BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12181

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACY78680.1|  calcium-dependent protein kinase 1                      178   3e-48   Panax ginseng [Asiatic ginseng]
emb|CDP04396.1|  unnamed protein product                                174   2e-46   Coffea canephora [robusta coffee]
ref|XP_011086186.1|  PREDICTED: calcium-dependent protein kinase-...    171   1e-45   Sesamum indicum [beniseed]
ref|XP_009597333.1|  PREDICTED: calcium-dependent protein kinase-...    169   5e-45   Nicotiana tomentosiformis
ref|XP_011096067.1|  PREDICTED: calcium-dependent protein kinase-...    169   8e-45   Sesamum indicum [beniseed]
ref|XP_007213894.1|  hypothetical protein PRUPE_ppa003830mg             168   1e-44   Prunus persica
ref|XP_010276092.1|  PREDICTED: calcium-dependent protein kinase ...    164   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008226901.1|  PREDICTED: calcium-dependent protein kinase 2      163   7e-43   Prunus mume [ume]
ref|XP_009776260.1|  PREDICTED: calcium-dependent protein kinase-...    162   1e-42   Nicotiana sylvestris
ref|XP_009776253.1|  PREDICTED: calcium-dependent protein kinase-...    162   3e-42   Nicotiana sylvestris
ref|XP_009360996.1|  PREDICTED: calcium-dependent protein kinase ...    160   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_008365060.1|  PREDICTED: calcium-dependent protein kinase 2      160   2e-41   
ref|XP_004294385.1|  PREDICTED: calcium-dependent protein kinase ...    159   2e-41   Fragaria vesca subsp. vesca
ref|XP_011047988.1|  PREDICTED: calcium-dependent protein kinase-...    158   4e-41   Populus euphratica
ref|XP_011047987.1|  PREDICTED: calcium-dependent protein kinase-...    158   6e-41   Populus euphratica
gb|KJB81729.1|  hypothetical protein B456_013G159300                    157   6e-41   Gossypium raimondii
gb|KJB81728.1|  hypothetical protein B456_013G159300                    157   1e-40   Gossypium raimondii
ref|XP_010278695.1|  PREDICTED: calcium-dependent protein kinase ...    157   1e-40   Nelumbo nucifera [Indian lotus]
gb|KJB81727.1|  hypothetical protein B456_013G159300                    157   2e-40   Gossypium raimondii
ref|XP_007020822.1|  Calmodulin-domain protein kinase 9 isoform 3       154   3e-40   
sp|P28582.2|CDPK_DAUCA  RecName: Full=Calcium-dependent protein k...    156   3e-40   Daucus carota [carrots]
gb|EYU33891.1|  hypothetical protein MIMGU_mgv1a004201mg                155   4e-40   Erythranthe guttata [common monkey flower]
gb|KDO62721.1|  hypothetical protein CISIN_1g0096582mg                  148   6e-40   Citrus sinensis [apfelsine]
ref|XP_007020821.1|  Calmodulin-domain protein kinase 9 isoform 2       153   6e-40   
gb|KDO62718.1|  hypothetical protein CISIN_1g0096582mg                  148   1e-39   Citrus sinensis [apfelsine]
ref|XP_009627158.1|  PREDICTED: calcium-dependent protein kinase ...    154   1e-39   Nicotiana tomentosiformis
ref|XP_007020820.1|  Calmodulin-domain protein kinase 9 isoform 1       154   2e-39   
gb|KHG17079.1|  Calcium-dependent protein kinase 9                      152   8e-39   Gossypium arboreum [tree cotton]
gb|KHG28675.1|  Calcium-dependent protein kinase 9                      152   9e-39   Gossypium arboreum [tree cotton]
ref|XP_004500067.1|  PREDICTED: calcium-dependent protein kinase ...    152   9e-39   Cicer arietinum [garbanzo]
gb|KJB13681.1|  hypothetical protein B456_002G088800                    150   3e-38   Gossypium raimondii
gb|KCW66999.1|  hypothetical protein EUGRSUZ_F007611                    147   4e-38   Eucalyptus grandis [rose gum]
ref|XP_006452370.1|  hypothetical protein CICLE_v10007983mg             149   4e-38   
gb|KJB13679.1|  hypothetical protein B456_002G088800                    150   5e-38   Gossypium raimondii
ref|XP_012070829.1|  PREDICTED: calcium-dependent protein kinase ...    149   6e-38   Jatropha curcas
ref|XP_006452371.1|  hypothetical protein CICLE_v10007983mg             149   6e-38   Citrus clementina [clementine]
ref|XP_008439982.1|  PREDICTED: calcium-dependent protein kinase 2      149   1e-37   Cucumis melo [Oriental melon]
ref|XP_006350481.1|  PREDICTED: calcium-dependent protein kinase-...    149   2e-37   Solanum tuberosum [potatoes]
ref|XP_006475136.1|  PREDICTED: calcium-dependent protein kinase ...    149   2e-37   
ref|XP_010060380.1|  PREDICTED: calcium-dependent protein kinase ...    148   2e-37   Eucalyptus grandis [rose gum]
ref|XP_010060346.1|  PREDICTED: calcium-dependent protein kinase ...    148   3e-37   
gb|KCW67039.1|  hypothetical protein EUGRSUZ_F00807                     147   3e-37   Eucalyptus grandis [rose gum]
ref|XP_010060348.1|  PREDICTED: calcium-dependent protein kinase ...    148   3e-37   
ref|XP_007142270.1|  hypothetical protein PHAVU_008G266600g             147   4e-37   Phaseolus vulgaris [French bean]
ref|XP_004231610.1|  PREDICTED: calcium-dependent protein kinase ...    147   5e-37   Solanum lycopersicum
ref|XP_009357448.1|  PREDICTED: calcium-dependent protein kinase ...    147   5e-37   Pyrus x bretschneideri [bai li]
ref|XP_002532559.1|  calcium-dependent protein kinase, putative         146   8e-37   Ricinus communis
gb|AIO04122.1|  calcium-dependent protein kinase                        134   3e-36   Hevea brasiliensis [jebe]
ref|XP_008224828.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    145   3e-36   Prunus mume [ume]
ref|XP_006389625.1|  hypothetical protein POPTR_0021s00750g             144   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008349938.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    144   4e-36   
ref|XP_009770081.1|  PREDICTED: calcium-dependent protein kinase ...    144   5e-36   Nicotiana sylvestris
ref|XP_007153943.1|  hypothetical protein PHAVU_003G078400g             144   5e-36   Phaseolus vulgaris [French bean]
ref|XP_008385882.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    144   5e-36   
ref|NP_001280761.1|  calcium-dependent protein kinase 2-like            143   9e-36   Malus domestica [apple tree]
gb|AAK92828.1|  putative calcium dependent protein kinase               143   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192381.1|  calcium-dependent protein kinase 21                   143   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AGJ83806.1|  calcium-dependent protein kinase 1d                     142   2e-35   Vitis amurensis
emb|CBI23246.3|  unnamed protein product                                142   2e-35   Vitis vinifera
gb|KCW75309.1|  hypothetical protein EUGRSUZ_E04057                     142   3e-35   Eucalyptus grandis [rose gum]
ref|XP_010057925.1|  PREDICTED: calcium-dependent protein kinase ...    142   3e-35   Eucalyptus grandis [rose gum]
ref|NP_001275456.1|  calcium-dependent protein kinase 3                 142   3e-35   Solanum tuberosum [potatoes]
gb|EPS59225.1|  calcium-dependent protein kinase 1                      142   3e-35   Genlisea aurea
gb|KCW75310.1|  hypothetical protein EUGRSUZ_E04057                     142   3e-35   Eucalyptus grandis [rose gum]
ref|XP_002268814.1|  PREDICTED: calcium-dependent protein kinase 2      142   4e-35   Vitis vinifera
ref|XP_007026068.1|  Calcium-dependent protein kinase 21 isoform 3      141   4e-35   
ref|XP_007026067.1|  Calcium-dependent protein kinase 21 isoform 2      141   4e-35   
ref|XP_010092160.1|  Calcium-dependent protein kinase 9                 141   5e-35   Morus notabilis
ref|XP_003519577.1|  PREDICTED: calcium-dependent protein kinase ...    141   5e-35   Glycine max [soybeans]
ref|XP_007026066.1|  Calcium-dependent protein kinase 21 isoform 1      141   6e-35   
dbj|BAJ99143.1|  predicted protein                                      141   6e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009360846.1|  PREDICTED: calcium-dependent protein kinase ...    141   6e-35   Pyrus x bretschneideri [bai li]
gb|AAD17800.1|  Ca2+-dependent protein kinase                           141   6e-35   Mesembryanthemum crystallinum
ref|XP_006289661.1|  hypothetical protein CARUB_v10003219mg             141   7e-35   Capsella rubella
gb|ABC59619.1|  calcium-dependent protein kinase                        141   7e-35   Triticum aestivum [Canadian hard winter wheat]
gb|AFR11230.1|  calcium dependent protein kinase 1                      141   7e-35   Chenopodium album [lamb's-quarters]
gb|KJB62816.1|  hypothetical protein B456_009G438300                    140   7e-35   Gossypium raimondii
gb|ABD98803.1|  calcium-dependent protein kinase                        140   8e-35   Triticum aestivum [Canadian hard winter wheat]
gb|ADZ52811.1|  calcium-dependent protein kinase 3                      140   8e-35   Solanum tuberosum [potatoes]
emb|CDP05759.1|  unnamed protein product                                140   9e-35   Coffea canephora [robusta coffee]
ref|XP_009783685.1|  PREDICTED: calcium-dependent protein kinase ...    140   9e-35   Nicotiana sylvestris
ref|XP_004293286.1|  PREDICTED: calcium-dependent protein kinase ...    140   1e-34   Fragaria vesca subsp. vesca
gb|KHN02836.1|  Calcium-dependent protein kinase 9                      140   1e-34   Glycine soja [wild soybean]
gb|KHG26977.1|  Calcium-dependent protein kinase 9                      140   2e-34   Gossypium arboreum [tree cotton]
gb|AAC25423.1|  calcium-dependent protein kinase                        140   2e-34   Nicotiana tabacum [American tobacco]
ref|XP_009798561.1|  PREDICTED: calcium-dependent protein kinase ...    140   2e-34   Nicotiana sylvestris
ref|XP_010675716.1|  PREDICTED: calcium-dependent protein kinase ...    140   2e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|ABC59620.1|  calcium-dependent protein kinase                        139   2e-34   Triticum aestivum [Canadian hard winter wheat]
gb|KFK30983.1|  hypothetical protein AALP_AA6G053500                    139   2e-34   Arabis alpina [alpine rockcress]
ref|XP_002874811.1|  calcium-dependent protein kinase 21                139   3e-34   
gb|ABB54456.1|  calcium-dependent protein kinase                        139   3e-34   Hordeum brevisubulatum
gb|AFY10519.1|  calcium dependent protein kinase 1                      139   3e-34   Dendrobium officinale
ref|NP_001266075.1|  calcium-dependent protein kinase 21-like           139   3e-34   Cicer arietinum [garbanzo]
ref|XP_010422295.1|  PREDICTED: calcium-dependent protein kinase 21     139   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008463413.1|  PREDICTED: calcium-dependent protein kinase-...    139   3e-34   Cucumis melo [Oriental melon]
ref|XP_010455773.1|  PREDICTED: calcium-dependent protein kinase ...    139   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011095398.1|  PREDICTED: calcium-dependent protein kinase ...    139   4e-34   Sesamum indicum [beniseed]
ref|XP_004134759.1|  PREDICTED: calcium-dependent protein kinase ...    139   4e-34   Cucumis sativus [cucumbers]
ref|XP_006657762.1|  PREDICTED: calcium-dependent protein kinase ...    139   5e-34   Oryza brachyantha
ref|NP_001234806.1|  calcium-dependent protein kinase                   139   5e-34   Solanum lycopersicum
ref|XP_004152931.1|  PREDICTED: calcium-dependent protein kinase-...    138   5e-34   Cucumis sativus [cucumbers]
gb|ACB71246.2|  calcium-dependent protein kinase 1                      139   5e-34   Hevea brasiliensis [jebe]
gb|AGJ83807.1|  calcium-dependent protein kinase 1e                     138   5e-34   Vitis amurensis
ref|XP_006657761.1|  PREDICTED: calcium-dependent protein kinase ...    139   5e-34   
ref|XP_008806408.1|  PREDICTED: calcium-dependent protein kinase 2      138   6e-34   Phoenix dactylifera
ref|NP_001059775.1|  Os07g0515100                                       138   6e-34   
ref|XP_003563028.1|  PREDICTED: calcium-dependent protein kinase ...    138   7e-34   
ref|XP_006365956.1|  PREDICTED: calcium-dependent protein kinase 2      138   8e-34   
ref|XP_010467929.1|  PREDICTED: calcium-dependent protein kinase ...    140   9e-34   
gb|ERN17348.1|  hypothetical protein AMTR_s00037p00138680               136   9e-34   Amborella trichopoda
ref|XP_011627635.1|  PREDICTED: calcium-dependent protein kinase ...    136   1e-33   
ref|XP_010686845.1|  PREDICTED: calcium-dependent protein kinase ...    137   1e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO78219.1|  hypothetical protein CISIN_1g009091mg                   136   1e-33   Citrus sinensis [apfelsine]
gb|ABD98804.1|  calcium-dependent protein kinase                        137   2e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009144515.1|  PREDICTED: calcium-dependent protein kinase 21     137   2e-33   Brassica rapa
gb|KDO78217.1|  hypothetical protein CISIN_1g009091mg                   136   3e-33   Citrus sinensis [apfelsine]
gb|KDO78218.1|  hypothetical protein CISIN_1g009091mg                   136   3e-33   Citrus sinensis [apfelsine]
gb|AEY99979.1|  calcium-dependent protein kinase                        136   3e-33   Nicotiana tabacum [American tobacco]
ref|XP_009592788.1|  PREDICTED: calcium-dependent protein kinase 2      136   3e-33   Nicotiana tomentosiformis
ref|XP_003529633.1|  PREDICTED: calcium-dependent protein kinase ...    136   3e-33   Glycine max [soybeans]
ref|XP_010545509.1|  PREDICTED: calcium-dependent protein kinase 33     136   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_010529441.1|  PREDICTED: calcium-dependent protein kinase 21     136   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_006391947.1|  hypothetical protein EUTSA_v10023804mg             136   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_002278179.1|  PREDICTED: calcium-dependent protein kinase 2      135   4e-33   Vitis vinifera
gb|ADM14342.1|  calcium-dependent protein kinase 19                     135   4e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006396672.1|  hypothetical protein EUTSA_v10028567mg             135   5e-33   Eutrema salsugineum [saltwater cress]
emb|CAA65500.1|  protein kinase                                         135   5e-33   Medicago sativa [alfalfa]
dbj|BAE71239.1|  putative calcium dependent protein kinase              135   6e-33   Trifolium pratense [peavine clover]
ref|XP_010093289.1|  Calcium-dependent protein kinase 15                135   6e-33   Morus notabilis
ref|XP_006467440.1|  PREDICTED: calcium-dependent protein kinase ...    135   6e-33   Citrus sinensis [apfelsine]
ref|XP_006449723.1|  hypothetical protein CICLE_v10014823mg             135   6e-33   Citrus clementina [clementine]
ref|XP_003610427.1|  Calcium-dependent protein kinase                   135   7e-33   
gb|KDO62703.1|  hypothetical protein CISIN_1g009382mg                   135   8e-33   Citrus sinensis [apfelsine]
gb|AAQ17506.1|  calcium dependent protein kinase 3                      135   9e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009604147.1|  PREDICTED: calcium-dependent protein kinase ...    135   9e-33   Nicotiana tomentosiformis
ref|XP_006600312.1|  PREDICTED: calcium-dependent protein kinase ...    135   1e-32   Glycine max [soybeans]
emb|CAA57157.1|  calcium-dependent protein kinase                       134   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651864.1|  PREDICTED: calcium-dependent protein kinase ...    134   1e-32   
ref|XP_012091348.1|  PREDICTED: calcium-dependent protein kinase ...    134   1e-32   Jatropha curcas
dbj|BAA13440.1|  calcium dependent protein kinase                       134   1e-32   Ipomoea batatas [batate]
ref|XP_002518484.1|  calcium-dependent protein kinase, putative         134   1e-32   Ricinus communis
ref|NP_001105542.1|  calcium-dependent protein kinase 2                 134   2e-32   
gb|ACJ61504.1|  calcium-dependent protein kinase                        134   2e-32   Glycine max [soybeans]
gb|EYU27336.1|  hypothetical protein MIMGU_mgv1a004414mg                134   2e-32   Erythranthe guttata [common monkey flower]
ref|NP_001275322.1|  calcium-dependent protein kinase                   134   2e-32   Solanum tuberosum [potatoes]
emb|CDX91224.1|  BnaC02g26350D                                          133   2e-32   
ref|XP_010929942.1|  PREDICTED: calcium-dependent protein kinase ...    134   3e-32   Elaeis guineensis
gb|AAP03014.1|  seed calcium dependent protein kinase c                 133   3e-32   Glycine max [soybeans]
gb|ABE72958.1|  calcium dependent protein kinase 3                      133   3e-32   Medicago truncatula
gb|KEH33831.1|  calmodulin-domain kinase CDPK protein                   133   3e-32   Medicago truncatula
ref|XP_010508871.1|  PREDICTED: calcium-dependent protein kinase 9      133   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003545165.1|  PREDICTED: calcium-dependent protein kinase ...    121   4e-32   Glycine max [soybeans]
ref|NP_001234582.1|  calcium-dependent protein kinase CDPK1             133   4e-32   
gb|AGG35970.1|  calcium-dependent protein kinase 21                     133   4e-32   Brassica napus [oilseed rape]
gb|AET00506.2|  calcium-dependent kinase                                133   5e-32   Medicago truncatula
emb|CDY07254.1|  BnaC04g19170D                                          132   5e-32   
gb|KFK40633.1|  hypothetical protein AALP_AA2G022000                    132   6e-32   Arabis alpina [alpine rockcress]
ref|XP_006346214.1|  PREDICTED: calcium-dependent protein kinase ...    132   8e-32   Solanum tuberosum [potatoes]
ref|XP_010466227.1|  PREDICTED: calcium-dependent protein kinase ...    132   8e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004957849.1|  PREDICTED: calcium-dependent protein kinase ...    132   8e-32   
ref|XP_006452344.1|  hypothetical protein CICLE_v10007980mg             132   8e-32   Citrus clementina [clementine]
ref|NP_001275371.1|  calcium-dependent protein kinase 2                 132   8e-32   Solanum tuberosum [potatoes]
ref|NP_176386.2|  calcium-dependent protein kinase 19                   132   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAD28192.2|  calcium-dependent protein kinase                        131   1e-31   Solanum tuberosum [potatoes]
gb|AIU98507.1|  calcium-dependent protein kinase                        131   1e-31   Musa acuminata AAA Group [Cavendish banana]
ref|NP_001235641.1|  calmodulin-like domain protein kinase isoenz...    131   2e-31   
ref|NP_188676.1|  calmodulin-domain protein kinase 9                    131   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406510.1|  PREDICTED: calcium-dependent protein kinase ...    131   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010538709.1|  PREDICTED: calcium-dependent protein kinase ...    131   2e-31   Tarenaya hassleriana [spider flower]
gb|ACR34538.1|  unknown                                                 131   2e-31   Zea mays [maize]
ref|XP_004957848.1|  PREDICTED: calcium-dependent protein kinase ...    131   2e-31   
ref|XP_009603797.1|  PREDICTED: calcium-dependent protein kinase ...    117   2e-31   Nicotiana tomentosiformis
ref|XP_011037643.1|  PREDICTED: calcium-dependent protein kinase-...    131   2e-31   Populus euphratica
ref|XP_010430219.1|  PREDICTED: calcium-dependent protein kinase 19     130   2e-31   
ref|XP_002305576.2|  hypothetical protein POPTR_0004s01530g             131   2e-31   Populus trichocarpa [western balsam poplar]
gb|KHN12036.1|  Calcium-dependent protein kinase 17                     118   2e-31   Glycine soja [wild soybean]
ref|XP_006297378.1|  hypothetical protein CARUB_v10013403mg             131   2e-31   Capsella rubella
ref|XP_010418170.1|  PREDICTED: calcium-dependent protein kinase ...    130   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010434101.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    130   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009789543.1|  PREDICTED: calcium-dependent protein kinase ...    116   3e-31   Nicotiana sylvestris
gb|KJB69279.1|  hypothetical protein B456_011G014200                    130   3e-31   Gossypium raimondii
ref|XP_006301218.1|  hypothetical protein CARUB_v10021616mg             130   3e-31   Capsella rubella
ref|XP_002883243.1|  calmodulin-domain protein kinase 9                 130   3e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_002888057.1|  predicted protein                                  130   4e-31   
ref|XP_010923910.1|  PREDICTED: calcium-dependent protein kinase ...    130   4e-31   Elaeis guineensis
gb|KHG10851.1|  Calcium-dependent protein kinase 21                     130   6e-31   Gossypium arboreum [tree cotton]
ref|XP_006349794.1|  PREDICTED: calcium-dependent protein kinase ...    115   6e-31   
ref|XP_010923909.1|  PREDICTED: calcium-dependent protein kinase ...    130   6e-31   Elaeis guineensis
gb|KFK39368.1|  hypothetical protein AALP_AA3G235800                    129   6e-31   Arabis alpina [alpine rockcress]
ref|XP_008804309.1|  PREDICTED: calcium-dependent protein kinase ...    129   7e-31   Phoenix dactylifera
emb|CDY24863.1|  BnaA03g59670D                                          129   8e-31   Brassica napus [oilseed rape]
ref|NP_001105306.1|  calcium-dependent protein kinase                   129   9e-31   Zea mays [maize]
ref|XP_003617547.1|  Calcium dependent protein kinase                   132   9e-31   
ref|XP_004491400.1|  PREDICTED: calcium-dependent protein kinase ...    129   1e-30   Cicer arietinum [garbanzo]
ref|XP_006406385.1|  hypothetical protein EUTSA_v10020475mg             129   1e-30   Eutrema salsugineum [saltwater cress]
gb|AGG35967.1|  calcium-dependent protein kinase 15                     129   1e-30   Brassica napus [oilseed rape]
ref|XP_006452345.1|  hypothetical protein CICLE_v10007978mg             129   1e-30   Citrus clementina [clementine]
ref|XP_007146136.1|  hypothetical protein PHAVU_006G015300g             112   1e-30   Phaseolus vulgaris [French bean]
gb|AGA83664.1|  calcium-dependent protein kinase 1                      128   2e-30   Dendrobium officinale
gb|KHN38392.1|  Calcium-dependent protein kinase 17                     116   2e-30   Glycine soja [wild soybean]
gb|KJB68586.1|  hypothetical protein B456_010G252400                    128   2e-30   Gossypium raimondii
ref|XP_006575622.1|  PREDICTED: calcium-dependent protein kinase ...    115   2e-30   Glycine max [soybeans]
emb|CDX82886.1|  BnaC01g13360D                                          128   2e-30   
ref|XP_002891589.1|  calcium-dependent protein kinase 33                127   3e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_010533815.1|  PREDICTED: calcium-dependent protein kinase 19     127   4e-30   Tarenaya hassleriana [spider flower]
ref|XP_009113383.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    127   4e-30   Brassica rapa
ref|XP_010448965.1|  PREDICTED: calcium-dependent protein kinase 15     127   6e-30   Camelina sativa [gold-of-pleasure]
gb|AAC28510.1|  Similar to gb|AF072908 calcium-dependent protein ...    127   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439398.1|  PREDICTED: calcium-dependent protein kinase ...    126   1e-29   Camelina sativa [gold-of-pleasure]
gb|KFK35914.1|  hypothetical protein AALP_AA4G052700                    125   2e-29   Arabis alpina [alpine rockcress]
emb|CAD70165.1|  calcium-dependent protein kinase                       125   2e-29   Landoltia punctata
ref|NP_175485.1|  calcium-dependent protein kinase 33                   125   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828852.1|  PREDICTED: calcium-dependent protein kinase ...    125   3e-29   Amborella trichopoda
gb|KDO62705.1|  hypothetical protein CISIN_1g040917mg                   114   4e-29   Citrus sinensis [apfelsine]
ref|XP_006452346.1|  hypothetical protein CICLE_v10010522mg             114   4e-29   
ref|XP_009135689.1|  PREDICTED: calcium-dependent protein kinase 9      124   4e-29   Brassica rapa
ref|XP_011628928.1|  PREDICTED: calcium-dependent protein kinase ...    124   5e-29   Amborella trichopoda
ref|XP_006475078.1|  PREDICTED: calcium-dependent protein kinase ...    114   5e-29   
ref|XP_009388872.1|  PREDICTED: calcium-dependent protein kinase ...    124   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH28424.1|  calcium-dependent kinase                                123   6e-29   Medicago truncatula
ref|XP_010461925.1|  PREDICTED: calcium-dependent protein kinase 33     124   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010479536.1|  PREDICTED: calcium-dependent protein kinase ...    124   7e-29   Camelina sativa [gold-of-pleasure]
gb|AGG35978.1|  calcium-dependent protein kinase 9                      124   9e-29   Brassica napus [oilseed rape]
ref|XP_003610425.1|  Calcium-dependent protein kinase                   123   1e-28   Medicago truncatula
ref|XP_009135461.1|  PREDICTED: calcium-dependent protein kinase 15     123   1e-28   Brassica rapa
ref|XP_006287505.1|  hypothetical protein CARUB_v10000714mg             123   1e-28   
