASMSAEMSCRMVFGK-KYEDKDIGDKGFKAVIHEAMSL  687
            S  V ++  ++  +M+ G+ KYE  D+     K +I EAM L
Sbjct  177  SEAVENLIEDIMYKMILGRSKYEQFDL-----KGLIQEAMVL  213



>ref|XP_009337257.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM +R G    I+VSS +AAE FLKTHD +FA+RP  Q++K+MS+ 
Sbjct  55   PHRSLQNLAKKYGPIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQSSKHMSHG  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKL TL+LLS  +I +   +RREE  LLV+SLK A+  G  VDL
Sbjct  115  TKAMAFSEYGPYWRHVRKLSTLQLLSPSRIEASAPLRREEAGLLVQSLKVAAEAGEVVDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV+ +   ++ RMV G+K  + D+ D   K +I E M L+ 
Sbjct  175  SEKVSELVVGITYRMVLGRK--NNDMFD--LKGIIEEVMFLSG  213



>ref|XP_002522214.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40189.1| cytochrome P450, putative [Ricinus communis]
Length=304

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ L + +K +GP+M ++ G V  +I+SS+EAA++ LKTHDL   +RP   +   +SYN
Sbjct  53   PHQSLWQYSKRYGPVMLVKLGRVPTVIISSSEAAKELLKTHDLSSCSRPLLTSTGKLSYN  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
              +++F  YG YWRNMRKLC LEL S  ++ SFQ +R EEV LL++S+ ++S     VDL
Sbjct  113  YLDIAFTPYGDYWRNMRKLCVLELFSTKRVESFQFVREEEVSLLIDSISKSS--CSPVDL  170

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            S K   ++A ++CR+ FGK ++++  G + F+ VI EA +L
Sbjct  171  SEKAIFLTANITCRVAFGKSFQERGFGHERFQEVIREAFAL  211



>ref|XP_007199546.1| hypothetical protein PRUPE_ppb020039mg [Prunus persica]
 gb|EMJ00745.1| hypothetical protein PRUPE_ppb020039mg [Prunus persica]
Length=178

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 101/155 (65%), Gaps = 28/155 (18%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  LH LA+ HG                   AAE FLKTHDLVFA+RPP QAA+++SY 
Sbjct  51   PHWYLHRLAQKHG-----------------HHAAEPFLKTHDLVFASRPPLQAAEHISYG  93

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            Q NLSFG YG  WR +           HKINSF+ MR+EE+ LL + +++A+R+   VDL
Sbjct  94   QMNLSFGAYGSDWRTI-----------HKINSFKPMRKEELALLTKFIQEAARDRFTVDL  142

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVI  669
            S KVAS++A+MSC MVFGKKY DK+  ++GFKAVI
Sbjct  143  SGKVASLAADMSCLMVFGKKYMDKEFDERGFKAVI  177



>ref|XP_002285460.2| PREDICTED: cytochrome P450 71B34-like [Vitis vinifera]
Length=505

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 111/161 (69%), Gaps = 1/161 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  L +L+K +G IM L+ G V  ++VSSAEAA +FLKTHD+   +RPP       SYN
Sbjct  56   PHYSLWQLSKKYGSIMLLQLG-VPTVVVSSAEAAREFLKTHDIDCCSRPPLVGLGKFSYN  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             +++SF  YG YWR +RK+C LE+ S  ++ SFQ +R EEV LL++S+ Q+S +G  +DL
Sbjct  115  HRDISFAPYGDYWREVRKICVLEVFSTKRVQSFQFIREEEVALLIDSIVQSSSSGSPIDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            + ++ S++A + CR+ FGK ++  + GD  F+ V+HEAM+L
Sbjct  175  TERLMSLTANIICRIAFGKSFQASEFGDGRFQEVVHEAMAL  215



>ref|XP_002285472.2| PREDICTED: cytochrome P450 71B34-like [Vitis vinifera]
Length=505

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 111/161 (69%), Gaps = 1/161 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  L +L+K +G IM L+ G V  ++VSSAEAA +FLKTHD+   +RPP       SYN
Sbjct  56   PHYSLWQLSKKYGSIMLLQLG-VPTVVVSSAEAAREFLKTHDIDCCSRPPLVGLGKFSYN  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             +++SF  YG YWR +RK+C LE+ S  ++ SFQ +R EEV LL++S+ Q+S +G  +DL
Sbjct  115  HRDISFAPYGDYWREVRKICVLEVFSTKRVQSFQFIREEEVALLIDSIVQSSSSGSPIDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            + ++ S++A + CR+ FGK ++  + GD  F+ V+HEAM+L
Sbjct  175  TERLMSLTANIICRIAFGKSFQASEFGDGRFQEVVHEAMAL  215



>gb|KJB34360.1| hypothetical protein B456_006G062200 [Gossypium raimondii]
Length=513

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ+LH LAK +GPIM LR G V  I+VSS EAAE FLKTHDLVFA+RP  QA +Y+SY 
Sbjct  58   PHQNLHHLAKRYGPIMSLRLGCVPTIVVSSPEAAELFLKTHDLVFASRPGIQAGEYLSYG  117

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
               ++F  YG YWR +RK CTL LLS  K+  F  +R+ E+  LVES+K+++     V+L
Sbjct  118  STGMAFTPYGSYWRTVRKWCTLHLLSASKVEYFAPVRKTELGSLVESVKESAAARETVNL  177

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +  +M C+++FG+  +D+       +++I + M L+ 
Sbjct  178  SEKVGELIEKMMCKIIFGRSNDDR----FNLRSLIDQTMHLSG  216



>ref|XP_007152790.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
 gb|ESW24784.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
Length=507

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH++L  LA  +GPIM L+ G V  I+VSS E AE FLKTHD VFA+RP  QA++++S+ 
Sbjct  58   PHRNLQSLATKYGPIMSLKLGQVPAIVVSSPETAEPFLKTHDTVFASRPKIQASEFLSHG  117

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EY  YWRNMRK+CT++LLS  ++  F  MRREE+ +LV+SLK+++ +G  VDL
Sbjct  118  SKGLAFSEYSAYWRNMRKVCTVQLLSVSRVEMFAPMRREELGVLVKSLKRSAASGEVVDL  177

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S  VA +  +M  RM+ G+  +D+       K +I E M+L  
Sbjct  178  SELVAEVVEKMVFRMMLGRVKDDR----LDLKKLIQEVMNLVG  216



>ref|XP_003530005.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
 gb|KHN20713.1| Cytochrome P450 71A1 [Glycine soja]
Length=503

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            P++ L  LAK +GPIM ++ G +  I+VSS E AE FLKTHD VFA+RP  QA+KYMSY 
Sbjct  54   PNRTLQALAKKYGPIMSIKLGQIPTIVVSSPETAELFLKTHDTVFASRPKTQASKYMSYG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             + + F EYGPYWRN+RK+CT ELLS  K+     +RR+E+ +LV+SL++A+ +   V++
Sbjct  114  TRGIVFTEYGPYWRNVRKVCTTELLSASKVEMLAPLRRQELGILVKSLEKAAASHDVVNV  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S KV  + + + C+M+ G+  +D+       K + H+ + L  L N
Sbjct  174  SDKVGELISNIVCKMILGRSRDDR----FDLKGLTHDYLHLLGLFN  215



>ref|XP_007036495.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20996.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=535

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH +LH LAK +GPIM LR G+V  I+VSS +AAE FLKTHD+VFA+RP  QA +Y+SY 
Sbjct  75   PHLNLHHLAKRYGPIMLLRLGYVPTIVVSSPQAAELFLKTHDVVFASRPKVQACEYLSYG  134

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K + F EYG YWR +RK CTL LLS  K+  F  +R+ E+  +VE++K+A+  G  VD+
Sbjct  135  GKGMGFTEYGSYWRTVRKWCTLHLLSGSKVEYFAPLRKAELGSMVETVKKAAAAGETVDI  194

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +  ++  +M+FG+    +D  +   K +I E   LA 
Sbjct  195  SGKVGEVIEDIMYKMIFGRPSNSED-DNINLKLLIKEISRLAG  236



>ref|XP_003534173.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=978

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM ++ G V  ++VSS E AE FLKTHD +FA+RP   A++YMSY 
Sbjct  524  PHRSLQALAKNYGPIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKTLASEYMSYG  583

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EYGPYWRN++KLCT +LLS  K+  F  +RREE+ + V+SL++A+ +   V+L
Sbjct  584  SKGLAFSEYGPYWRNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKAAASRDVVNL  643