emb|CDX82244.1|  BnaA03g35770D                                          123   1e-28   
ref|XP_002874812.1|  calcium-dependent protein kinase 23                122   2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010501945.1|  PREDICTED: calcium-dependent protein kinase ...    123   2e-28   
ref|XP_006303970.1|  hypothetical protein CARUB_v10008860mg             122   2e-28   Capsella rubella
ref|XP_007141507.1|  hypothetical protein PHAVU_008G201900g             122   2e-28   Phaseolus vulgaris [French bean]
ref|XP_006452355.1|  hypothetical protein CICLE_v10010314mg             112   2e-28   
ref|XP_006283446.1|  hypothetical protein CARUB_v10004493mg             123   2e-28   Capsella rubella
ref|XP_001782248.1|  predicted protein                                  121   4e-28   
emb|CDY36037.1|  BnaC03g41610D                                          122   4e-28   Brassica napus [oilseed rape]
ref|XP_002869856.1|  calcium-dependent protein kinase 15                122   5e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010519814.1|  PREDICTED: calcium-dependent protein kinase ...    121   5e-28   Tarenaya hassleriana [spider flower]
gb|AAL59948.1|  putative calcium-dependent protein kinase               121   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006452347.1|  hypothetical protein CICLE_v10008020mg             111   6e-28   Citrus clementina [clementine]
ref|XP_006475143.1|  PREDICTED: calcium-dependent protein kinase ...    111   7e-28   
ref|XP_003617233.1|  Calcium dependent protein kinase                   120   8e-28   Medicago truncatula
ref|XP_001767768.1|  cpk1 calcium-dependent protein kinase              121   8e-28   
ref|XP_011034967.1|  PREDICTED: calcium-dependent protein kinase 29     120   9e-28   Populus euphratica
ref|XP_010519813.1|  PREDICTED: calcium-dependent protein kinase ...    121   9e-28   Tarenaya hassleriana [spider flower]
emb|CDY13993.1|  BnaC09g38330D                                          120   1e-27   Brassica napus [oilseed rape]
ref|XP_009120894.1|  PREDICTED: calcium-dependent protein kinase 34     120   1e-27   Brassica rapa
ref|XP_006399734.1|  hypothetical protein EUTSA_v10013236mg             120   1e-27   Eutrema salsugineum [saltwater cress]
ref|NP_196779.1|  calcium-dependent protein kinase 17                   120   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131258.1|  PREDICTED: calcium-dependent protein kinase ...    120   2e-27   Brassica rapa
emb|CDX78468.1|  BnaA03g03800D                                          119   2e-27   
gb|KFK25494.1|  hypothetical protein AALP_AA8G122000                    120   2e-27   Arabis alpina [alpine rockcress]
gb|AHG06449.1|  calcium-dependent protein kinase 17                     119   2e-27   Brassica napus [oilseed rape]
ref|XP_009125853.1|  PREDICTED: calcium-dependent protein kinase ...    119   2e-27   Brassica rapa
ref|XP_006289327.1|  hypothetical protein CARUB_v10002812mg             119   3e-27   Capsella rubella
ref|XP_010419805.1|  PREDICTED: calcium-dependent protein kinase ...    119   3e-27   
ref|XP_010453282.1|  PREDICTED: calcium-dependent protein kinase 17     119   3e-27   Camelina sativa [gold-of-pleasure]
emb|CDX97174.1|  BnaC09g44510D                                          119   3e-27   
ref|XP_010536137.1|  PREDICTED: calcium-dependent protein kinase 17     119   3e-27   Tarenaya hassleriana [spider flower]
ref|NP_193925.1|  calcium-dependent protein kinase 15                   119   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419806.1|  PREDICTED: calcium-dependent protein kinase ...    119   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009121874.1|  PREDICTED: calcium-dependent protein kinase 17     119   4e-27   Brassica rapa
ref|XP_002871516.1|  calcium-dependent protein kinase 17                119   4e-27   
ref|XP_010924783.1|  PREDICTED: calcium-dependent protein kinase ...    103   4e-27   Elaeis guineensis
ref|NP_001190794.1|  calcium-dependent protein kinase 15                119   4e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79112.1|  BnaA01g11790D                                          119   4e-27   
ref|XP_010924782.1|  PREDICTED: calcium-dependent protein kinase ...    102   5e-27   Elaeis guineensis
emb|CDY44912.1|  BnaA02g04170D                                          118   5e-27   Brassica napus [oilseed rape]
ref|XP_008792394.1|  PREDICTED: calcium-dependent protein kinase ...    102   5e-27   Phoenix dactylifera
gb|KHN23929.1|  Calcium-dependent protein kinase 17                     118   5e-27   Glycine soja [wild soybean]
ref|XP_009126355.1|  PREDICTED: calcium-dependent protein kinase 34     118   6e-27   Brassica rapa
gb|KJB09335.1|  hypothetical protein B456_001G135000                    118   6e-27   Gossypium raimondii
ref|XP_010492994.1|  PREDICTED: calcium-dependent protein kinase ...    118   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006289743.1|  hypothetical protein CARUB_v10003311mg             118   6e-27   Capsella rubella
ref|XP_008788593.1|  PREDICTED: calcium-dependent protein kinase ...    118   6e-27   Phoenix dactylifera
ref|XP_006400491.1|  hypothetical protein EUTSA_v10013240mg             118   6e-27   Eutrema salsugineum [saltwater cress]
emb|CDX70450.1|  BnaC03g05340D                                          118   6e-27   
gb|AGG35954.1|  calcium-dependent protein kinase 34                     118   6e-27   Brassica napus [oilseed rape]
ref|XP_010420737.1|  PREDICTED: calcium-dependent protein kinase ...    118   6e-27   Camelina sativa [gold-of-pleasure]
gb|KFK26202.1|  hypothetical protein AALP_AA8G215800                    118   6e-27   Arabis alpina [alpine rockcress]
ref|XP_010454209.1|  PREDICTED: calcium-dependent protein kinase 34     118   7e-27   
emb|CDY63783.1|  BnaCnng42690D                                          118   8e-27   
ref|XP_009402456.1|  PREDICTED: calcium-dependent protein kinase ...    118   8e-27   
ref|XP_007146477.1|  hypothetical protein PHAVU_006G0437000g            117   9e-27   
gb|EYU40050.1|  hypothetical protein MIMGU_mgv1a011511mg                101   9e-27   
ref|XP_003556786.1|  PREDICTED: calcium-dependent protein kinase ...    118   1e-26   
ref|XP_010266343.1|  PREDICTED: uncharacterized protein LOC104603873    120   1e-26   
ref|XP_004491231.1|  PREDICTED: calcium-dependent protein kinase ...    117   1e-26   
ref|XP_001781985.1|  predicted protein                                  117   1e-26   
ref|XP_006452350.1|  hypothetical protein CICLE_v10007950mg             106   1e-26   
gb|KDO36585.1|  hypothetical protein CISIN_1g042977mg                   117   2e-26   
ref|NP_197437.1|  calcium-dependent protein kinase 34                   117   2e-26   
gb|ABV22562.1|  calcium-dependent protein kinase                        117   2e-26   
ref|XP_002873943.1|  calcium-dependent protein kinase 34                117   2e-26   
ref|XP_006446309.1|  hypothetical protein CICLE_v10014854mg             117   2e-26   
ref|XP_006470577.1|  PREDICTED: calcium-dependent protein kinase ...    117   2e-26   
ref|XP_001768980.1|  predicted protein                                  116   2e-26   
gb|ABV22565.1|  calcium-dependent protein kinase                        117   2e-26   
gb|EMS63097.1|  Calcium-dependent protein kinase isoform 11             107   3e-26   
ref|XP_007015253.1|  Calcium-dependent protein kinase 17                116   3e-26   
gb|KJB83565.1|  hypothetical protein B456_013G253100                    116   4e-26   
ref|XP_010922091.1|  PREDICTED: calcium-dependent protein kinase ...    116   4e-26   
gb|ABY59004.1|  calcium-dependent protein kinase                        107   4e-26   
ref|XP_008227265.1|  PREDICTED: calcium-dependent protein kinase ...    116   4e-26   
ref|XP_002977722.1|  calcium dependent protein kinase 17                116   4e-26   
ref|XP_010904692.1|  PREDICTED: calcium-dependent protein kinase ...    116   4e-26   
ref|XP_012073727.1|  PREDICTED: calcium-dependent protein kinase 29     116   4e-26   
ref|XP_002979552.1|  calcium dependent protein kinase 17                116   4e-26   
ref|XP_007213195.1|  hypothetical protein PRUPE_ppa026653mg             116   4e-26   
ref|XP_006475142.1|  PREDICTED: calcium-dependent protein kinase ...    105   4e-26   
gb|KDO62709.1|  hypothetical protein CISIN_1g010756mg                   104   5e-26   
ref|XP_006452360.1|  hypothetical protein CICLE_v10010555mg             104   5e-26   
ref|XP_006649323.1|  PREDICTED: calcium-dependent protein kinase ...    105   5e-26   
ref|XP_001771902.1|  predicted protein                                  115   5e-26   
gb|ABV22575.1|  calcium-dependent protein kinase                        117   5e-26   
ref|XP_006396673.1|  hypothetical protein EUTSA_v10028617mg             108   5e-26   
gb|KHN28162.1|  Calcium-dependent protein kinase 17                     115   5e-26   
ref|XP_002526062.1|  calcium-dependent protein kinase, putative         115   5e-26   
ref|XP_002299975.2|  hypothetical protein POPTR_0001s28150g             115   6e-26   
ref|XP_009414250.1|  PREDICTED: calcium-dependent protein kinase ...    114   6e-26   
ref|XP_006452356.1|  hypothetical protein CICLE_v10010666mg             115   6e-26   
ref|XP_006452348.1|  hypothetical protein CICLE_v10008325mg             114   7e-26   
ref|XP_006845045.1|  PREDICTED: calcium-dependent protein kinase 17     115   7e-26   
gb|KDO40816.1|  hypothetical protein CISIN_1g046082mg                   104   7e-26   
ref|XP_010229262.1|  PREDICTED: calcium-dependent protein kinase ...    105   7e-26   
gb|KDO37230.1|  hypothetical protein CISIN_1g047606mg                   115   7e-26   
gb|KDP43197.1|  hypothetical protein JCGZ_22749                         115   7e-26   
ref|XP_011073451.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    7e-26   
ref|XP_003558912.1|  PREDICTED: calcium-dependent protein kinase ...    105   7e-26   
gb|AHN49725.1|  calcium-dependent protein kinase 1                      115   7e-26   
ref|XP_012065867.1|  PREDICTED: calcium-dependent protein kinase 34     115   7e-26   
gb|KCW68005.1|  hypothetical protein EUGRSUZ_F01694                     114   8e-26   
ref|XP_006475082.1|  PREDICTED: calcium-dependent protein kinase ...    115   8e-26   
gb|AED99726.1|  stress-related calcium-dependent protein kinase         106   8e-26   
ref|XP_004293141.1|  PREDICTED: calcium-dependent protein kinase 34     115   8e-26   
ref|XP_006475079.1|  PREDICTED: calcium-dependent protein kinase ...    115   8e-26   
ref|XP_004228884.1|  PREDICTED: calcium-dependent protein kinase ...    115   8e-26   
ref|XP_004252886.1|  PREDICTED: calcium-dependent protein kinase ...    115   8e-26   
gb|EEE58262.1|  hypothetical protein OsJ_09266                          106   8e-26   
ref|XP_003528592.1|  PREDICTED: calcium-dependent protein kinase ...    115   9e-26   
gb|KCW68004.1|  hypothetical protein EUGRSUZ_F01694                     114   9e-26   
ref|XP_011024983.1|  PREDICTED: calcium-dependent protein kinase 17     115   9e-26   
ref|NP_001048842.1|  Os03g0128700                                       106   1e-25   
gb|EEC74439.1|  hypothetical protein OsI_09829                          106   1e-25   
gb|AGG35971.1|  calcium-dependent protein kinase 29                     115   1e-25   
gb|AAN17388.1|  Putative calcium dependent protein kinase               106   1e-25   
gb|AAC05270.1|  calcium dependent protein kinase                        106   1e-25   
emb|CDX73219.1|  BnaC06g36670D                                          115   1e-25   
ref|XP_008786936.1|  PREDICTED: calcium-dependent protein kinase ...    115   1e-25   
gb|ABF93782.1|  Calcium-dependent protein kinase, isoform 11, put...    106   1e-25   
ref|XP_010061106.1|  PREDICTED: calcium-dependent protein kinase ...    115   1e-25   
ref|XP_006452359.1|  hypothetical protein CICLE_v10007873mg             105   1e-25   
gb|AES59823.2|  calcium-dependent kinase                                115   1e-25   
ref|XP_006475081.1|  PREDICTED: calcium-dependent protein kinase ...    115   1e-25   
ref|XP_010247475.1|  PREDICTED: calcium-dependent protein kinase 34     114   1e-25   
gb|KJB55472.1|  hypothetical protein B456_009G078000                    114   1e-25   
gb|ABK63287.1|  calcium dependent protein kinase                        105   2e-25   
ref|XP_002970639.1|  calcium dependent protein kinase 17              99.8    2e-25   
emb|CDP20327.1|  unnamed protein product                                114   2e-25   
gb|AFZ84665.1|  CDPK                                                    105   2e-25   
ref|XP_010673770.1|  PREDICTED: calcium-dependent protein kinase ...    114   2e-25   
ref|XP_004499307.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    115   2e-25   
ref|XP_011080420.1|  PREDICTED: calcium-dependent protein kinase ...    114   2e-25   
ref|XP_009419685.1|  PREDICTED: calcium-dependent protein kinase ...    114   2e-25   
gb|AIU98504.1|  calcium-dependent protein kinase                        114   2e-25   
ref|XP_010106395.1|  Calcium-dependent protein kinase 17                114   2e-25   
ref|XP_002276630.2|  PREDICTED: calcium-dependent protein kinase ...    114   2e-25   
emb|CAN62888.1|  hypothetical protein VITISV_025544                     114   3e-25   
ref|XP_009620047.1|  PREDICTED: calcium-dependent protein kinase 29     114   3e-25   
ref|XP_002442700.1|  hypothetical protein SORBIDRAFT_08g001380          114   3e-25   
ref|XP_006473713.1|  PREDICTED: calcium-dependent protein kinase ...    113   3e-25   
gb|KDO84959.1|  hypothetical protein CISIN_1g010263mg                   112   3e-25   
ref|XP_010099802.1|  Calcium-dependent protein kinase 17                114   3e-25   
gb|EAZ40006.1|  hypothetical protein OsJ_24444                          113   3e-25   
ref|XP_009773532.1|  PREDICTED: calcium-dependent protein kinase ...    114   3e-25   
ref|XP_009627412.1|  PREDICTED: calcium-dependent protein kinase ...    114   3e-25   
gb|EPS70504.1|  calcium dependent protein kinase 25                     113   4e-25   
ref|XP_006473712.1|  PREDICTED: calcium-dependent protein kinase ...    113   4e-25   
ref|XP_008449648.1|  PREDICTED: calcium-dependent protein kinase ...    113   4e-25   
ref|XP_006435253.1|  hypothetical protein CICLE_v10000897mg             113   4e-25   
emb|CAD70166.1|  putative calcium-dependent protein kinase              108   4e-25   
emb|CAA57156.1|  calcium-dependent protein kinase                       103   4e-25   
ref|XP_009368734.1|  PREDICTED: calcium-dependent protein kinase ...    113   4e-25   
ref|XP_004980140.1|  PREDICTED: calcium-dependent protein kinase ...    113   5e-25   
ref|XP_003589572.1|  Calcium-dependent protein kinase                   115   5e-25   
ref|XP_004978350.1|  PREDICTED: calcium-dependent protein kinase ...    113   6e-25   
ref|XP_004140192.1|  PREDICTED: calcium-dependent protein kinase 34     113   6e-25   
ref|XP_009412989.1|  PREDICTED: calcium-dependent protein kinase ...    113   6e-25   
ref|XP_009408515.1|  PREDICTED: calcium-dependent protein kinase ...    104   6e-25   
ref|XP_010031714.1|  PREDICTED: calcium-dependent protein kinase ...    113   6e-25   
ref|XP_002510594.1|  calcium-dependent protein kinase, putative         112   7e-25   
ref|XP_002468587.1|  hypothetical protein SORBIDRAFT_01g048570          103   7e-25   
ref|XP_008365176.1|  PREDICTED: calcium-dependent protein kinase ...    112   8e-25   
ref|XP_008451994.1|  PREDICTED: calcium-dependent protein kinase 3      103   8e-25   
ref|XP_010266896.1|  PREDICTED: calcium-dependent protein kinase ...    112   9e-25   
ref|XP_011014420.1|  PREDICTED: calcium-dependent protein kinase ...    112   1e-24   
ref|XP_002313265.1|  calcium-dependent protein kinase                   112   1e-24   
ref|XP_010266895.1|  PREDICTED: calcium-dependent protein kinase ...    112   1e-24   
gb|AFW82380.1|  putative calcium-dependent protein kinase family ...    108   1e-24   
ref|XP_011009111.1|  PREDICTED: calcium-dependent protein kinase ...    112   1e-24   
ref|XP_003622837.1|  Calcium dependent protein kinase                   112   1e-24   
ref|XP_009398351.1|  PREDICTED: calcium-dependent protein kinase ...    102   1e-24   
ref|XP_006386161.1|  hypothetical protein POPTR_0002s01850g             112   1e-24   
ref|XP_006361005.1|  PREDICTED: calcium-dependent protein kinase ...    112   1e-24   
ref|XP_002306955.1|  hypothetical protein POPTR_0005s26640g             112   1e-24   
ref|XP_011459094.1|  PREDICTED: calcium-dependent protein kinase ...    111   1e-24   
gb|EYU46187.1|  hypothetical protein MIMGU_mgv1a004352mg                112   2e-24   
dbj|BAA81749.1|  calcium-dependent protein kinase                       112   2e-24   
sp|Q9ZSA3.2|CDPKM_ARATH  RecName: Full=Calcium-dependent protein ...    111   2e-24   
ref|XP_002968464.1|  calcium dependent protein kinase 17              97.4    2e-24   
ref|XP_002968465.1|  calcium dependent protein kinase 17              97.4    2e-24   
dbj|BAA81748.1|  calcium-dependent protein kinase                       111   2e-24   
emb|CDY43077.1|  BnaCnng10830D                                          111   2e-24   
ref|XP_003576346.1|  PREDICTED: calcium-dependent protein kinase ...    111   2e-24   
ref|XP_004250895.1|  PREDICTED: calcium-dependent protein kinase ...    111   2e-24   
ref|XP_004513232.1|  PREDICTED: calcium-dependent protein kinase ...    111   2e-24   
ref|XP_004291330.1|  PREDICTED: calcium-dependent protein kinase ...    111   2e-24   
ref|XP_004985870.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-depe...    101   2e-24   
ref|XP_006664312.1|  PREDICTED: calcium-dependent protein kinase ...    110   3e-24   
ref|XP_008798404.1|  PREDICTED: calcium-dependent protein kinase ...    111   3e-24   
ref|XP_008671573.1|  PREDICTED: calcium-dependent protein kinase ...    111   3e-24   
ref|XP_007160621.1|  hypothetical protein PHAVU_001G002800g             112   3e-24   
ref|NP_001267714.1|  calcium-dependent protein kinase 3-like            101   3e-24   
ref|XP_009630031.1|  PREDICTED: calcium-dependent protein kinase ...    111   3e-24   
dbj|BAK06618.1|  predicted protein                                      110   3e-24   
ref|XP_003564438.1|  PREDICTED: calcium-dependent protein kinase 34     110   4e-24   
ref|XP_006662719.1|  PREDICTED: calcium-dependent protein kinase ...    110   4e-24   
ref|XP_009106253.1|  PREDICTED: calcium-dependent protein kinase 29     111   4e-24   
emb|CBX25340.1|  hypothetical_protein                                   110   4e-24   
gb|KJB21813.1|  hypothetical protein B456_004G015100                    110   4e-24   
ref|XP_009796949.1|  PREDICTED: calcium-dependent protein kinase ...    110   4e-24   
gb|EAY76207.1|  hypothetical protein OsI_04143                          110   4e-24   
ref|NP_001266856.1|  calcium-dependent protein kinase                   110   4e-24   
gb|AAZ76712.1|  calcium-dependent protein kinase 1                      110   4e-24   
ref|XP_004238385.1|  PREDICTED: calcium-dependent protein kinase 29     110   4e-24   
ref|XP_006644875.1|  PREDICTED: calcium-dependent protein kinase ...    110   4e-24   
dbj|BAK06838.1|  predicted protein                                      110   4e-24   
ref|XP_003572014.1|  PREDICTED: calcium-dependent protein kinase ...    100   4e-24   
emb|CAG27840.1|  calcium-dependent protein kinase 17                    110   4e-24   
emb|CBX25242.1|  hypothetical_protein                                   110   4e-24   
ref|XP_006356386.1|  PREDICTED: calcium-dependent protein kinase ...    110   4e-24   
ref|NP_001044575.1|  Os01g0808400                                       110   5e-24   
gb|AFW84809.1|  putative calcium-dependent protein kinase family ...    109   5e-24   
gb|AFW64738.1|  putative calcium-dependent protein kinase family ...    110   5e-24   
tpg|DAA57188.1|  TPA: putative calcium-dependent protein kinase f...    110   5e-24   
ref|XP_002441304.1|  hypothetical protein SORBIDRAFT_09g024100          110   5e-24   
gb|EYU35947.1|  hypothetical protein MIMGU_mgv1a004350mg                110   5e-24   
emb|CDP07348.1|  unnamed protein product                                110   6e-24   
ref|XP_008387908.1|  PREDICTED: calcium-dependent protein kinase 29     110   6e-24   
gb|KJB31960.1|  hypothetical protein B456_005G216500                    110   6e-24   
gb|KDO62707.1|  hypothetical protein CISIN_1g043230mg                   108   6e-24   
emb|CDX85697.1|  BnaA02g01160D                                          110   6e-24   
gb|KJB31957.1|  hypothetical protein B456_005G216500                    110   6e-24   
ref|XP_008674922.1|  PREDICTED: calcium-dependent protein kinase 34     110   6e-24   
gb|KJB31959.1|  hypothetical protein B456_005G216500                    110   6e-24   
ref|XP_008802050.1|  PREDICTED: calcium-dependent protein kinase ...  93.2    7e-24   
ref|XP_008657141.1|  PREDICTED: calcium-dependent protein kinase ...    109   7e-24   
gb|AGT17455.1|  hypothetical protein SHCRBa_258_F08_F_40                109   8e-24   
gb|EPS59027.1|  hypothetical protein M569_15783                         108   8e-24   
gb|AGT15898.1|  calcium-dependent protein kinase                        109   8e-24   
emb|CDX91168.1|  BnaC02g04290D                                          109   9e-24   
ref|XP_007017899.1|  Calcium-dependent protein kinase 29                109   9e-24   
gb|AGT16545.1|  calcium-dependent protein kinase 34                     109   9e-24   
ref|XP_007145769.1|  hypothetical protein PHAVU_007G266100g           97.1    1e-23   
ref|XP_008800033.1|  PREDICTED: calcium-dependent protein kinase 29     109   1e-23   
gb|AGT17376.1|  calcium-dependent protein kinase                        109   1e-23   
ref|XP_010543629.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    1e-23   
ref|XP_006342079.1|  PREDICTED: calcium-dependent protein kinase ...    109   1e-23   
dbj|BAG87126.1|  unnamed protein product                                107   1e-23   
ref|XP_003578964.1|  PREDICTED: calcium-dependent protein kinase ...    109   1e-23   
ref|XP_002299904.1|  calcium-dependent protein kinase 1               99.4    1e-23   
ref|XP_002983821.1|  calcium dependent protein kinase 3               99.4    1e-23   
gb|KGN53365.1|  hypothetical protein Csa_4G050200                       101   1e-23   
ref|XP_007160628.1|  hypothetical protein PHAVU_001G003300g             107   1e-23   
ref|XP_009798869.1|  PREDICTED: calcium-dependent protein kinase 29     109   1e-23   
gb|EAY79844.1|  hypothetical protein OsI_35004                          106   1e-23   
ref|XP_010536433.1|  PREDICTED: calcium-dependent protein kinase 29     109   1e-23   
ref|XP_002989102.1|  calcium dependent protein kinase                 99.4    2e-23   
gb|ADE76782.1|  unknown                                                 106   2e-23   
ref|NP_001169430.1|  uncharacterized LOC100383301                       100   2e-23   
ref|XP_004961659.1|  PREDICTED: calcium-dependent protein kinase ...    109   2e-23   
ref|XP_002454465.1|  hypothetical protein SORBIDRAFT_04g031570          108   2e-23   
ref|XP_009404695.1|  PREDICTED: calcium-dependent protein kinase ...    108   2e-23   
ref|XP_002448943.1|  hypothetical protein SORBIDRAFT_05g002110          108   2e-23   
tpg|DAA43115.1|  TPA: putative calcium-dependent protein kinase f...    100   2e-23   
ref|XP_011045425.1|  PREDICTED: calcium-dependent protein kinase ...  98.6    2e-23   
ref|XP_009397608.1|  PREDICTED: calcium-dependent protein kinase ...    108   2e-23   
gb|KHN16772.1|  Calcium-dependent protein kinase 3                      103   2e-23   
gb|KJB35709.1|  hypothetical protein B456_006G124800                    108   2e-23   
gb|EYU23402.1|  hypothetical protein MIMGU_mgv1a004683mg              96.3    2e-23   
gb|KJB61965.1|  hypothetical protein B456_009G394700                  99.8    2e-23   
gb|EEC67625.1|  hypothetical protein OsI_35012                          107   2e-23   
ref|XP_009414363.1|  PREDICTED: calcium-dependent protein kinase 17     108   2e-23   
ref|XP_010269425.1|  PREDICTED: calcium-dependent protein kinase ...    108   3e-23   
gb|AFW82381.1|  putative calcium-dependent protein kinase family ...    108   3e-23   
ref|XP_010269424.1|  PREDICTED: calcium-dependent protein kinase ...    108   3e-23   
ref|XP_010055801.1|  PREDICTED: calcium-dependent protein kinase 3      108   3e-23   
ref|XP_001775548.1|  predicted protein                                  108   3e-23   
ref|XP_002284750.2|  PREDICTED: calcium-dependent protein kinase 29     108   3e-23   
gb|AEY99978.1|  calcium-dependent protein kinase                        107   3e-23   
ref|XP_010266261.1|  PREDICTED: calcium-dependent protein kinase ...    108   4e-23   



>gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng]
Length=549

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 116/187 (62%), Gaps = 39/187 (21%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVT-ESHQKASSTHAQTYTQPERP-------  359
            MGGC SK +  Q DVNGYR GR   TGYQ V+ + ++K S+ +  T  Q           
Sbjct  1    MGGCASKKQDYQADVNGYRSGRNGGTGYQTVSGQGYEKPSTQYNPTQPQRPHQTQPQPQP  60

Query  360  ------------YNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  503
                        +NP P+   PVH P                EPN ILGK FEDI+AHY+
Sbjct  61   KQPAPAPLKPAAHNPSPR---PVHKP----------------EPNTILGKKFEDIRAHYT  101

Query  504  LGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNI  683
            LGKELGRGQFGVTYLCTEIS+   YACKSILKRKLVSKNDKED+KREIQIMQHLSGQP+I
Sbjct  102  LGKELGRGQFGVTYLCTEISSGHFYACKSILKRKLVSKNDKEDMKREIQIMQHLSGQPDI  161

Query  684  VLXAGCF  704
            V   G +
Sbjct  162  VEFKGAY  168



>emb|CDP04396.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 121/173 (70%), Gaps = 10/173 (6%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATG-----YQPVTESHQKASSTHAQTYTQPERPYNP  368
            MGGCFSK K  Q  +NG+R G G A       YQ   +++QK +  +     Q ER Y P
Sbjct  1    MGGCFSKKKYPQSSINGHRSGGGAAAAATTTAYQQSYQTNQKQAVQYTPQPHQAERFYQP  60