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S +V  + + + CRM+ G+  +D+       K +  E + LA + N
Sbjct  644  SEQVGELISNIVCRMILGRSKDDR----FDLKGLAREVLRLAGVFN  685


 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM ++ G V  ++VSS E AE FLKTHD +FA+RP   A++YMSY 
Sbjct  53   PHRSLQALAKNYGPIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKTLASEYMSYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EYGPYWRN++KLCT +LLS  K+  F  +RREE+ + V+SL++A+ +   V+L
Sbjct  113  SKGLAFSEYGPYWRNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKAAASRDVVNL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDK  636
            S +V  + + + CRM+ G+  +D+
Sbjct  173  SEQVGELISNIVCRMILGRSKDDR  196



>emb|CAN60733.1| hypothetical protein VITISV_023587 [Vitis vinifera]
Length=505

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 109/161 (68%), Gaps = 1/161 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH    +L+K +GPIM L+ G V  ++VSS EAA +FLKTHD+   +RPP       SYN
Sbjct  56   PHYSWWQLSKKYGPIMLLQLG-VPTVVVSSVEAAREFLKTHDIDCCSRPPLVGLGKFSYN  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             +++ F  YG YWR +RK+C LE+ S  ++ SFQ +R EEV LL++S+ Q+S +G  +DL
Sbjct  115  HRDIGFAPYGDYWREVRKICVLEVFSTKRVQSFQFIREEEVTLLIDSIAQSSSSGSPIDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            + ++ S++A + CR+ FGK ++  + GD  F+ V+HEAM+L
Sbjct  175  TERLMSLTANIICRIAFGKSFQVSEFGDGRFQEVVHEAMAL  215



>ref|XP_003636948.1| Cytochrome P450 [Medicago truncatula]
Length=333

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 111/163 (68%), Gaps = 6/163 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  L +L+  +GP+MHL+ G V  I+VSSAE A++ LKTHDLVFA+RPP QA+K MSYN
Sbjct  57   PHHRLRDLSTKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYN  116

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
               LSF  YG YWR +RK+C LELLS+ ++ SFQ +R EE+  L++ +  AS+ G  ++L
Sbjct  117  SIGLSFSPYGDYWRQLRKICALELLSSKRVQSFQPIRSEEMTNLIKWI--ASKEGSEINL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            + +V S    ++ R+ FGK+ +D    +K F +++ EA  +A 
Sbjct  175  TKEVNSRIFLITSRVAFGKECKD----NKKFISLVWEATRVAG  213



>ref|XP_010650716.1| PREDICTED: cytochrome P450 71B34-like [Vitis vinifera]
Length=503

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 111/162 (69%), Gaps = 0/162 (0%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            HQ L +L+K +GP+M L  GFV  ++VSSAEAA++ LK HD+   +RPP  +   +SYN 
Sbjct  55   HQSLWQLSKKYGPVMLLHLGFVPTLVVSSAEAAKKVLKDHDISCCSRPPLISIGRLSYNY  114

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
             ++SF  YGPYWR +RK+C L+L S +++ SFQ +R  EV LL++SL Q+S +   VDL+
Sbjct  115  LDISFAPYGPYWREIRKICVLQLFSTNRVQSFQVIREAEVALLIDSLAQSSSSASPVDLT  174

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
             K+ S++A M CR+ FG+ +E  + G   F+ V+HEA ++ +
Sbjct  175  DKIMSLTANMICRIAFGRSFEGSEFGKGRFQEVVHEATAMMS  216



>gb|KHN20715.1| Cytochrome P450 71A1 [Glycine soja]
Length=500

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 109/163 (67%), Gaps = 5/163 (3%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM L+ G V  ++VSS EAAE FLKTHD VFA RP  + A+Y +Y 
Sbjct  47   PHRSLQSLSKRYGPIMSLQLGNVPTVVVSSPEAAELFLKTHDTVFANRPKFETAQY-TYG  105

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             ++++F EYGPYWRN+RK+CT  LLS  K+ SF  +R+ E+  +VESLK+A+     VD+
Sbjct  106  AESVAFAEYGPYWRNVRKVCTTHLLSASKVESFDGLRKREIGAMVESLKEAAMAREVVDV  165

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S +V  +  +M+C+MV G+  +D+       K ++ E MS++ 
Sbjct  166  SERVGEVLRDMACKMVLGRNKDDR----FDLKGILVETMSVSG  204



>ref|XP_002285456.1| PREDICTED: cytochrome P450 71B34-like [Vitis vinifera]
Length=505

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 110/161 (68%), Gaps = 1/161 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  L +L+K +G IM L+ G V  ++VSSAEAA +FLKTHD+   +RPP       SYN
Sbjct  56   PHYSLWQLSKKYGSIMLLQLG-VPTVVVSSAEAAREFLKTHDIDCCSRPPLVGPGKFSYN  114

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             +++ F  YG YWR +RK+C LE+ S  ++ SFQ +R EEV LL++S+ Q+S +G  +DL
Sbjct  115  HRDIGFAPYGDYWREVRKICVLEVFSTKRVQSFQFIREEEVTLLIDSIAQSSSSGSPIDL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            + ++ S++A + CR+ FGK ++  + GD  F+ V+HEA++L
Sbjct  175  TERLMSLTANIICRIAFGKSFQVSEFGDGRFQEVVHEAVAL  215



>gb|KJB13389.1| hypothetical protein B456_002G072000 [Gossypium raimondii]
Length=519

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ LH LAK +GPIM +  G V  I+VSS EAAE FLK HD+VFA+RP  Q+AKY +Y 
Sbjct  67   PHQSLHYLAKKYGPIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSAKYFTYG  126

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F +YG YWR +RK C L  LS  ++  F  +R+ EV LLVES+++ +  G  ++L
Sbjct  127  GKALAFTQYGSYWRTVRKWCILHFLSASEVECFAPIRKAEVGLLVESVRKVAAVGETINL  186

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S  VA +  EM  +++FG+  +DK      FK ++ EA+ L+ + N
Sbjct  187  SLAVAKVLEEMMSKVLFGRSMDDK----IDFKPLVDEALHLSGVFN  228



>emb|CAN83446.1| hypothetical protein VITISV_019663 [Vitis vinifera]
Length=992

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 111/162 (69%), Gaps = 0/162 (0%)
 Frame = +1

Query  208  HQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQ  387
            HQ L +L+K HGP+M L  GFV  ++VSSAEAA++ LK HD+   +RPP  +   +SYN 
Sbjct  550  HQSLWQLSKKHGPVMLLHLGFVPTLVVSSAEAAKKVLKDHDISCCSRPPLISIGRLSYNY  609

Query  388  KNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLS  567
             ++SF  YGPYWR +RK+C L+L S +++ SFQ +R  EV LL++SL Q+S +   VDL+
Sbjct  610  LDISFAPYGPYWREIRKICVLQLFSTNRVQSFQVIREAEVALLIDSLAQSSSSASPVDLT  669

Query  568  AKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
             K+ S++A M CR+ FG+ +E  + G   F+ V+HEA ++ +
Sbjct  670  DKIMSLTANMICRIAFGRSFEGSEFGKGRFQEVVHEATAMMS  711


 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 95/136 (70%), Gaps = 0/136 (0%)
 Frame = +1

Query  280  IIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYNQKNLSFGEYGPYWRNMRKLCTLELL  459
            IIVSSAEAA +FLKTHD+   +RPP       SYN +++ F  YG YWR +RK+C LE+ 
Sbjct  45   IIVSSAEAAREFLKTHDIDCCSRPPLVGXGKFSYNHRDIGFAPYGDYWREVRKICVLEVF  104

Query  460  SNHKINSFQSMRREEVCLLVESLKQASRNGGAVDLSAKVASMSAEMSCRMVFGKKYEDKD  639
            S  ++ SFQ +R EEV LL++S+ Q+S +G  +DL+ ++ S++A + CR+ FGK ++  +
Sbjct  105  STKRVQSFQFIREEEVTLLIDSIAQSSSSGSPIDLTERLMSLTANIICRIAFGKSFQASE  164

Query  640  IGDKGFKAVIHEAMSL  687
             GD  F+ V+HEAM+L
Sbjct  165  FGDGRFQEVVHEAMAL  180



>ref|XP_004506686.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=495

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 110/163 (67%), Gaps = 6/163 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  L EL+  +GP+MHL+ G +  IIVSSAE A+Q +KTHDL+F++RPP QA+  MSYN
Sbjct  56   PHHRLRELSTKYGPLMHLKLGEISTIIVSSAECAKQVMKTHDLIFSSRPPIQASTIMSYN  115