Query  369  QPQSYAPVHVPAKpssvpqpvrp-vqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
            QP    P  VPAKPS+ P       QR EPN ILGKPF+D++AHY+LG+ELG+GQFGVTY
Sbjct  61   QP----PSSVPAKPSAQPPQRPRPAQRQEPNTILGKPFDDVRAHYTLGRELGKGQFGVTY  116

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            LCTE +T + YACKSILKRKLVSKNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  117  LCTENATGQKYACKSILKRKLVSKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  169



>ref|XP_011086186.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=543

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 114/177 (64%), Gaps = 22/177 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGCFSK+K    DVNGYR G    TGYQ   +SHQ         Y +P   Y PQPQ+ 
Sbjct  1    MGGCFSKNKYSSPDVNGYRSGTA-GTGYQ---QSHQD--------YQKPSTQYTPQPQAE  48

Query  384  APVHVPAKpssvpqp----------vrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQF  533
               H    P   PQ              VQ+ E NNILGKPFED+K+ Y++ KELGRGQF
Sbjct  49   PERHHQPPPPRQPQNPAPLRPAPQPQNTVQKLEHNNILGKPFEDVKSKYTISKELGRGQF  108

Query  534  GVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            GVTYLCT+++T   YACKSILKRKLVSKNDKED+KRE+ IMQHLSGQPNIV   G +
Sbjct  109  GVTYLCTDVATGNQYACKSILKRKLVSKNDKEDMKREVHIMQHLSGQPNIVEFKGTY  165



>ref|XP_009597333.1| PREDICTED: calcium-dependent protein kinase-like [Nicotiana tomentosiformis]
Length=539

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 108/167 (65%), Gaps = 7/167 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGCFSK+K  Q D   YR  RG    YQP    H +    + + Y +P     PQ + Y
Sbjct  1    MGGCFSKNKYGQPDGKRYRPRRGANAAYQPY--QHYQHPVYYHRNYQRP-----PQERQY  53

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P H   +   VP         E + ILGKPFEDIKAHY+LG+ELGRGQ+GV Y CTEIS
Sbjct  54   KPPHSQQQVQQVPVKNSQPHFQEQDTILGKPFEDIKAHYTLGQELGRGQYGVIYHCTEIS  113

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T +AYACKSILKRKLVSK DKEDIK EIQIMQHLSGQPNIV   G +
Sbjct  114  TGQAYACKSILKRKLVSKKDKEDIKNEIQIMQHLSGQPNIVEFKGAY  160



>ref|XP_011096067.1| PREDICTED: calcium-dependent protein kinase-like [Sesamum indicum]
Length=541

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 111/181 (61%), Gaps = 32/181 (18%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ--  377
            MGGC SK++    D+NGYR G    TGYQ   +SHQ         Y +P   Y PQP+  
Sbjct  1    MGGCCSKNEPSTRDINGYRSGGAGNTGYQ---QSHQ---------YQKPSTQYTPQPERH  48

Query  378  ------------SYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELG  521
                          AP H PA               E NNILGKPFED+K+ Y++GKELG
Sbjct  49   HHPTPPTQPHPPIPAP-HGPAPQPQNAVQKL-----EHNNILGKPFEDVKSKYTIGKELG  102

Query  522  RGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGC  701
            RGQFGVTY CTEI+T + YACKSILKRKLVSKNDKED+KRE+ IMQHLSGQPNIV   G 
Sbjct  103  RGQFGVTYSCTEIATGQQYACKSILKRKLVSKNDKEDMKREVHIMQHLSGQPNIVEFKGA  162

Query  702  F  704
            F
Sbjct  163  F  163



>ref|XP_007213894.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
 gb|EMJ15093.1| hypothetical protein PRUPE_ppa003830mg [Prunus persica]
Length=545

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 109/175 (62%), Gaps = 18/175 (10%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTE--SHQKASSTHAQTYTQPER------P  359
            MG C SKSK  +   NGYR G G    YQ   E  +HQ  +S     +  PE+       
Sbjct  1    MGKCLSKSKDSEPQYNGYRSGGGAGAHYQKPHEPVAHQPKASAQQARHQLPEKRGSAAAQ  60

Query  360  YNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGV  539
              PQP ++ P  VP K               P+ ILGKPFED+K HY++GKELGRGQFGV
Sbjct  61   QEPQP-AWKP-SVPVKSPKPVY--------RPDTILGKPFEDVKQHYTIGKELGRGQFGV  110

Query  540  TYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TYLCTE ST   YACKSI KRKLV+KNDKEDIKREIQIMQHLSGQPNIV   GC+
Sbjct  111  TYLCTENSTGNKYACKSISKRKLVTKNDKEDIKREIQIMQHLSGQPNIVEFKGCY  165



>ref|XP_010276092.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=538

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 110/171 (64%), Gaps = 17/171 (10%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPERPYNPQ  371
            MG C SK K  + DVNG+R G  V    Q    PV ++  K  +   QT+  PER   PQ
Sbjct  1    MGLCISKEKVPEPDVNGHRSGANVVRHQQRRQEPVVQAQPKIPAQ--QTHLLPER-RQPQ  57

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
            P + APV          +P       + + ILGKPFEDIKAHY+LGKELGRGQFGVTYLC
Sbjct  58   PPAAAPV----------KPSPHSLVHKQDTILGKPFEDIKAHYTLGKELGRGQFGVTYLC  107

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST   YACKSI KRKLVSKNDK+DIKREIQIMQHL+GQ NIV   G +
Sbjct  108  TENSTGHTYACKSISKRKLVSKNDKDDIKREIQIMQHLTGQANIVEFKGAY  158



>ref|XP_008226901.1| PREDICTED: calcium-dependent protein kinase 2 [Prunus mume]
Length=545

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 105/177 (59%), Gaps = 22/177 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTE--SHQKASSTHAQTYTQPER-------  356
            MG C SKSK  +   NGYR G G    YQ   E  + Q  +S     +  PE+       
Sbjct  1    MGKCLSKSKDSEPQYNGYRSGGGAGAHYQKPHEPVAPQPKASAQQAHHQLPEKRGSAAAH  60

Query  357  -PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQF  533
                P  + Y PV  P                 P+ ILGKP+ED+K HY++GKELGRGQF
Sbjct  61   QELQPAWKPYVPVKSP------------KPVYRPDTILGKPYEDVKQHYTIGKELGRGQF  108

Query  534  GVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            GVTYLCTE ST   YACKSI KRKLV+KNDKEDIKREIQIMQHLSGQPNIV   GC+
Sbjct  109  GVTYLCTENSTGNKYACKSISKRKLVTKNDKEDIKREIQIMQHLSGQPNIVEFKGCY  165



>ref|XP_009776260.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Nicotiana 
sylvestris]
Length=503

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 111/174 (64%), Gaps = 9/174 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQP--ERPYNPQPQ  377
            MGGCFSK+K  Q D   YR  RG    YQP    H +    + Q Y +P  ERPY  + Q
Sbjct  1    MGGCFSKNKYGQPDGKRYRPRRGANAAYQPY--QHYQHPVYYHQNYQRPPQERPYKTRAQ  58

Query  378  SYAPVH-----VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  542
                       V   P    QP    QR E + ILGKPFEDIKAHY+LG+ELGRGQ+GV 
Sbjct  59   QQQQQQQQQQQVHQNPVKNSQPHIQEQRIEQDTILGKPFEDIKAHYTLGQELGRGQYGVI  118

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            Y CTEIST + YACKSILKRKLV+K DKEDIKREIQIMQHLSGQPNIV   G +
Sbjct  119  YHCTEISTGQPYACKSILKRKLVNKKDKEDIKREIQIMQHLSGQPNIVEFKGAY  172



>ref|XP_009776253.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Nicotiana 
sylvestris]
Length=551

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 111/174 (64%), Gaps = 9/174 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQP--ERPYNPQPQ  377
            MGGCFSK+K  Q D   YR  RG    YQP    H +    + Q Y +P  ERPY  + Q
Sbjct  1    MGGCFSKNKYGQPDGKRYRPRRGANAAYQPY--QHYQHPVYYHQNYQRPPQERPYKTRAQ  58

Query  378  SYAPVH-----VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  542
                       V   P    QP    QR E + ILGKPFEDIKAHY+LG+ELGRGQ+GV 
Sbjct  59   QQQQQQQQQQQVHQNPVKNSQPHIQEQRIEQDTILGKPFEDIKAHYTLGQELGRGQYGVI  118

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            Y CTEIST + YACKSILKRKLV+K DKEDIKREIQIMQHLSGQPNIV   G +
Sbjct  119  YHCTEISTGQPYACKSILKRKLVNKKDKEDIKREIQIMQHLSGQPNIVEFKGAY  172



>ref|XP_009360996.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=544

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 107/170 (63%), Gaps = 9/170 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGY---RQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C SKSK  +   NGY     G G    +Q    SH+ A++ H Q   +   P N +P
Sbjct  1    MGKCLSKSKDSERQRNGYISVGGGEGGGGVHQQKPHSHE-AAAVHQQRPEKRGLPVNQEP  59

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            Q      VPA+                N ILGKPFED++ HY++GKELGRGQFGVTYLCT
Sbjct  60   QPAWKPTVPARTPKPAAQRPA-----DNTILGKPFEDVRVHYTIGKELGRGQFGVTYLCT  114

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            EIST + YACKSI KRKLV+KNDKEDIKREIQIMQ LSGQPNIV   GC+
Sbjct  115  EISTGKKYACKSISKRKLVTKNDKEDIKREIQIMQDLSGQPNIVEFKGCY  164



>ref|XP_008365060.1| PREDICTED: calcium-dependent protein kinase 2 [Malus domestica]
Length=544

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 105/172 (61%), Gaps = 13/172 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ--PER---PYNP  368
            MG C SKSK  +   NGYR    V  G       HQK  S  A    Q  PER   P N 
Sbjct  1    MGKCLSKSKDSERQHNGYR---SVGGGEGGGGVHHQKPHSHEAAAVHQQRPERRGLPVNQ  57

Query  369  QPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
            +PQ      V AK      P         N ILGKPFED++ HY++GKELGRGQFGVTYL
Sbjct  58   EPQPAWKPTVXAKTPKPVAPRPA-----DNTILGKPFEDVRVHYTIGKELGRGQFGVTYL  112

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            CTEIST + YACKSI KRKLV+KNDKEDIKREIQIMQ LSGQPN V   GC+
Sbjct  113  CTEISTGKKYACKSISKRKLVTKNDKEDIKREIQIMQDLSGQPNXVEFKGCY  164



>ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=541

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 105/171 (61%), Gaps = 12/171 (7%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPERPYNPQ  371
            MG C SKS+  +   NGYR G G    YQ    PV    + ++  H Q   +     + +
Sbjct  1    MGKCLSKSREPEPQHNGYRSGGGAGAHYQKPHEPVVHQPKASAQQHHQIPEKRGMAAHQE  60

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
            PQ      VPA+               P+ ILGKP+ED+K HY+LGKELGRGQFGVTYLC
Sbjct  61   PQPAWKPSVPARHPKPVH--------RPDTILGKPYEDVKLHYTLGKELGRGQFGVTYLC  112

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST   YACKSI KRKLV+KNDKEDIKREIQI+QHLSGQPNIV   G +
Sbjct  113  TENSTGMKYACKSISKRKLVTKNDKEDIKREIQILQHLSGQPNIVEFKGSY  163



>ref|XP_011047988.1| PREDICTED: calcium-dependent protein kinase-like isoform X2 [Populus 
euphratica]
Length=533

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 107/176 (61%), Gaps = 30/176 (17%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGY---------QPVTESHQKASSTHAQTYTQPER  356
            MG C SK  +R+ DVNGYR   G ATGY             +S QK +    QT T P R
Sbjct  1    MGCCASKENARRPDVNGYR---GPATGYPRQTNQQQQPQYHQSQQKVTVPQIQTQTPPTR  57

Query  357  PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFG  536
            P   Q Q+  P   P                 P+ ILGKPFEDIK HY+LGKELGRGQFG
Sbjct  58   PQQTQHQT--PPTRPV----------------PDTILGKPFEDIKQHYTLGKELGRGQFG  99

Query  537  VTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            VTYLCTE ST   YACKSILKRKLV+KND+ED+KRE+ IMQ LSGQPNIV   G +
Sbjct  100  VTYLCTENSTGHTYACKSILKRKLVNKNDREDMKREVHIMQDLSGQPNIVEFRGAY  155



>ref|XP_011047987.1| PREDICTED: calcium-dependent protein kinase-like isoform X1 [Populus 
euphratica]
Length=544

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 110/176 (63%), Gaps = 19/176 (11%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGY---------QPVTESHQKASSTHAQTYTQPER  356
            MG C SK  +R+ DVNGYR   G ATGY             +S QK +    QT T P R
Sbjct  1    MGCCASKENARRPDVNGYR---GPATGYPRQTNQQQQPQYHQSQQKVTVPQIQTQTPPTR  57

Query  357  PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFG  536
            P   Q Q+        +  +  +PV       P+ ILGKPFEDIK HY+LGKELGRGQFG
Sbjct  58   PQQTQHQTPPARPQQTQQQTPTRPV-------PDTILGKPFEDIKQHYTLGKELGRGQFG  110

Query  537  VTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            VTYLCTE ST   YACKSILKRKLV+KND+ED+KRE+ IMQ LSGQPNIV   G +
Sbjct  111  VTYLCTENSTGHTYACKSILKRKLVNKNDREDMKREVHIMQDLSGQPNIVEFRGAY  166



>gb|KJB81729.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=444

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 107/173 (62%), Gaps = 22/173 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC +K+K      NGYR G   AT            ++ H Q Y  P RP   QPQ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDPVRPAPIQPQVY  47

Query  384  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQFGVTY  104

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             CTE ST + YACK+I KRKLV KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  105  HCTENSTGKQYACKTISKRKLVRKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  157



>gb|KJB81728.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=480

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 107/173 (62%), Gaps = 22/173 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC +K+K      NGYR G   AT            ++ H Q Y  P RP   QPQ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDPVRPAPIQPQVY  47

Query  384  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQFGVTY  104

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             CTE ST + YACK+I KRKLV KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  105  HCTENSTGKQYACKTISKRKLVRKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  157



>ref|XP_010278695.1| PREDICTED: calcium-dependent protein kinase 2-like [Nelumbo nucifera]
Length=539

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 103/171 (60%), Gaps = 16/171 (9%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPERPYNPQ  371
            MG CFSK    Q DVNG+R G  VA   Q    PV  +  K  +   QT   PERP   Q
Sbjct  1    MGHCFSKDNVSQLDVNGHRSGADVARHQQRRQEPVVHTQHKPPAQQ-QTRPLPERP-KTQ  58

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
            P + APV                       ILGKPFED+K+HY++ KELGRGQFGVTYLC
Sbjct  59   PLAPAPVR----------SSPYSLTHRQETILGKPFEDVKSHYTIRKELGRGQFGVTYLC  108

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             E ST   YACKSI KRKLVSKNDK+DI+REIQIMQHL+GQ NIV   G +
Sbjct  109  IENSTGHTYACKSISKRKLVSKNDKDDIRREIQIMQHLTGQANIVEFKGAY  159



>gb|KJB81727.1| hypothetical protein B456_013G159300 [Gossypium raimondii]
Length=536

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 107/173 (62%), Gaps = 22/173 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC +K+K      NGYR G   AT            ++ H Q Y  P RP   QPQ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDPVRPAPIQPQVY  47

Query  384  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPTPNIDTILGKPFEDIRIHYTIGKELGKGQFGVTY  104

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             CTE ST + YACK+I KRKLV KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  105  HCTENSTGKQYACKTISKRKLVRKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  157



>ref|XP_007020822.1| Calmodulin-domain protein kinase 9 isoform 3 [Theobroma cacao]
 gb|EOY12347.1| Calmodulin-domain protein kinase 9 isoform 3 [Theobroma cacao]
Length=382

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 105/173 (61%), Gaps = 22/173 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC +KSK  +   NGYR G                  + H Q Y +P RP   QPQ +
Sbjct  1    MGGCLTKSKEPKPKHNGYRSGATTTV-------------AVHQQRYQEPVRPAPVQPQFH  47

Query  384  APVHVPAK------pssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
               H+P K         V     P   P  + ILGKP+EDI+  Y++GKELG+GQFGVTY
Sbjct  48   ---HIPEKPGAQTPWKPVAPAPSPKPAPRVDTILGKPYEDIRMRYTIGKELGKGQFGVTY  104

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            LCTE ST + YACK+I KRKLV+KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  105  LCTENSTGKQYACKTISKRKLVTKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  157



>sp|P28582.2|CDPK_DAUCA RecName: Full=Calcium-dependent protein kinase; Short=CDPK [Daucus 
carota]
 emb|CAA39936.1| calcium- dependent protein kinase [Daucus carota]
Length=532

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 103/169 (61%), Gaps = 22/169 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGCFSK K  Q D NGYR      T Y  VT+   + SS  +Q   QP+        S 
Sbjct  1    MGGCFSK-KEYQADGNGYRSA---PTAYHTVTDQSYEKSSQRSQPQAQPQPQVQQTGPSL  56

Query  384  AP--VHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  557
             P  VH P                E N ILGKPFEDI+  Y+LGKELGRGQFG  Y CTE
Sbjct  57   KPRQVHRP----------------ESNTILGKPFEDIRGKYTLGKELGRGQFGCVYQCTE  100

Query  558  ISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             S+ + YACKSILKRKLVSKNDKEDIKREIQI+QHLSGQPNIV   G F
Sbjct  101  NSSGQLYACKSILKRKLVSKNDKEDIKREIQILQHLSGQPNIVEFKGVF  149



>gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata]
Length=539

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 104/167 (62%), Gaps = 7/167 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGCFSK K    D NGYR      T Y        +   T           YNP P   
Sbjct  1    MGGCFSKGKYSSPDANGYRSAN---TAYNQQNYEKPQPQYTPQPPTQPERHHYNPPPPPP  57

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                    P   PQP  PVQ+ EPNNILGKPFED+K+HY++GKELGRGQFGVTY C EIS
Sbjct  58   PK----TSPPPQPQPQHPVQKLEPNNILGKPFEDVKSHYTVGKELGRGQFGVTYSCIEIS  113

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSILKRKLVSKNDK+D+KRE+ IMQHLSGQPNIV   G +
Sbjct  114  TGHHYACKSILKRKLVSKNDKDDMKREVHIMQHLSGQPNIVEFKGAY  160



>gb|KDO62721.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=207

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 108/168 (64%), Gaps = 20/168 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  380
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R +ACKSI KRKLV+KNDK+DIKREIQIMQHLSGQPNIV   G +
Sbjct  102  STGRQFACKSISKRKLVTKNDKDDIKREIQIMQHLSGQPNIVEFKGAY  149



>ref|XP_007020821.1| Calmodulin-domain protein kinase 9 isoform 2 [Theobroma cacao]
 gb|EOY12346.1| Calmodulin-domain protein kinase 9 isoform 2 [Theobroma cacao]
Length=390

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 105/173 (61%), Gaps = 22/173 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC +KSK  +   NGYR G                  + H Q Y +P RP   QPQ +
Sbjct  1    MGGCLTKSKEPKPKHNGYRSGATTTV-------------AVHQQRYQEPVRPAPVQPQFH  47

Query  384  APVHVPAK------pssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
               H+P K         V     P   P  + ILGKP+EDI+  Y++GKELG+GQFGVTY
Sbjct  48   ---HIPEKPGAQTPWKPVAPAPSPKPAPRVDTILGKPYEDIRMRYTIGKELGKGQFGVTY  104

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            LCTE ST + YACK+I KRKLV+KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  105  LCTENSTGKQYACKTISKRKLVTKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  157



>gb|KDO62718.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62719.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
 gb|KDO62720.1| hypothetical protein CISIN_1g0096582mg, partial [Citrus sinensis]
Length=235

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 108/168 (64%), Gaps = 20/168 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  380
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R +ACKSI KRKLV+KNDK+DIKREIQIMQHLSGQPNIV   G +
Sbjct  102  STGRQFACKSISKRKLVTKNDKDDIKREIQIMQHLSGQPNIVEFKGAY  149



>ref|XP_009627158.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
tomentosiformis]
Length=534

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 108/167 (65%), Gaps = 12/167 (7%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGCFSK  +R+G   GYR  R      + V + ++K      +   QP+    PQPQ++
Sbjct  1    MGGCFSKKYTREGAKGGYRATR------RNVNQEYKKTPQPQPERPYQPQPQPQPQPQAH  54

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                 PA+     Q          NNILGKPFEDI+ HY+LGKELGRGQFGVTY CTE S
Sbjct  55   TVTAQPAQTQDQMQGPHL------NNILGKPFEDIRKHYTLGKELGRGQFGVTYHCTENS  108

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSILKRKLVSKND+ED+KREIQIMQHLSGQPNIV   G +
Sbjct  109  TGNPYACKSILKRKLVSKNDREDMKREIQIMQHLSGQPNIVEFKGAY  155



>ref|XP_007020820.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
 gb|EOY12345.1| Calmodulin-domain protein kinase 9 isoform 1 [Theobroma cacao]
Length=536

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 105/173 (61%), Gaps = 22/173 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC +KSK  +   NGYR G                  + H Q Y +P RP   QPQ +
Sbjct  1    MGGCLTKSKEPKPKHNGYRSGATTTV-------------AVHQQRYQEPVRPAPVQPQFH  47

Query  384  APVHVPAK------pssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
               H+P K         V     P   P  + ILGKP+EDI+  Y++GKELG+GQFGVTY
Sbjct  48   ---HIPEKPGAQTPWKPVAPAPSPKPAPRVDTILGKPYEDIRMRYTIGKELGKGQFGVTY  104

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            LCTE ST + YACK+I KRKLV+KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  105  LCTENSTGKQYACKTISKRKLVTKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  157



>gb|KHG17079.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=536

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 106/173 (61%), Gaps = 22/173 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC +K+K      NGYR G   AT            ++ H Q Y    RP   QP+ Y
Sbjct  1    MGGCLTKNKDPMPQHNGYRSG---AT----------TTAAVHQQRYQDTVRPAPIQPRVY  47

Query  384  APVHVPAKpssvpqpvrpvqrpEP------NNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
               H+P KP +       V  P P      + ILGKPFEDI+ HY++GKELG+GQFGVTY
Sbjct  48   ---HIPQKPGTQTPWKPAVPAPSPKPAPNIDTILGKPFEDIRMHYTIGKELGKGQFGVTY  104

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             CTE ST + YACK+I KRKLV KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  105  HCTENSTGKQYACKTISKRKLVRKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  157



>gb|KHG28675.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=537

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 107/174 (61%), Gaps = 23/174 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C +KSK  +   NGY  G        P T      ++ H Q Y +P RP   QPQ +
Sbjct  1    MGTCLTKSKDSKPTHNGYGSG--------PTT-----TAAVHQQRYQEPVRPAPVQPQFH  47

Query  384  APVHVPAKpssvpqpvrpvqrpEP-------NNILGKPFEDIKAHYSLGKELGRGQFGVT  542
               H+P KP +          P P       + ILGKPFEDI+ HY++GKELG+GQFGVT
Sbjct  48   ---HIPEKPGTQTPWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVT  104

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            YLC E ST + YACK+I K+KLV++NDKED++REIQIMQHLSGQPNIV   G +
Sbjct  105  YLCIENSTGKQYACKTISKKKLVTRNDKEDMRREIQIMQHLSGQPNIVEFKGAY  158



>ref|XP_004500067.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Cicer 
arietinum]
Length=548

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 106/170 (62%), Gaps = 11/170 (6%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDV--NGYRQG-RGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C SK K    +   NGYR G   V   ++   + +Q  +ST   T  QP++  +   
Sbjct  1    MGSCISKGKDSDSEAEQNGYRYGGNSVVNNHRNNEKVNQTRTSTQPSTSNQPQKHVSSTH  60

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
               + V VP+    + Q        E N ILGK FED+K  Y+LGKELGRGQFGVTYLCT
Sbjct  61   MKPSSVSVPSPKPFMKQ--------ETNTILGKGFEDVKDFYTLGKELGRGQFGVTYLCT  112

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST+  YACKSI K+KLVSK+D+EDIKREIQIMQHLSGQPNIV   G +
Sbjct  113  ENSTKLLYACKSISKKKLVSKSDREDIKREIQIMQHLSGQPNIVEFKGAY  162



>gb|KJB13681.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=481

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 106/174 (61%), Gaps = 23/174 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C +KSK  +   NGY  G        P T      ++ H Q Y +P RP   Q Q +
Sbjct  1    MGSCLTKSKDSKPKHNGYGSG--------PTT-----TAAVHQQRYQEPVRPAPVQSQFH  47

Query  384  APVHVPAKpssvpqpvrpvqrpEP-------NNILGKPFEDIKAHYSLGKELGRGQFGVT  542
               H+P KP +          P P       + ILGKPFEDI+ HY++GKELG+GQFGVT
Sbjct  48   ---HIPEKPGTQTSWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVT  104

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            YLC E ST + YACK+I K+KLV++NDKED++REIQIMQHLSGQPNIV   G +
Sbjct  105  YLCIENSTGKQYACKTISKKKLVTRNDKEDMRREIQIMQHLSGQPNIVEFKGAY  158



>gb|KCW66999.1| hypothetical protein EUGRSUZ_F007611, partial [Eucalyptus grandis]
Length=346

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 103/168 (61%), Gaps = 6/168 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R YACKSI KRKLV+KNDKED+KREI IMQHLSGQPNIV   G +
Sbjct  116  STGRQYACKSISKRKLVTKNDKEDMKREIHIMQHLSGQPNIVEFKGAY  163



>ref|XP_006452370.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65610.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=472

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 108/168 (64%), Gaps = 20/168 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  380
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R +ACKSI KRKLV+KNDK+DIKREIQIMQHLSGQPNIV   G +
Sbjct  102  STGRQFACKSISKRKLVTKNDKDDIKREIQIMQHLSGQPNIVEFKGAY  149



>gb|KJB13679.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13680.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
 gb|KJB13682.1| hypothetical protein B456_002G088800 [Gossypium raimondii]
Length=537

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 106/174 (61%), Gaps = 23/174 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C +KSK  +   NGY  G        P T      ++ H Q Y +P RP   Q Q +
Sbjct  1    MGSCLTKSKDSKPKHNGYGSG--------PTT-----TAAVHQQRYQEPVRPAPVQSQFH  47

Query  384  APVHVPAKpssvpqpvrpvqrpEP-------NNILGKPFEDIKAHYSLGKELGRGQFGVT  542
               H+P KP +          P P       + ILGKPFEDI+ HY++GKELG+GQFGVT
Sbjct  48   ---HIPEKPGTQTSWKPVAPSPSPKPVAPRVDTILGKPFEDIRMHYTIGKELGKGQFGVT  104

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            YLC E ST + YACK+I K+KLV++NDKED++REIQIMQHLSGQPNIV   G +
Sbjct  105  YLCIENSTGKQYACKTISKKKLVTRNDKEDMRREIQIMQHLSGQPNIVEFKGAY  158



>ref|XP_012070829.1| PREDICTED: calcium-dependent protein kinase 33-like [Jatropha 
curcas]
 ref|XP_012070830.1| PREDICTED: calcium-dependent protein kinase 33-like [Jatropha 
curcas]
 gb|KDP39132.1| hypothetical protein JCGZ_00889 [Jatropha curcas]
Length=535

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 108/168 (64%), Gaps = 14/168 (8%)
 Frame = +3

Query  204  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MG CFSK K + Q   NG  +            + HQKA          P +P    P  
Sbjct  1    MGHCFSKDKKAHQQHYNGADR-----------MQHHQKAQEPVTYQSKSPVQPTYQLPSQ  49

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
              P+HVP KP++     +PVQ  +P+ IL KPFED++ HY++GKELGRGQFGVTYLCTE 
Sbjct  50   QPPIHVPRKPAAPAPSPKPVQ--KPDTILEKPFEDLRLHYTIGKELGRGQFGVTYLCTEN  107

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R YACKSI KRKLV+KNDKED+KREIQIMQHLSGQPNIV   G +
Sbjct  108  STGRRYACKSISKRKLVTKNDKEDMKREIQIMQHLSGQPNIVEFKGAY  155



>ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
 gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina]
Length=529

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 108/168 (64%), Gaps = 20/168 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  380
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R +ACKSI KRKLV+KNDK+DIKREIQIMQHLSGQPNIV   G +
Sbjct  102  STGRQFACKSISKRKLVTKNDKDDIKREIQIMQHLSGQPNIVEFKGAY  149



>ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo]
Length=552

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 111/177 (63%), Gaps = 15/177 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATG--YQPVTESHQKASST---HAQTYTQPERPYN-  365
            MG C S  K     +NG+   RGVAT   YQP    +Q  S+    H  +  Q + P N 
Sbjct  1    MGCCSSTQKPPSSGINGFDAARGVATRGPYQP----YQPQSTVPIPHKVSAPQTQIPSNR  56

Query  366  --PQPQSYAPVHVPAKpssvpqpvrpvqrpE--PNNILGKPFEDIKAHYSLGKELGRGQF  533
              PQP   A  H P+  +     V   +  +  P  ILG+P++DIK +Y+LGKELGRGQF
Sbjct  57   NQPQPPPTAE-HPPSASAFSKPAVSTPRTAQNYPETILGRPYDDIKKYYTLGKELGRGQF  115

Query  534  GVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            G+TYLCTE ST + YACKSILKRKL+SKNDK+D+KREI I+QHLSGQPNIV   G +
Sbjct  116  GITYLCTENSTGQTYACKSILKRKLISKNDKDDMKREILILQHLSGQPNIVEFKGAY  172



>ref|XP_006350481.1| PREDICTED: calcium-dependent protein kinase-like [Solanum tuberosum]
Length=545

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 108/173 (62%), Gaps = 13/173 (8%)
 Frame = +3

Query  204  MGGCFSKSK--SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ  377
            MGGCFSK+K   R G  N  R  RG      P +  H K    +    TQ ERPY PQ  
Sbjct  1    MGGCFSKNKYIERDGKGNRPRTRRGNT----PASYQHYKHPVYYHPRPTQ-ERPYMPQHP  55

Query  378  SYAPVH----VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
                      V  K +    PV      +P  ILGKP+E+IKAHY+LG+ELGRGQ+GV Y
Sbjct  56   QQQQQRHAHQVTVKSTQPNVPVIQRIEQDP--ILGKPYENIKAHYTLGRELGRGQYGVIY  113

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            LCTE STRR YACKSILKRKLV++ D+EDIKREIQ+MQHLSGQPNIV   G +
Sbjct  114  LCTENSTRRNYACKSILKRKLVNRKDREDIKREIQMMQHLSGQPNIVEFKGAY  166



>ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=680

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 108/168 (64%), Gaps = 20/168 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASS-THAQTYTQPERPYNPQPQS  380
            MGGC +KSK  +         R  A GY+    +  KA +    Q + +PE+P  P P +
Sbjct  1    MGGCLTKSKDPKP--------RHYAHGYRSSPNTVAKAPAPAQQQAHHRPEKP-GPTPAA  51

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
             APV             + V RP+ N ILGKP+ED+K HYS GKELGRGQFGVTYLCTE 
Sbjct  52   -APV---------SGLKQAVPRPDTNTILGKPYEDVKLHYSFGKELGRGQFGVTYLCTEN  101

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R +ACKSI KRKLV+KNDK+DIKREIQIMQHLSGQPNIV   G +
Sbjct  102  STGRQFACKSISKRKLVTKNDKDDIKREIQIMQHLSGQPNIVEFKGAY  149



>ref|XP_010060380.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW67038.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=543

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 103/168 (61%), Gaps = 6/168 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R YACKSI KRKLVSKNDKED++REI IMQHLSGQPNIV   G +
Sbjct  116  STGRQYACKSISKRKLVSKNDKEDMRREIHIMQHLSGQPNIVEFKGAY  163



>ref|XP_010060346.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X1 
[Eucalyptus grandis]
Length=535

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 103/168 (61%), Gaps = 6/168 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R YACKSI KRKLV+KNDKED+KREI IMQHLSGQPNIV   G +
Sbjct  116  STGRQYACKSISKRKLVTKNDKEDMKREIHIMQHLSGQPNIVEFKGAY  163



>gb|KCW67039.1| hypothetical protein EUGRSUZ_F00807 [Eucalyptus grandis]
Length=492

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 103/168 (61%), Gaps = 6/168 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R YACKSI KRKLVSKNDKED++REI IMQHLSGQPNIV   G +
Sbjct  116  STGRQYACKSISKRKLVSKNDKEDMRREIHIMQHLSGQPNIVEFKGAY  163



>ref|XP_010060348.1| PREDICTED: calcium-dependent protein kinase 2-like isoform X2 
[Eucalyptus grandis]
Length=550

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 103/168 (61%), Gaps = 6/168 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQ-PVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MG CF+K K+ +   NGYR        YQ P    HQ+      Q     +  + P    
Sbjct  1    MGCCFTKDKAPEPQQNGYRSA---GENYQRPHEHHHQRHHQQQQQAIVVAQ--HKPSSNH  55

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
            Y P     K S       P    + + ILGKP+E++K+HY+LGKELGRGQFGVTYLCTEI
Sbjct  56   YQPQQAAFKTSVPASSPSPRPVQKVDTILGKPYEEVKSHYTLGKELGRGQFGVTYLCTEI  115

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST R YACKSI KRKLV+KNDKED+KREI IMQHLSGQPNIV   G +
Sbjct  116  STGRQYACKSISKRKLVTKNDKEDMKREIHIMQHLSGQPNIVEFKGAY  163



>ref|XP_007142270.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
 gb|ESW14264.1| hypothetical protein PHAVU_008G266600g [Phaseolus vulgaris]
Length=525

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 98/167 (59%), Gaps = 21/167 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGC SK+ S   + NGYR   G A  ++       +    HA     P+  + P   S 
Sbjct  1    MGGCLSKNGSESEEHNGYRHVVGGAHNHKSHEPFVNQLPEKHA-----PQAAWRPTVHSP  55

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
            +P HV                   + I GKP ED+K HY+LGKELGRGQFGVTYLCTE S
Sbjct  56   SPKHV----------------HRADTITGKPLEDVKQHYTLGKELGRGQFGVTYLCTENS  99

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSI KRKLV ++DKED+KREIQIMQHLSGQPNIV   G +
Sbjct  100  TGLQYACKSISKRKLVRRDDKEDMKREIQIMQHLSGQPNIVEFKGSY  146



>ref|XP_004231610.1| PREDICTED: calcium-dependent protein kinase 2-like [Solanum lycopersicum]
Length=527

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 99/167 (59%), Gaps = 19/167 (11%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGCFSK        N Y +G G  T  +P             Q Y  P   Y+P+P + 
Sbjct  1    MGGCFSK--------NRYLEGDGKGTSNRPGRRRRGNTGVASYQHYKHPVY-YHPRPTA-  50

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                              V+  +P  ILGKP+E+I+AHY+LG+ELGRGQ+GV Y CTE S
Sbjct  51   ---------QQRHAHQVTVKSSQPGTILGKPYENIRAHYTLGRELGRGQYGVIYFCTENS  101

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TRR YACKSILKRKLVS+ D EDIKREIQ+MQHLSGQPNIV   G +
Sbjct  102  TRRNYACKSILKRKLVSRKDTEDIKREIQMMQHLSGQPNIVEFKGAY  148