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
               ++F  YG YWR +RK+CTLELLS+  + SFQ +R EEV  L++ +   S+ G +++L
Sbjct  116  NVGIAFAPYGDYWRQLRKICTLELLSSKSVQSFQPIRDEEVTNLIKWI--TSKEGSSINL  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            + +V S  + ++ R  FGKK E+    +  F +++ EA+ +A 
Sbjct  174  TKEVFSTISTITSRTAFGKKCEE----NTKFISLVREAVKVAG  212



>gb|KHG07950.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ LH LAK +GPIM +  G V  I+VSS EAAE FLK HD+VFA+RP  Q+AKY +Y 
Sbjct  67   PHQSLHYLAKKYGPIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSAKYFAYG  126

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F +YG YWR +RK   L  LS  K+  F S+R+ EV LLVES+++ +  G  ++L
Sbjct  127  GKAMAFTQYGSYWRTVRKWSILHFLSASKVQCFASIRKAEVGLLVESVRKVAAAGETINL  186

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S  VA +   M  +++FG+  +DK      FK +++EAM LA + N
Sbjct  187  SQAVAKVLEGMMSKVLFGRSMDDK----IDFKPLVNEAMHLAGVFN  228



>gb|KHF97324.1| Cytochrome P450 [Gossypium arboreum]
 gb|KHG09556.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PHQ LH LAK +GPIM +  G V  I+VSS EAAE FLK HD+VFA+RP  Q+AKY +Y 
Sbjct  67   PHQSLHYLAKKYGPIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSAKYFAYG  126

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F +YG YWR +RK   L  LS  K+  F S+R+ EV LLVES+++ +  G  ++L
Sbjct  127  GKAMAFTQYGSYWRTVRKWSILHFLSASKVQCFASIRKAEVGLLVESVRKVAAAGETINL  186

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S  VA +   M  +++FG+  +DK      FK +++EAM LA + N
Sbjct  187  SQAVAKVLEGMMSKVLFGRSMDDK----IDFKPLVNEAMHLAGVFN  228



>ref|XP_003528941.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=981

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 110/163 (67%), Gaps = 5/163 (3%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM L+ G V  ++VSS EAAE FLKTHD VFA RP  + A+Y +Y 
Sbjct  528  PHRSLQSLSKRYGPIMSLQLGNVPTVVVSSPEAAELFLKTHDTVFANRPKFETAQY-TYG  586

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            +++++F EYGPYWRN+RK+CT  LLS  K+ SF  +R+ E+  +VESLK+A+     VD+
Sbjct  587  EESVAFAEYGPYWRNVRKVCTTHLLSASKVESFDGLRKREIGAMVESLKEAAMAREVVDV  646

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S +V  +  +M+C+MV G+  +D+       K ++ E MS++ 
Sbjct  647  SERVGEVLRDMACKMVLGRNKDDR----FDLKGILVETMSVSG  685


 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 105/164 (64%), Gaps = 6/164 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +GPIM L+ G V  I++SS E AE FLKTHD  FA+RP   ++KY+SY 
Sbjct  53   PHRTLQSLAKQYGPIMSLKLGQVTTIVISSPETAELFLKTHDTTFASRPKSISSKYISYG  112

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EYGPYWRNMRKLCT++LL   K+  F  +R +++  LV+ L++ + +   VDL
Sbjct  113  GKGLVFSEYGPYWRNMRKLCTVQLLIASKVEMFSPLRSQQLQELVKCLRKTASSREVVDL  172

Query  565  SAKVASMSAEMSCRMVFGKKYEDK-DIGDKGFKAVIHEAMSLAA  693
            S  V  +   ++ +M+FG   +D+ D+     K + HE ++LA 
Sbjct  173  SDMVGDLIENINFQMIFGCSKDDRFDV-----KNLAHEIVNLAG  211