>ref|XP_009357448.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=546

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            PN+ILGKPF+DIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSILKRKLVSKND+ED
Sbjct  83   PNSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSILKRKLVSKNDRED  142

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQIMQHLSGQPNIV   G +
Sbjct  143  IKREIQIMQHLSGQPNIVEIKGAY  166



>ref|XP_002532559.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF29820.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=533

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 107/182 (59%), Gaps = 44/182 (24%)
 Frame = +3

Query  204  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQ-------------PVTESHQKASST-HAQT  338
            MG C SK K S+Q   NG       ATG Q             P   S+Q  S T  AQ 
Sbjct  1    MGFCLSKEKRSQQHHYNG-------ATGLQHQSREPVAYQSKSPAQPSYQFPSQTPGAQI  53

Query  339  YTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKEL  518
               P +P  P P S  PVH                  +P+ IL KP+ED+K HY++GKEL
Sbjct  54   ---PRKPVVPAP-SPKPVH------------------KPDTILEKPYEDVKLHYTIGKEL  91

Query  519  GRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAG  698
            GRGQFGVTYLCTEIST + YACKSI KRKLV++NDKED+KREIQIMQHLSGQPNIV   G
Sbjct  92   GRGQFGVTYLCTEISTGKLYACKSISKRKLVTRNDKEDMKREIQIMQHLSGQPNIVEFKG  151

Query  699  CF  704
             +
Sbjct  152  AY  153



>gb|AIO04122.1| calcium-dependent protein kinase [Hevea brasiliensis]
Length=556

 Score =   134 bits (336),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 77/114 (68%), Gaps = 11/114 (10%)
 Frame = +3

Query  363  NPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  542
             P P   AP ++ A+               P  ILGKP EDIK +YSLGKELGRGQFG+T
Sbjct  74   TPPPVRAAPTNLTARSVQT-----------PQTILGKPLEDIKQYYSLGKELGRGQFGIT  122

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            YLCTE ST   YACKSILKRKL +K D+EDIKRE+QIMQHLSGQPN V   G +
Sbjct  123  YLCTENSTGHIYACKSILKRKLTNKGDREDIKREVQIMQHLSGQPNNVEFRGSY  176


 Score = 45.8 bits (107),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  691  LQGAFEDRQSVHLVMELRSDGELLDRIIA  777
             +G++EDRQSVH+VMEL + GEL DRIIA
Sbjct  172  FRGSYEDRQSVHVVMELCAGGELFDRIIA  200



>ref|XP_008224828.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
2-like [Prunus mume]
Length=560

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            PN+ILGKPF+DIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSILKRKLVSKND++D
Sbjct  97   PNSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSILKRKLVSKNDRDD  156

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQIMQHLSGQPNIV   G +
Sbjct  157  IKREIQIMQHLSGQPNIVEIKGSY  180



>ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa]
 emb|CEH19767.1| Calcium-dependent protein kinase [Populus tremula x Populus tremuloides]
Length=532

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 100/167 (60%), Gaps = 13/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK  +   DVNGYR   G ATGY P   + Q+    H      P +     PQ  
Sbjct  1    MGCCGSKGNAPTPDVNGYR---GPATGY-PRQTNQQQQPQYH------PSQQKVTVPQIQ  50

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                      +  Q         P+ ILGKPFEDIK HY+LGKELGRGQFGVTYLCTE S
Sbjct  51   TQTPPTRPQQTQQQTPTRPA---PDTILGKPFEDIKQHYTLGKELGRGQFGVTYLCTENS  107

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSILKRKLV+KNDKED+KRE+ IMQ LSGQPNIV   G +
Sbjct  108  TSHTYACKSILKRKLVNKNDKEDMKREVHIMQDLSGQPNIVEFRGAY  154



>ref|XP_008349938.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
isoform 2-like [Malus domestica]
Length=453

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            N ILGKPFED++  Y++GKELGRGQFGVTYLCTEIST + YACKSI KRKLV+KNDKEDI
Sbjct  44   NTILGKPFEDVRLRYTIGKELGRGQFGVTYLCTEISTGKKYACKSISKRKLVTKNDKEDI  103

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQ NIV   GC+
Sbjct  104  KREIQIMQHLSGQLNIVEFEGCY  126



>ref|XP_009770081.1| PREDICTED: calcium-dependent protein kinase 21-like [Nicotiana 
sylvestris]
Length=542

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 99/183 (54%), Gaps = 36/183 (20%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGR-GVATGYQP---------------VTESHQKASSTHAQ  335
            MGGCFSK   ++G   GYR  R  V   YQ                     Q       Q
Sbjct  1    MGGCFSKKYRQEGANGGYRATRRNVNQEYQKPPQHQPERPYQPQPQPQPQPQPQPRPQPQ  60

Query  336  TYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKE  515
             +T   +P   Q Q   P H+                   NNILGKPFEDI+  Y+LGKE
Sbjct  61   AHTVTAQPAQTQDQMQGP-HL-------------------NNILGKPFEDIRKQYTLGKE  100

Query  516  LGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXA  695
            LGRGQFGVTY CTE ST   YACKSILKRKLV KND+EDIKREIQIMQHLSGQPNIV   
Sbjct  101  LGRGQFGVTYHCTENSTGNPYACKSILKRKLVRKNDREDIKREIQIMQHLSGQPNIVEFK  160

Query  696  GCF  704
            G +
Sbjct  161  GAY  163



>ref|XP_007153943.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
 gb|ESW25937.1| hypothetical protein PHAVU_003G078400g [Phaseolus vulgaris]
Length=546

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 91/132 (69%), Gaps = 3/132 (2%)
 Frame = +3

Query  309  QKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDI  488
            Q +++T AQ  T P  P  PQP S A V  P KP   P       +     ILGKPFEDI
Sbjct  31   QPSTTTVAQVQTSP--PPKPQPHSEA-VASPPKPKLSPTQNARAVQKPDATILGKPFEDI  87

Query  489  KAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLS  668
            K +YSLGKELGRGQFG+TYLCTE +T   YACKSILKRKLVS+ D+ED+KREIQIMQHLS
Sbjct  88   KKYYSLGKELGRGQFGITYLCTENATGMTYACKSILKRKLVSRADREDMKREIQIMQHLS  147

Query  669  GQPNIVLXAGCF  704
            GQ NIV   G F
Sbjct  148  GQNNIVEFKGAF  159



>ref|XP_008385882.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
isoform 2 [Malus domestica]
Length=470

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            N ILGKPFED++  Y++GKELGRGQFGVTYLCTEIST + YACKSI KRKLV+KNDKEDI
Sbjct  61   NTILGKPFEDVRLRYTIGKELGRGQFGVTYLCTEISTGKKYACKSISKRKLVTKNDKEDI  120

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQ NIV   GC+
Sbjct  121  KREIQIMQHLSGQXNIVEFEGCY  143



>ref|NP_001280761.1| calcium-dependent protein kinase 2-like [Malus domestica]
 gb|AAR28084.1| calcium-dependent protein kinase [Malus domestica]
Length=543

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            N+ILGKPF+DIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSILKRKLVSKND++DI
Sbjct  81   NSILGKPFDDIKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSILKRKLVSKNDRDDI  140

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQPNIV   G +
Sbjct  141  KREIQIMQHLSGQPNIVEIKGAY  163



>gb|AAK92828.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
Length=531

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +3

Query  330  AQTYTQPE--RPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  503
             QT+  PE  +P  P P+   P+  P           PV   +P+ ILGKPFEDI+  YS
Sbjct  25   VQTHVVPEHRKPQTPTPK---PMTQPIHQQISTPSSNPVSVRDPDTILGKPFEDIRKFYS  81

Query  504  LGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNI  683
            LGKELGRGQFG+TY+C EI T   YACKSILKRKL+SK DKED+KREIQIMQ+LSGQPNI
Sbjct  82   LGKELGRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNI  141

Query  684  VLXAGCF  704
            V   G +
Sbjct  142  VEIKGAY  148


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 61/146 (42%), Gaps = 3/146 (2%)
 Frame = +1

Query  340  IPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNW  519
            +P  + P T +P PM Q +  Q      N + + RD   I   G     +R    LGK  
Sbjct  30   VPEHRKPQTPTPKPMTQPIHQQISTPSSNPVSV-RDPDTIL--GKPFEDIRKFYSLGKEL  86

Query  520  GGASLG*LTCVLRFPPVGLMLasrf*rgss*armirrisrgrfrLCST*VGSRTLCXLQG  699
            G    G                    +    ++  +   +   ++     G   +  ++G
Sbjct  87   GRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKG  146

Query  700  AFEDRQSVHLVMELRSDGELLDRIIA  777
            A+EDRQS+HLVMEL + GEL DRIIA
Sbjct  147  AYEDRQSIHLVMELCAGGELFDRIIA  172



>ref|NP_192381.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
 sp|Q9ZSA2.1|CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21 [Arabidopsis 
thaliana]
 gb|AAD03453.1| contains similarity to eukaryotic protein kinase domains (Pfam: 
PF00069, score=312.6, E=4.7e-90, N=1) and EF hand domains 
(Pfam: PF00036, score=131, E=2.1e-35, N=4) [Arabidopsis thaliana]
 emb|CAB80837.1| putative calcium dependent protein kinase [Arabidopsis thaliana]
 gb|AAN13018.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AEE82416.1| calcium-dependent protein kinase 21 [Arabidopsis thaliana]
Length=531

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +3

Query  330  AQTYTQPE--RPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  503
             QT+  PE  +P  P P+   P+  P           PV   +P+ ILGKPFEDI+  YS
Sbjct  25   VQTHVVPEHRKPQTPTPK---PMTQPIHQQISTPSSNPVSVRDPDTILGKPFEDIRKFYS  81

Query  504  LGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNI  683
            LGKELGRGQFG+TY+C EI T   YACKSILKRKL+SK DKED+KREIQIMQ+LSGQPNI
Sbjct  82   LGKELGRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNI  141

Query  684  VLXAGCF  704
            V   G +
Sbjct  142  VEIKGAY  148


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 61/146 (42%), Gaps = 3/146 (2%)
 Frame = +1

Query  340  IPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNW  519
            +P  + P T +P PM Q +  Q      N + + RD   I   G     +R    LGK  
Sbjct  30   VPEHRKPQTPTPKPMTQPIHQQISTPSSNPVSV-RDPDTIL--GKPFEDIRKFYSLGKEL  86

Query  520  GGASLG*LTCVLRFPPVGLMLasrf*rgss*armirrisrgrfrLCST*VGSRTLCXLQG  699
            G    G                    +    ++  +   +   ++     G   +  ++G
Sbjct  87   GRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKG  146

Query  700  AFEDRQSVHLVMELRSDGELLDRIIA  777
            A+EDRQS+HLVMEL + GEL DRIIA
Sbjct  147  AYEDRQSIHLVMELCAGGELFDRIIA  172



>gb|AGJ83806.1| calcium-dependent protein kinase 1d [Vitis amurensis]
Length=545

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGKPF+DIK +Y+LGKELGRGQFGVTYLCT+ ST   YACKSILKRKLV+KNDKED
Sbjct  82   PDTILGKPFDDIKHYYTLGKELGRGQFGVTYLCTQNSTGNTYACKSILKRKLVTKNDKED  141

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQIMQHL+GQPNIV   G +
Sbjct  142  IKREIQIMQHLTGQPNIVEFKGAY  165



>emb|CBI23246.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 98/166 (59%), Gaps = 34/166 (20%)
 Frame = +3

Query  210  GCFS-KSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYA  386
            GCFS K +  + D+ G R  RG  T             + H      P +P +P  ++  
Sbjct  2    GCFSSKERVTERDIKGGRSERGAPT------------QTYHQPPPQPPLKPSHPNTRAI-  48

Query  387  PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIST  566
                                 +P+ ILG+PF+DIK +Y+LGKELGRGQFGVTYLCT+ ST
Sbjct  49   --------------------QKPDTILGRPFDDIKHYYTLGKELGRGQFGVTYLCTQNST  88

Query  567  RRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
               YACKSILKRKLV+KNDKEDIKREIQIMQHL+GQPNIV   G +
Sbjct  89   GNTYACKSILKRKLVTKNDKEDIKREIQIMQHLTGQPNIVEFKGAY  134



>gb|KCW75309.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=536

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 101/171 (59%), Gaps = 9/171 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQG--RGVATGYQ--PVTESHQKASSTHAQTYTQPERPYNPQ  371
            MG   SK KS Q   NGY      G    YQ     ++H+ ++        Q +   NP 
Sbjct  1    MGCRGSKEKSPQSGANGYSSTTVSGQNQAYQQGAAVQTHKVSAQMPQPRPQQQQPASNP-  59

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
                APV               V +   N ILGKPFE+IK HY+LGKELGRGQFG+TYLC
Sbjct  60   ----APVSSEVAQKRPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLC  115

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST + YACKSILKRKL+SK D++D+KREIQIMQHLSGQPNIV   G +
Sbjct  116  TEKSTGQTYACKSILKRKLLSKGDRDDMKREIQIMQHLSGQPNIVEFRGAY  166



>ref|XP_010057925.1| PREDICTED: calcium-dependent protein kinase 2-like [Eucalyptus 
grandis]
 gb|KCW75311.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=546

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 101/171 (59%), Gaps = 9/171 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQG--RGVATGYQ--PVTESHQKASSTHAQTYTQPERPYNPQ  371
            MG   SK KS Q   NGY      G    YQ     ++H+ ++        Q +   NP 
Sbjct  1    MGCRGSKEKSPQSGANGYSSTTVSGQNQAYQQGAAVQTHKVSAQMPQPRPQQQQPASNP-  59

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
                APV               V +   N ILGKPFE+IK HY+LGKELGRGQFG+TYLC
Sbjct  60   ----APVSSEVAQKRPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLC  115

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST + YACKSILKRKL+SK D++D+KREIQIMQHLSGQPNIV   G +
Sbjct  116  TEKSTGQTYACKSILKRKLLSKGDRDDMKREIQIMQHLSGQPNIVEFRGAY  166



>ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
 gb|AAQ08324.2| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=558

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            NNILGKPFEDI+  Y+LGKELGRGQFGVTY CTE ST   YACKSILKRKLVSKND+ED+
Sbjct  96   NNILGKPFEDIRKLYTLGKELGRGQFGVTYYCTENSTENPYACKSILKRKLVSKNDREDM  155

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQPNIV   G +
Sbjct  156  KREIQIMQHLSGQPNIVEFKGAY  178



>gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea]
Length=503

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            EPNNI GKPFE+IK+ Y++G+ELGRGQFGVTYLCTEI++ + YACKSILKRKLV+KNDK+
Sbjct  38   EPNNIFGKPFENIKSKYAVGRELGRGQFGVTYLCTEIASGQQYACKSILKRKLVTKNDKD  97

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D+KRE+ IM+HLSGQPNIV   G +        V   C G  L
Sbjct  98   DMKREVHIMEHLSGQPNIVAFKGVYEDRQSVHVVMELCRGGEL  140



>gb|KCW75310.1| hypothetical protein EUGRSUZ_E04057 [Eucalyptus grandis]
Length=543

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 101/171 (59%), Gaps = 9/171 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQG--RGVATGYQ--PVTESHQKASSTHAQTYTQPERPYNPQ  371
            MG   SK KS Q   NGY      G    YQ     ++H+ ++        Q +   NP 
Sbjct  1    MGCRGSKEKSPQSGANGYSSTTVSGQNQAYQQGAAVQTHKVSAQMPQPRPQQQQPASNP-  59

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
                APV               V +   N ILGKPFE+IK HY+LGKELGRGQFG+TYLC
Sbjct  60   ----APVSSEVAQKRPAPVSSGVAQKMDNTILGKPFEEIKQHYTLGKELGRGQFGITYLC  115

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST + YACKSILKRKL+SK D++D+KREIQIMQHLSGQPNIV   G +
Sbjct  116  TEKSTGQTYACKSILKRKLLSKGDRDDMKREIQIMQHLSGQPNIVEFRGAY  166



>ref|XP_002268814.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=545

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILG+PF+DIK +Y+LGKELGRGQFGVTYLCT+ ST   YACKSILKRKLV+KNDKED
Sbjct  82   PDTILGRPFDDIKHYYTLGKELGRGQFGVTYLCTQNSTGNTYACKSILKRKLVTKNDKED  141

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQIMQHL+GQPNIV   G +
Sbjct  142  IKREIQIMQHLTGQPNIVEFKGAY  165



>ref|XP_007026068.1| Calcium-dependent protein kinase 21 isoform 3 [Theobroma cacao]
 gb|EOY28690.1| Calcium-dependent protein kinase 21 isoform 3 [Theobroma cacao]
Length=481

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK K  + D   YR G   +   QP   S  +   T   +  Q + P   QPQ  
Sbjct  1    MGCCGSKHKLSEPDYKDYRSGMPPSRPVQPA--SQPQPVQTQKMSVPQIQAPQMRQPQ--  56

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P+  P KPS         Q      ILGKP EDIK +Y+LGKELGRGQFG+TYLCTE S
Sbjct  57   -PIPAPLKPSPASSRPVQGQ----ETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENS  111

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSILKRKL +K D+EDIK+E+QIMQHLSGQPNIV   G +
Sbjct  112  TGNTYACKSILKRKLKNKQDREDIKKEVQIMQHLSGQPNIVEFRGAY  158



>ref|XP_007026067.1| Calcium-dependent protein kinase 21 isoform 2 [Theobroma cacao]
 gb|EOY28689.1| Calcium-dependent protein kinase 21 isoform 2 [Theobroma cacao]
Length=486

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK K  + D   YR G   +   QP   S  +   T   +  Q + P   QPQ  
Sbjct  1    MGCCGSKHKLSEPDYKDYRSGMPPSRPVQPA--SQPQPVQTQKMSVPQIQAPQMRQPQ--  56

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P+  P KPS         Q      ILGKP EDIK +Y+LGKELGRGQFG+TYLCTE S
Sbjct  57   -PIPAPLKPSPASSRPVQGQ----ETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENS  111