>emb|CAN69565.1| hypothetical protein VITISV_033534 [Vitis vinifera]
Length=501

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 107/166 (64%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +G IM +R G V  I+VSS +AA+ FLKTHD VFA+R   Q  +Y++Y 
Sbjct  52   PHRSLSRLAKKYGSIMFMRLGSVPTIVVSSPQAAKLFLKTHDAVFASRAKLQGVEYLTYG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYG Y RN+RKLC L+L S  KINSF SMR E + L V+SLK+ +  G  VD+
Sbjct  112  TKGIAFSEYGLYLRNVRKLCALKLFSTAKINSFASMRXEAIGLFVQSLKEMAAAGNVVDI  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S +VA +  +M+ RMVFG    DKD      K +I EA SLA   N
Sbjct  172  STRVAEVIEDMAYRMVFG---HDKD-EMIDLKTLIGEATSLAGTFN  213



>ref|XP_004299223.2| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=535

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 101/144 (70%), Gaps = 0/144 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +G IM LR G V  I++SS +AAE FLKTHD  FA+RP  QA++Y++Y 
Sbjct  83   PHRTLQNLAKQYGDIMSLRLGNVPTIVISSPKAAELFLKTHDTNFASRPKIQASEYLAYG  142

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EYGPYWR++RK+CTL+L    K+ +F  +R+EE+  LV  LK+A+  G  VD+
Sbjct  143  TKGLAFSEYGPYWRHVRKICTLQLFCPAKLEAFAPLRKEELGGLVGKLKRAAEEGEVVDV  202

Query  565  SAKVASMSAEMSCRMVFGKKYEDK  636
            S K+  M+ +++ RMV G K +DK
Sbjct  203  SEKIGEMNEDITYRMVLGCKRDDK  226



>ref|XP_002275691.1| PREDICTED: cytochrome P450 CYP736A12 isoform X1 [Vitis vinifera]
Length=501

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 107/166 (64%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +G IM +R G V  I+VSS +AA+ FLKTHD VFA+R   Q  +Y++Y 
Sbjct  52   PHRSLSRLAKKYGSIMFMRLGSVPTIVVSSPQAAKLFLKTHDAVFASRAKLQGVEYLTYG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYG Y RN+RKLC L+L S  KINSF SMR E + L V+SLK+ +  G  VD+
Sbjct  112  TKGIAFSEYGLYLRNVRKLCALKLFSTAKINSFASMRGEAIGLFVQSLKEMAAAGNVVDI  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S +VA +  +M+ RMVFG    DKD      K +I EA SLA   N
Sbjct  172  STRVAEVIEDMAYRMVFG---HDKD-EMIDLKTLIGEATSLAGTFN  213



>ref|XP_007152787.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
 gb|ESW24781.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
Length=499

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LA  +GPIM L  G V  I+VSS E AE FLKTHD VFA+RP  Q ++ +S+ 
Sbjct  50   PHRTLQSLATKYGPIMSLNLGQVPAIVVSSPETAELFLKTHDTVFASRPKIQVSETLSHG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EY  YWRN+RK+CT++LLS  K+  F  +RREE+ +LVESLK ++ +G  VDL
Sbjct  110  SKGLVFSEYSAYWRNVRKVCTVQLLSASKVEMFGPLRREELGVLVESLKNSAASGEVVDL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S  VA +  +M  RMV G+  +DK       K +I EA++L  
Sbjct  170  SELVAEVVEKMVFRMVLGRVKDDK----LELKRLIQEALNLVG  208



>ref|XP_007036496.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY20997.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=514

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 106/163 (65%), Gaps = 1/163 (1%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH +LH LAK +G IM LR G+V  I+VSS +AAE FLKTHD+VFA+RP  QA +Y+SY 
Sbjct  54   PHLNLHHLAKRYGHIMLLRLGYVPTIVVSSPQAAELFLKTHDVVFASRPKVQACEYLSYG  113

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K + F EYG YWR +RK CTL LLS  K+  F  +R+ E+  +VE++K+A+  G  VD+
Sbjct  114  GKGMGFTEYGSYWRTVRKWCTLHLLSGSKVEYFAPLRKAELGSMVETVKKAAAAGETVDI  173

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S KV  +  ++  +M+FG+    +D  +   K +I E   LA 
Sbjct  174  SGKVGEVIEDIMYKMIFGRPSNSED-DNINLKLLIKEISRLAG  215



>ref|XP_004301061.2| PREDICTED: cytochrome P450 CYP736A12-like [Fragaria vesca subsp. 
vesca]
Length=536

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 107/163 (66%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LAK +G IM +R G V  I++SS +AAE FLKTHD  FA+RP  QA++Y+SY 
Sbjct  84   PHRTLQNLAKQYGDIMSIRLGNVPTIVISSPKAAELFLKTHDTNFASRPKIQASEYLSYG  143

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWR++RKLCTL+L  + K+ +F  +R+EE+  LV  LK+A+  G  VD+
Sbjct  144  TKGMAFSEYGPYWRHVRKLCTLQLFCSAKLEAFAPLRKEELGGLVGKLKKAAEEGEVVDV  203

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S K+  M+  ++ RMV G K +D+       KA++ E   L  
Sbjct  204  SEKIGEMNEGITYRMVLGCKRDDR----FDLKAIVEEMFFLVG  242



>ref|XP_003600322.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=499

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 111/163 (68%), Gaps = 6/163 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  L +L+  +GP+MHL+ G V  I+VSSAE A++ LKTHDLVFA+RPP QA+K MSYN
Sbjct  57   PHHRLRDLSTKYGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYN  116

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
               LSF  YG YWR +RK+C LELLS+ ++ SFQ +R EE+  L++ +  AS+ G  ++L
Sbjct  117  SIGLSFSPYGDYWRQLRKICALELLSSKRVQSFQPIRSEEMTNLIKWI--ASKEGSEINL  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            + +V S    ++ R+ FGK+ +D    +K F +++ EA  +A 
Sbjct  175  TKEVNSRIFLITSRVAFGKECKD----NKKFISLVWEATRVAG  213



>ref|XP_010111002.1| Cytochrome P450 71D10 [Morus notabilis]
 gb|EXC29388.1| Cytochrome P450 71D10 [Morus notabilis]
Length=473

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+K +GPIM LR G V  ++VSS EAAE FLKTHD  FA+RP  QA++YMSY 
Sbjct  59   PHRGLQSLSKKYGPIMSLRLGQVQAVVVSSPEAAELFLKTHDTAFASRPKVQASEYMSYG  118

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F EYGPYWRN+RKLCTL+LLS  KI SF + R EEV  LVESL+ A+     VD+
Sbjct  119  TKGMAFTEYGPYWRNVRKLCTLQLLSASKIESFTASRGEEVAALVESLRGAAAARELVDV  178

Query  565  SAKVA  579
            S K+A
Sbjct  179  SRKIA  183



>gb|KEH27058.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 108/163 (66%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L++ +GPIM  + G V  I+VSS + AE FLKTHD +F++RP   AA YM+Y 
Sbjct  57   PHRSLQLLSQKYGPIMSFKLGQVQTIVVSSPQIAELFLKTHDSIFSSRPKAFAADYMTYG  116

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
            +K + F EYG YWRNMRKLCT++LL + K+  F  +R+EEV LLV+SL++++     V++
Sbjct  117  KKGIIFTEYGDYWRNMRKLCTIQLLHSSKVEMFAPLRKEEVGLLVKSLRKSATLHEVVNV  176

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            S  VA +   ++C+M+ G+  +D+       K ++H+AM L  
Sbjct  177  SKVVAELIENITCKMILGRSKDDR----FDLKGIVHKAMLLTG  215



>gb|KJB13388.1| hypothetical protein B456_002G071900 [Gossypium raimondii]
Length=519

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  LH LA+ +GPIM +  G V  I+VSS EAAE FLK HD+VFA+RP  Q+AKY++Y 
Sbjct  67   PHHSLHYLAEKYGPIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSAKYLAYG  126

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K + F +YG YWR +RK C L  LS  K+  F  +R+ EV LLVES+++ +  G  ++L
Sbjct  127  GKAVGFTQYGSYWRTVRKWCILHFLSASKVECFAPIRKAEVGLLVESVRKVAAAGETINL  186

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            S  VA +  EM  +++FG+  +DK      FK ++ EA+ L+ + N
Sbjct  187  SQAVAKVLEEMMSKVLFGRSMDDK----IDFKPLVDEALHLSGVFN  228



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 112/163 (69%), Gaps = 6/163 (4%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH  L +L+  +GP+MHL+ G V  I+VSSAE A++ +K HDLVFA+RPP QA+K MSY+
Sbjct  57   PHHRLRDLSTKYGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPIQASKIMSYD  116