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSILKRKL +K D+EDIK+E+QIMQHLSGQPNIV   G +
Sbjct  112  TGNTYACKSILKRKLKNKQDREDIKKEVQIMQHLSGQPNIVEFRGAY  158



>ref|XP_010092160.1| Calcium-dependent protein kinase 9 [Morus notabilis]
 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis]
Length=548

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGKPFEDIK HY+ GKELGRGQFGVTYLCTE ST R YACKSI KRKLVSKNDKED+
Sbjct  87   DTILGKPFEDIKNHYTFGKELGRGQFGVTYLCTENSTGRLYACKSISKRKLVSKNDKEDM  146

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREI+IMQHLSGQPNIV   G +
Sbjct  147  KREIRIMQHLSGQPNIVEFKGAY  169



>ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 
[Glycine max]
Length=528

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 99/169 (59%), Gaps = 23/169 (14%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPER--PYNPQPQ  377
            MG C SK  S   +   YR   G   G   V  +H+       Q Y  PE+  P+ P P 
Sbjct  1    MGCCMSKKGSEPEEHIVYRHVAG--AGGAGVYNNHKSHEPPSHQPYPLPEKHAPWRPPP-  57

Query  378  SYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  557
              +P HV                 + + I GKPFED+K HY+LGKELGRGQFGVTYLCTE
Sbjct  58   --SPKHV----------------HKHDTITGKPFEDVKQHYTLGKELGRGQFGVTYLCTE  99

Query  558  ISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             ST   YACKSI KRKLVS++DKED+KREIQIMQHLSGQ NIV   G F
Sbjct  100  NSTGFQYACKSISKRKLVSRDDKEDMKREIQIMQHLSGQSNIVEFKGAF  148



>ref|XP_007026066.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
 gb|EOY28688.1| Calcium-dependent protein kinase 21 isoform 1 [Theobroma cacao]
Length=538

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 100/167 (60%), Gaps = 9/167 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK K  + D   YR G   +   QP   S  +   T   +  Q + P   QPQ  
Sbjct  1    MGCCGSKHKLSEPDYKDYRSGMPPSRPVQPA--SQPQPVQTQKMSVPQIQAPQMRQPQ--  56

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P+  P KPS         Q      ILGKP EDIK +Y+LGKELGRGQFG+TYLCTE S
Sbjct  57   -PIPAPLKPSPASSRPVQGQ----ETILGKPLEDIKQYYTLGKELGRGQFGITYLCTENS  111

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSILKRKL +K D+EDIK+E+QIMQHLSGQPNIV   G +
Sbjct  112  TGNTYACKSILKRKLKNKQDREDIKKEVQIMQHLSGQPNIVEFRGAY  158



>dbj|BAJ99143.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=532

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 105/170 (62%), Gaps = 20/170 (12%)
 Frame = +3

Query  204  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            Q+      PA    V  PV    +P P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPTPDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCT  103

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            EIST R YACKSI KRKLVSK DKEDI+REIQIMQHLSGQPNIV   G +
Sbjct  104  EISTGRQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQPNIVEFCGAY  153



>ref|XP_009360846.1| PREDICTED: calcium-dependent protein kinase 2-like [Pyrus x bretschneideri]
Length=543

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            N+ILGKPF DIK +Y+LGKELGRGQFG+TYLCTE ST   YACKSILKRKLVSKND++DI
Sbjct  81   NSILGKPFNDIKQYYTLGKELGRGQFGITYLCTENSTGHCYACKSILKRKLVSKNDRDDI  140

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQPNIV   G +
Sbjct  141  KREIQIMQHLSGQPNIVEIKGSY  163



>gb|AAD17800.1| Ca2+-dependent protein kinase [Mesembryanthemum crystallinum]
Length=534

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 105/167 (63%), Gaps = 13/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK+K+ Q + NGY    GV +  Q      +  +  +       +    PQP S+
Sbjct  1    MGICASKNKATQPEDNGYTPANGVGSNNQ-----SKPPAQQNYHQQPPQQPVAPPQPASH  55

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             PV +P+   +           EPN ILGKPFED+K +Y+LG+ELGRGQFGVTYLCT+  
Sbjct  56   PPVRMPSPKPAPKV--------EPNTILGKPFEDVKVYYTLGRELGRGQFGVTYLCTDKK  107

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T + YACKSI K+KLV+K DK+D++REIQIMQH+SGQPNIV   G +
Sbjct  108  TGQQYACKSISKKKLVTKADKDDMRREIQIMQHMSGQPNIVEFKGAY  154



>ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
 gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella]
Length=534

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EIST   YACKSILKRKL+SK DKE
Sbjct  67   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREISTGNTYACKSILKRKLISKQDKE  126

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQ+LSGQPNIV   G +
Sbjct  127  DVKREIQIMQYLSGQPNIVEIKGAY  151


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  ++GA+EDRQSVHLVMEL + GEL DRIIA
Sbjct  140  GQPNIVEIKGAYEDRQSVHLVMELCAGGELFDRIIA  175



>gb|ABC59619.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMT05971.1| Calcium-dependent protein kinase isoform 2 [Aegilops tauschii]
Length=532

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 105/170 (62%), Gaps = 20/170 (12%)
 Frame = +3

Query  204  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQAPPSYNNAQ----PPP  43

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            Q+      PA    V  PV    +P P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPMPDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCT  103

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            EIST R YACKSI KRKLVSK DKEDI+REIQIMQHLSGQPNIV   G +
Sbjct  104  EISTGRQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQPNIVEFCGAY  153



>gb|AFR11230.1| calcium dependent protein kinase 1 [Chenopodium album]
Length=543

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            ILGKPFEDI++HY LGKELGRGQFG+TYLCTE ST + YACKSILKRKLV+K DKEDIKR
Sbjct  83   ILGKPFEDIRSHYKLGKELGRGQFGITYLCTENSTGQTYACKSILKRKLVTKADKEDIKR  142

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQI+QHLSGQPNIV   G +
Sbjct  143  EIQILQHLSGQPNIVEFKGVY  163



>gb|KJB62816.1| hypothetical protein B456_009G438300 [Gossypium raimondii]
Length=524

 Score =   140 bits (354),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 104/168 (62%), Gaps = 24/168 (14%)
 Frame = +3

Query  204  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MGGC +K+K S     NGY+ G    T       + ++   TH      PE+P    P  
Sbjct  1    MGGCLTKTKGSNPQHNNGYKSGATTTT-------AAEQPQPTHI-----PEKPGTQAP--  46

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
            + PV VP   +            + + ILGKP+EDI+ HY++GKELG+GQFGVTYLC E 
Sbjct  47   WKPV-VPTPSAKPAP--------KSDTILGKPYEDIRMHYTIGKELGKGQFGVTYLCIEN  97

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST + YACK+I KRKL++KNDKED++REIQIMQHLSGQPNIV   G +
Sbjct  98   STGKQYACKTISKRKLITKNDKEDMRREIQIMQHLSGQPNIVEFKGAY  145



>gb|ABD98803.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|ABY59008.1| calcium-dependent protein kinase [Triticum aestivum]
 gb|EMS66675.1| Calcium-dependent protein kinase isoform 2 [Triticum urartu]
Length=532

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 105/170 (62%), Gaps = 20/170 (12%)
 Frame = +3

Query  204  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            Q+      PA    V  PV    +P P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPMPDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCT  103

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            EIST R YACKSI KRKLVSK DKEDI+REIQIMQHLSGQPNIV   G +
Sbjct  104  EISTGRQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQPNIVEFCGAY  153



>gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum]
Length=554

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            NNILGKPFEDI+  Y+LGKELGRGQFGVTY CTE ST   YACKSILKRKLVSKND+ED+
Sbjct  96   NNILGKPFEDIRKLYTLGKELGRGQFGVTYYCTENSTGNPYACKSILKRKLVSKNDREDM  155

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQPNIV   G +
Sbjct  156  KREIQIMQHLSGQPNIVEFKGAY  178



>emb|CDP05759.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGKP+EDIK HY+LGKELGRGQFGVTYLCT+I T R YACKSI K+KLV+K DKED
Sbjct  58   PDTILGKPYEDIKLHYTLGKELGRGQFGVTYLCTDIETGRQYACKSISKKKLVTKGDKED  117

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            ++REIQIMQHLSGQPNIV   G +
Sbjct  118  MRREIQIMQHLSGQPNIVEFKGAY  141



>ref|XP_009783685.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=522

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 100/167 (60%), Gaps = 25/167 (15%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK+K  +   NG+                ++    +     TQ +   +P P+S 
Sbjct  1    MGICLSKTKPAESKSNGH----------------NRSGGGSGGHHQTQIQYTKSPGPESQ  44

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P+   A          P    +   ILGKPFED+KAHY+LGKELGRGQFGVT+LCTEI+
Sbjct  45   LPMRPSA---------SPKPVFKQETILGKPFEDVKAHYTLGKELGRGQFGVTFLCTEIA  95

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSI K+KLV+K+DKED++REIQIMQHLSGQPNIV   G +
Sbjct  96   TGHQYACKSISKKKLVTKSDKEDMRREIQIMQHLSGQPNIVEFKGAY  142



>ref|XP_004293286.1| PREDICTED: calcium-dependent protein kinase 2-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 92/136 (68%), Gaps = 18/136 (13%)
 Frame = +3

Query  297  TESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKP  476
            T+  QK S+   +   +PE  + P+PQ   P  VP                 P++IL KP
Sbjct  47   TQQPQKVSAPPTRPKPEPEPQFQPKPQRPKPA-VP-----------------PDSILEKP  88

Query  477  FEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIM  656
            FEDIK +Y+LGKELGRGQFG+TYLCTE ST  +YACKSILKRKLV K+D++D+KREIQIM
Sbjct  89   FEDIKRYYTLGKELGRGQFGITYLCTENSTGDSYACKSILKRKLVRKSDRDDVKREIQIM  148

Query  657  QHLSGQPNIVLXAGCF  704
            QH+SGQPN+V   G +
Sbjct  149  QHMSGQPNVVEIKGAY  164



>gb|KHN02836.1| Calcium-dependent protein kinase 9 [Glycine soja]
Length=551

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 101/168 (60%), Gaps = 4/168 (2%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHA-QTYTQPERPYNPQPQS  380
            MG C SK    Q   NGYR G       Q   E     S   A Q Y  PE+      Q+
Sbjct  1    MGCCVSKDSEPQH--NGYRHGGTGGVHNQKTHEPLVNQSRAPANQPYHLPEKHAASTAQT  58

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
              P ++P KPS      +PV     + ILGK FED+K  Y+LGKELGRGQFGVTYLCTE 
Sbjct  59   -VPQNMPWKPSGPALSPKPVVSVRQDTILGKQFEDVKQFYTLGKELGRGQFGVTYLCTEN  117

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST   YACKSI KRKLV K+DKEDIKREIQIMQHLSGQPNIV   G +
Sbjct  118  STGLQYACKSISKRKLVKKSDKEDIKREIQIMQHLSGQPNIVEFKGAY  165



>gb|KHG26977.1| Calcium-dependent protein kinase 9 [Gossypium arboreum]
Length=524

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 104/168 (62%), Gaps = 24/168 (14%)
 Frame = +3

Query  204  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MGGC +K+K S     NGY+ G    T       + ++   TH      PE+P    P  
Sbjct  1    MGGCLTKTKGSNPQHNNGYKSGATTTT-------AAEQPQVTHI-----PEKPGTQAP--  46

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
            + PV VP   +            + + ILGKP+EDI+ HY++GKELG+GQFGVTYLC E 
Sbjct  47   WKPV-VPTPSAKPAP--------KSDTILGKPYEDIRMHYTIGKELGKGQFGVTYLCIEN  97

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST + YACK+I KRKL++KNDKED++REIQ+MQHLSGQPNIV   G +
Sbjct  98   STGKQYACKTISKRKLITKNDKEDMRREIQLMQHLSGQPNIVEFKGAY  145



>gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=540

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 102/167 (61%), Gaps = 6/167 (4%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MGGCFSK   ++G   GYR  R      +   + +QK      +   QP+    PQPQ  
Sbjct  1    MGGCFSKKYRQEGANGGYRATR------RNANQEYQKPPQHQPERPYQPQPQPQPQPQPR  54

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                         Q    +Q P  NNILGKPFEDI+  Y+LGKELGRGQFGVTY CTE S
Sbjct  55   PQPQAHTVTXQPXQTQDQMQGPHLNNILGKPFEDIRKQYTLGKELGRGQFGVTYHCTENS  114

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSILKRKLV KND+ED+KREIQIMQHLSGQPNIV   G +
Sbjct  115  TGNPYACKSILKRKLVRKNDREDMKREIQIMQHLSGQPNIVEFKGAY  161



>ref|XP_009798561.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
sylvestris]
Length=521

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 99/164 (60%), Gaps = 27/164 (16%)
 Frame = +3

Query  213  CFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPV  392
            C SKSK  Q + NG+    GV          H+          T+ +   +P P+S  PV
Sbjct  5    CSSKSKPEQSNANGHHGSGGVG--------PHR----------TEIQYTKSPGPESQLPV  46

Query  393  HVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRR  572
              P  P  V              ILGKP+ED++ HY+LGKELGRGQFGVTYLCTEIST +
Sbjct  47   RAPPSPKPVSAH---------GTILGKPYEDVRVHYTLGKELGRGQFGVTYLCTEISTGQ  97

Query  573  AYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  98   QYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  141



>ref|XP_010675716.1| PREDICTED: calcium-dependent protein kinase 33-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 104/167 (62%), Gaps = 11/167 (7%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK+K  + + NGYR G      Y    ++  +      +      R  NP+P   
Sbjct  1    MGICASKNKDSKVEQNGYRAG----NEYNQQPKAPVQQQQPQQEQQQYVPRQ-NPEPN--  53

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             PV  P    S     +  QR +PN ILGKPFED+K HY+LGKELGRGQFGVTYLC + +
Sbjct  54   -PVSQPG---SKGVAAKGGQRNDPNTILGKPFEDVKMHYTLGKELGRGQFGVTYLCVDKT  109

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            + + YACKSI K+KLV++ DKED+KREIQIMQH+SGQPNIV   G +
Sbjct  110  SGQQYACKSISKKKLVTRADKEDMKREIQIMQHMSGQPNIVEFKGAY  156



>gb|ABC59620.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 105/170 (62%), Gaps = 20/170 (12%)
 Frame = +3

Query  204  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            Q+      PA    V  PV    +P P+ ILGK ++D+++ YSLGKELGRGQFGVTYLCT
Sbjct  44   QAEVWYTPPAMNPPVVPPVVAPSKPMPDTILGKQYQDVRSVYSLGKELGRGQFGVTYLCT  103

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            EIST R YACKSI KRKLVSK DKEDI+REIQIMQHLSGQPNIV   G +
Sbjct  104  EISTGRQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQPNIVEFCGAY  153



>gb|KFK30983.1| hypothetical protein AALP_AA6G053500 [Arabis alpina]
Length=538

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P+ ILGKPFE+IK  YSLGKELGRGQFG+TYLCTEIST   YACKSILKRKL+SK DKE
Sbjct  71   DPDTILGKPFEEIKKLYSLGKELGRGQFGITYLCTEISTGNTYACKSILKRKLISKQDKE  130

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQ+LSGQ NIV   G +
Sbjct  131  DVKREIQIMQYLSGQSNIVEIKGAY  155



>ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 82/117 (70%), Gaps = 3/117 (3%)
 Frame = +3

Query  354  RPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQF  533
            +P  P P+   P++ P           P+   +P  ILGKPFEDI+  YSLGKELGRGQF
Sbjct  38   KPQTPTPK---PMNQPILQQISTPSSNPISVRDPETILGKPFEDIRKFYSLGKELGRGQF  94

Query  534  GVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            G+TY+C EI T   YACKSILKRKL+SK DKED+KREIQIMQ+LSGQPNIV   G +
Sbjct  95   GITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKGAY  151


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 61/146 (42%), Gaps = 3/146 (2%)
 Frame = +1

Query  340  IPNLKGPITHSPSPMLQSMSLQNPHQCPNLLGLFRDLSQITYWGSLLRTLRHTTVLGKNW  519
            +P  + P T +P PM Q +  Q      N + + RD   I   G     +R    LGK  
Sbjct  33   VPEHRKPQTPTPKPMNQPILQQISTPSSNPISV-RDPETIL--GKPFEDIRKFYSLGKEL  89

Query  520  GGASLG*LTCVLRFPPVGLMLasrf*rgss*armirrisrgrfrLCST*VGSRTLCXLQG  699
            G    G                    +    ++  +   +   ++     G   +  ++G
Sbjct  90   GRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKG  149

Query  700  AFEDRQSVHLVMELRSDGELLDRIIA  777
            A+EDRQSVHLVMEL + GEL DRIIA
Sbjct  150  AYEDRQSVHLVMELCAGGELFDRIIA  175



>gb|ABB54456.1| calcium-dependent protein kinase [Hordeum brevisubulatum]
Length=532

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 102/172 (59%), Gaps = 24/172 (14%)
 Frame = +3

Query  204  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C S++    S QG  NGY        GY     SHQ   +    +Y       N QP
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQAPPSYN------NAQP  41

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEP--NNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
               A V       + P     V   +P  + ILGK +ED+++ YSLGKELGRGQFGVTYL
Sbjct  42   PPRAEVRYTPPAMNPPVVPPVVAPSKPMPDTILGKQYEDVRSVYSLGKELGRGQFGVTYL  101

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            CTEIST R YACKSI KRKLVSK DKEDI+REIQIMQHLSGQPNIV   G +
Sbjct  102  CTEISTGRQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQPNIVEFCGAY  153



>gb|AFY10519.1| calcium dependent protein kinase 1 [Dendrobium catenatum]
Length=525

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 97/151 (64%), Gaps = 15/151 (10%)
 Frame = +3