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
               L+F  YG YWRN+RK+CTLELLS+ ++ SFQ +R EEV  L++ +  +S+ G  ++ 
Sbjct  117  SLGLAFAPYGDYWRNLRKICTLELLSSKRVQSFQPIRSEEVTNLIKWI--SSKEGSQINF  174

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            + +V S  + ++ R  FGKK ++    ++ F +++ +A+ +A 
Sbjct  175  TKEVFSTISTITSRTAFGKKCKE----NQKFISIVRDAIKIAG  213



>ref|XP_007152789.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
 gb|ESW24783.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
Length=499

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 107/161 (66%), Gaps = 4/161 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  LA  +GPIM L+ G +  I+VSS E AE FLKTHD VFA+RP  QA++++S+ 
Sbjct  50   PHRTLQSLATKYGPIMSLKLGQIPAIVVSSPETAELFLKTHDTVFASRPKIQASEFLSHG  109

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F EY  YWRNMRK+CT++LLS  ++  F  MRREE+ +LV+SLK ++ +G  VDL
Sbjct  110  SKGLAFSEYSAYWRNMRKVCTVQLLSASRVEMFAPMRREELGVLVKSLKHSAASGEVVDL  169

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            S  +  +  +M  +MV G   +D+       K +I EA++L
Sbjct  170  SELLGELMEKMVFKMVLGCAKDDR----LDLKNLIQEALNL  206



>gb|KCW79056.1| hypothetical protein EUGRSUZ_C00482, partial [Eucalyptus grandis]
Length=417

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 107/163 (66%), Gaps = 4/163 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH LAK++GPIM LR G    ++VSS EAAE  LKT+D +F++RP   A ++MSY 
Sbjct  52   PHRCLHSLAKSYGPIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDALRHMSYG  111

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K ++F E G YWR M+KLCTL+LLS  K+ SF  MRREE+  +V  ++ A+     VD+
Sbjct  112  NKGMAFAESGAYWRGMKKLCTLQLLSTAKVESFAPMRREELGRVVRRVRAAAAEHEVVDV  171

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAA  693
            SA+V  + A+++CRM+ G    DK       K VIHE ++LA 
Sbjct  172  SAEVGQLIADLACRMILGCSTRDK----FNLKPVIHEGLNLAG  210



>ref|XP_010045641.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=506

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 104/166 (63%), Gaps = 4/166 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ L  L+  +GPIM LR G V  ++VSS EAA  FL THD +FA+RP    A+   Y 
Sbjct  56   PHRSLCSLSARYGPIMSLRLGLVPAVVVSSPEAAGLFLGTHDAIFASRPRIPEAELEFYT  115

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L F EYGPYWR++RKLCT  LLS  ++ SF+ MRREEV  LV SL++++    AVDL
Sbjct  116  TKGLVFTEYGPYWRSVRKLCTTHLLSAARVRSFEGMRREEVGSLVASLRESAAAHEAVDL  175

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSLAALPN  702
            SA+V     +M+CRM+ G+  +    G+   K +I E   +A + N
Sbjct  176  SAQVERAMEDMACRMILGRSTD----GEHDLKGIIQENARVAGVFN  217



>ref|XP_007036492.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY20993.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=512

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = +1

Query  205  PHQDLHELAKTHGPIMHLRFGFVDNIIVSSAEAAEQFLKTHDLVFATRPPHQAAKYMSYN  384
            PH+ LH LA+ +G IM +R G+V  I+VSS +AAE FLKTHD +F +RP  Q ++Y+SY 
Sbjct  58   PHRTLHHLAQKYGSIMSIRLGYVPTIVVSSPQAAELFLKTHDTIFDSRPKVQGSEYLSYG  117

Query  385  QKNLSFGEYGPYWRNMRKLCTLELLSNHKINSFQSMRREEVCLLVESLKQASRNGGAVDL  564
             K L+F +YG YWR +RK CTL+LLS  K+  F   RR E+  LV+ LK A+     VDL
Sbjct  118  TKGLAFAQYGSYWRTVRKWCTLQLLSASKVEFFAPKRRTELQSLVKLLKNAAAASEVVDL  177

Query  565  SAKVASMSAEMSCRMVFGKKYEDKDIGDKGFKAVIHEAMSL  687
            SAKV  +  ++  RM+ G+  +DK       K +IHE + L
Sbjct  178  SAKVGELIEDIMYRMILGRCKDDK----FDLKPLIHEGIRL  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1239542226394