Query  264  GRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvq  443
            G+G  TG +    SHQ  ++       QP +P  P P+++      A PS          
Sbjct  6    GKGKRTGLEANGHSHQPPATV------QPVKPSRPSPETHY-----APPSPAKPNPPIAS  54

Query  444  rpEP----NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLV  611
             P+P    N ILGKPFED+++HYSLGKELGRGQFGVTY C EI+T  +YACKSI KRKLV
Sbjct  55   PPKPAPTNNTILGKPFEDVRSHYSLGKELGRGQFGVTYFCKEIATGHSYACKSISKRKLV  114

Query  612  SKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             KNDKEDIKRE+QI+QHL+GQ NIV   G +
Sbjct  115  HKNDKEDIKREMQILQHLTGQSNIVEFKGSY  145



>ref|NP_001266075.1| calcium-dependent protein kinase 21-like [Cicer arietinum]
 gb|AAP72281.2| calcium-dependent calmodulin-independent protein kinase isoform 
1 [Cicer arietinum]
Length=556

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 92/144 (64%), Gaps = 26/144 (18%)
 Frame = +3

Query  297  TESHQ----KASSTHAQTYTQPERPYNPQP----QSYAPVHVPAKpssvpqpvrpvqrpE  452
            T +HQ    + SSTH QT   P+   NP+P    Q+   VH                   
Sbjct  35   TNNHQYHSVQPSSTHVQT-PPPKPDSNPKPTVTTQNVKTVH-----------------KT  76

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
               ILGKPF+DIK HY+LG+ELGRGQFG+TY CTE ST   YACKSILKRKLVSK+D+ED
Sbjct  77   DTTILGKPFDDIKKHYTLGQELGRGQFGITYFCTENSTGNTYACKSILKRKLVSKSDRED  136

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQI+QHLSGQPNIV   G +
Sbjct  137  IKREIQILQHLSGQPNIVEFKGAY  160



>ref|XP_010422295.1| PREDICTED: calcium-dependent protein kinase 21 [Camelina sativa]
Length=534

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T   YACKSILKRKL+SK DKE
Sbjct  67   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIETGNTYACKSILKRKLISKQDKE  126

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQ+LSGQPNIV   G +
Sbjct  127  DVKREIQIMQYLSGQPNIVEIKGAY  151



>ref|XP_008463413.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis melo]
Length=519

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 99/171 (58%), Gaps = 35/171 (20%)
 Frame = +3

Query  204  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQ---TYTQPERPYNPQ  371
            MG C SK K SRQ D   Y Q        QP      KA + HA     Y QP       
Sbjct  1    MGICTSKGKYSRQYD--RYEQ--------QP------KAPAQHAHRSPEYHQPAAAAKSS  44

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
                +P H P +                + ILGKP ED+K HY++GKELGRGQFGVTYLC
Sbjct  45   GPPKSPKHTPFRS---------------DTILGKPLEDVKLHYTIGKELGRGQFGVTYLC  89

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE S+ + YACKSILKRKLV++NDKEDI+REI IMQHLSGQPNIV   G +
Sbjct  90   TENSSGKQYACKSILKRKLVTRNDKEDIRREIHIMQHLSGQPNIVEFKGAY  140



>ref|XP_010455773.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=536

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T   YACKSILKRKL+SK DKE
Sbjct  69   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIETGNTYACKSILKRKLISKQDKE  128

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQ+LSGQPNIV   G +
Sbjct  129  DVKREIQIMQYLSGQPNIVEIKGAY  153



>ref|XP_011095398.1| PREDICTED: calcium-dependent protein kinase 33-like [Sesamum 
indicum]
Length=523

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            N ILGKP+ED+KAHYSLGKELGRGQFGVT+LCT+I+T + YACKSI K+KLV+K+DKED+
Sbjct  61   NTILGKPYEDVKAHYSLGKELGRGQFGVTHLCTDIATGQKYACKSISKKKLVTKSDKEDM  120

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REIQIMQHLSGQPNIV   G +
Sbjct  121  RREIQIMQHLSGQPNIVEFKGAY  143



>ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 2-like [Cucumis sativus]
 gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus]
Length=552

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 100/183 (55%), Gaps = 27/183 (15%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVAT-----GYQP--VTESHQKASSTHAQT--------  338
            MG C S        VNG+    G+AT      YQP     +  K S+   Q         
Sbjct  1    MGCCSSTQMPPSSGVNGFDSATGIATRGPYQAYQPQSTVPTPHKVSAPQTQIPSSRNQPQ  60

Query  339  -YTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKE  515
                 E P +    S   V  P    +            P  ILG+P++DIK +Y+LGKE
Sbjct  61   PPPPAEHPTSASAFSKPAVSTPRTAQNY-----------PETILGRPYDDIKKYYTLGKE  109

Query  516  LGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXA  695
            LGRGQFG+TYLCTE ST + YACKSILKRKL+SKNDK+D+KREI I+QHLSGQPNIV   
Sbjct  110  LGRGQFGITYLCTENSTGQTYACKSILKRKLISKNDKDDMKREILILQHLSGQPNIVEFK  169

Query  696  GCF  704
            G +
Sbjct  170  GAY  172



>ref|XP_006657762.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Oryza brachyantha]
Length=531

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 105/167 (63%), Gaps = 14/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ S          GRG A GY     SHQ  S+    +Y  P+    P P + 
Sbjct  1    MGMCCSRATSPDS-------GRGGANGY---GYSHQAKSAQAPPSYNHPQ----PPPPAE  46

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                 PA    V  PV    +P P+ ILGKP+ED+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  47   VRYTPPAMNPPVVPPVVAPPKPTPDTILGKPYEDVRSAYSLGKELGRGQFGVTYLCTEIA  106

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T + YACKSI KRKLVSK DKEDI+REIQIMQHLSGQ NIV   G +
Sbjct  107  TGKQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQQNIVEFRGAY  153



>ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum]
 emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum]
Length=553

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            NNILGKPFE+I+  Y+LGKELGRGQFGVTY CTE ST   YACKSILKRKLVSKND+ED+
Sbjct  91   NNILGKPFEEIRKLYTLGKELGRGQFGVTYYCTENSTGNPYACKSILKRKLVSKNDREDM  150

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQPNIV   G +
Sbjct  151  KREIQIMQHLSGQPNIVEFKGAY  173



>ref|XP_004152931.1| PREDICTED: calcium-dependent protein kinase-like [Cucumis sativus]
 gb|KGN56125.1| hypothetical protein Csa_3G077600 [Cucumis sativus]
Length=519

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGKP ED+K HY++GKELGRGQFGVTYLCTE S+ + YACKSILKRKLV+KNDKEDI
Sbjct  58   DTILGKPLEDVKLHYTIGKELGRGQFGVTYLCTENSSGKQYACKSILKRKLVTKNDKEDI  117

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REI IMQHLSGQPNIV   G +
Sbjct  118  RREIHIMQHLSGQPNIVEFKGAY  140



>gb|ACB71246.2| calcium-dependent protein kinase 1 [Hevea brasiliensis]
Length=556

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 79/114 (69%), Gaps = 11/114 (10%)
 Frame = +3

Query  363  NPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  542
             P P   AP ++ A+               P  ILGKP EDIK +YSLGKELGRGQFGVT
Sbjct  74   TPPPVRAAPTNLTARSVQT-----------PQTILGKPLEDIKQYYSLGKELGRGQFGVT  122

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            YLCTE ST   YACKSILKRKL++K D+EDIKRE+QIMQHLSGQPNIV   G +
Sbjct  123  YLCTENSTGHIYACKSILKRKLINKGDREDIKREVQIMQHLSGQPNIVEFRGSY  176



>gb|AGJ83807.1| calcium-dependent protein kinase 1e [Vitis amurensis]
Length=536

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 99/168 (59%), Gaps = 13/168 (8%)
 Frame = +3

Query  204  MGGCFSKSK-SRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS  380
            MG C SKSK   +   NGY  G      Y  + E   + ++     +  PE+     P +
Sbjct  1    MGICLSKSKRGSEPAYNGYGSGAVAGGVYDRIQE---RPAAVQQPPHQLPEKRV---PAA  54

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
              PV  P           P     P+ ILGK FED+K HY++GKELGRGQFGVTYLCTE 
Sbjct  55   QPPVKPPT------VAASPKPVHRPDTILGKSFEDVKLHYTIGKELGRGQFGVTYLCTEN  108

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ST   YACKSI KRKLV+KNDKEDI+REIQIMQ LSGQPNIV   G +
Sbjct  109  STGLQYACKSISKRKLVTKNDKEDIRREIQIMQDLSGQPNIVEFKGTY  156



>ref|XP_006657761.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Oryza brachyantha]
Length=559

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 105/167 (63%), Gaps = 14/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ S          GRG A GY     SHQ  S+    +Y  P+    P P + 
Sbjct  1    MGMCCSRATSPDS-------GRGGANGY---GYSHQAKSAQAPPSYNHPQ----PPPPAE  46

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                 PA    V  PV    +P P+ ILGKP+ED+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  47   VRYTPPAMNPPVVPPVVAPPKPTPDTILGKPYEDVRSAYSLGKELGRGQFGVTYLCTEIA  106

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T + YACKSI KRKLVSK DKEDI+REIQIMQHLSGQ NIV   G +
Sbjct  107  TGKQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQQNIVEFRGAY  153



>ref|XP_008806408.1| PREDICTED: calcium-dependent protein kinase 2 [Phoenix dactylifera]
Length=548

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 106/178 (60%), Gaps = 21/178 (12%)
 Frame = +3

Query  204  MGGCFSKSKS---RQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C SK K    R G  NGY       + +Q   +  Q  SS H   Y QP+ P     
Sbjct  1    MGHCCSKEKDSGRRGGGANGY-------SSHQQQLKPSQPPSSYHG--YNQPQPPPTTTE  51

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpE--------PNNILGKPFEDIKAHYSLGKELGRGQ  530
               AP   P K S+      PV  P         P+ ILGKPFED+++ Y+LGKELGRGQ
Sbjct  52   ARQAPPS-PLKSSAPTPAPVPVPVPSPAITAPRGPDTILGKPFEDVRSFYTLGKELGRGQ  110

Query  531  FGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            FGVTYLCTEI+T + YACKSI KRKL+S ND+EDI+RE+QIMQHL+GQ NIV   G +
Sbjct  111  FGVTYLCTEIATGKRYACKSIAKRKLLSANDREDIRREVQIMQHLTGQANIVEFKGAY  168



>ref|NP_001059775.1| Os07g0515100 [Oryza sativa Japonica Group]
 sp|P53683.2|CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform 2; Short=CDPK 
2 [Oryza sativa Japonica Group]
 dbj|BAC20693.1| CDP2_ORYSA Calcium-dependent protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF21689.1| Os07g0515100 [Oryza sativa Japonica Group]
Length=533

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 104/167 (62%), Gaps = 14/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ S          GRG A GY     SHQ   +    +Y  P+ P  P    Y
Sbjct  1    MGSCCSRATSPDS-------GRGGANGY---GYSHQTKPAQTTPSYNHPQPP-PPAEVRY  49

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P    A    V  PV    +P P+ ILGKP++D+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  50   TP---SAMNPPVVPPVVAPPKPTPDTILGKPYDDVRSVYSLGKELGRGQFGVTYLCTEIA  106

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            + + YACKSI KRKLVSK DKEDI+REIQIMQHLSGQ NIV   G +
Sbjct  107  SGKQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQQNIVEFRGAY  153



>ref|XP_003563028.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Brachypodium 
distachyon]
Length=532

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGK +ED+++ YSLGKELGRGQFGVTYLCTEI+T R YACKSI KRKLVSK DKED
Sbjct  69   PDTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEIATGRQYACKSISKRKLVSKADKED  128

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            I+REIQIMQHLSGQPNIV   G +
Sbjct  129  IRREIQIMQHLSGQPNIVEFCGAY  152



>ref|XP_006365956.1| PREDICTED: calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=526

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 99/167 (59%), Gaps = 21/167 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SKSK  +   +G+ +  G   G+             H     Q +   +P P++ 
Sbjct  1    MGVCLSKSKPAESKSDGHYRSGGSDGGH------------NHGTHQAQIQYTKSPGPETQ  48

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P+   A          P    +   ILGK FED+KAHY+LGKELGRGQFGVT+LCTEI+
Sbjct  49   LPLRPQA---------SPKPVFKQETILGKAFEDVKAHYTLGKELGRGQFGVTFLCTEIA  99

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T   YACKSI K+KLV+K+DK D++REIQIMQHLSGQPNIV   G +
Sbjct  100  TGHQYACKSISKKKLVTKSDKADMRREIQIMQHLSGQPNIVAFKGAY  146



>ref|XP_010467929.1| PREDICTED: calcium-dependent protein kinase 21-like [Camelina 
sativa]
Length=873

 Score =   140 bits (353),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 101/166 (61%), Gaps = 15/166 (9%)
 Frame = +3

Query  210  GCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ-SYA  386
            GCFS    +  +  G R     +    PV    Q   +     + +P+ P  P+P+ +Y 
Sbjct  2    GCFSSKPRKTQNHGGER-----SIPINPV----QTHVANQVPEHRKPQIP-TPKPKPTYQ  51

Query  387  PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIST  566
            P+H             P+   +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T
Sbjct  52   PIH----QQISTPSSNPISVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIET  107

Query  567  RRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
               YACKSILKRKL+SK DKED+KREIQIMQ+LSGQPNIV   G +
Sbjct  108  GNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKGAY  153


 Score =   140 bits (353),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 101/166 (61%), Gaps = 15/166 (9%)
 Frame = +3

Query  210  GCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQ-SYA  386
            GCFS    +  +  G R     +    PV    Q   +     + +P+ P  P+P+ +Y 
Sbjct  339  GCFSSKPRKTQNHGGER-----SIPINPV----QTHVANQVPEHRKPQIP-TPKPKPTYQ  388

Query  387  PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIST  566
            P+H             P+   +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY+C EI T
Sbjct  389  PIH----QQISTPSSNPISVRDPDTILGKPFEDIRKFYSLGKELGRGQFGITYMCREIET  444

Query  567  RRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
               YACKSILKRKL+SK DKED+KREIQIMQ+LSGQPNIV   G +
Sbjct  445  GNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKGAY  490



>gb|ERN17348.1| hypothetical protein AMTR_s00037p00138680 [Amborella trichopoda]
Length=390

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 97/169 (57%), Gaps = 12/169 (7%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG CFSK  S         +  G   GYQP +    +         T+ ERP    P S 
Sbjct  1    MGDCFSKKNSES-------EADGAGGGYQPASRQQNQQKEQQQPHNTRSERPGQQLPPSS  53

Query  384  APVHVPAKpssvpqpvrpvqrpEP--NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  557
             P   P    +           EP  + ILGKPF ++K+ Y+LGKELGRGQFGVTYLCTE
Sbjct  54   QPKASPLPHPASSYEQPKP---EPGVDTILGKPFLNVKSFYTLGKELGRGQFGVTYLCTE  110

Query  558  ISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             ST  +YACKSI KRKLV K+D++D+KREIQIMQHL+GQ NIV   G +
Sbjct  111  NSTGLSYACKSISKRKLVRKSDRDDVKREIQIMQHLTGQANIVEFKGAY  159



>ref|XP_011627635.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Amborella 
trichopoda]
Length=413

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 97/169 (57%), Gaps = 12/169 (7%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG CFSK  S         +  G   GYQP +    +         T+ ERP    P S 
Sbjct  1    MGDCFSKKNSES-------EADGAGGGYQPASRQQNQQKEQQQPHNTRSERPGQQLPPSS  53

Query  384  APVHVPAKpssvpqpvrpvqrpEP--NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTE  557
             P   P    +           EP  + ILGKPF ++K+ Y+LGKELGRGQFGVTYLCTE
Sbjct  54   QPKASPLPHPASSYEQPKP---EPGVDTILGKPFLNVKSFYTLGKELGRGQFGVTYLCTE  110

Query  558  ISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             ST  +YACKSI KRKLV K+D++D+KREIQIMQHL+GQ NIV   G +
Sbjct  111  NSTGLSYACKSISKRKLVRKSDRDDVKREIQIMQHLTGQANIVEFKGAY  159



>ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGKP+EDI+++Y LGKELGRGQFG+TYLCTE ST + YACKSILKRKLV+  DKED
Sbjct  126  PDTILGKPYEDIRSNYRLGKELGRGQFGITYLCTENSTGQTYACKSILKRKLVTSADKED  185

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQI+QHLSGQPNIV   G +
Sbjct  186  IKREIQILQHLSGQPNIVEFKGVY  209



>gb|KDO78219.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
 gb|KDO78220.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=447

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 97/170 (57%), Gaps = 12/170 (7%)
 Frame = +3

Query  210  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST  +YACKSILKRKLV+K D+EDIKREIQIMQHLSGQ NIV   G +
Sbjct  115  ENSTGNSYACKSILKRKLVNKQDREDIKREIQIMQHLSGQQNIVEFRGAY  164


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G + +   +GA+EDRQSVHLVMEL S GEL D+IIA
Sbjct  153  GQQNIVEFRGAYEDRQSVHLVMELCSGGELFDKIIA  188



>gb|ABD98804.1| calcium-dependent protein kinase [Triticum aestivum]
Length=532

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 104/170 (61%), Gaps = 20/170 (12%)
 Frame = +3

Query  204  MGGCFSKS---KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG C S++    S QG  NGY        GY     SHQ   +    +Y   +    P P
Sbjct  1    MGQCCSRATSPDSVQGGANGY--------GY-----SHQPKQAQTPPSYNNAQ----PPP  43

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            Q+      PA    V  PV    +P P+ ILGK ++D+++ Y LGKELGRGQFGVTYLCT
Sbjct  44   QAEVRYTPPAMNPPVVPPVVAPSKPMPDTILGKQYDDVRSVYPLGKELGRGQFGVTYLCT  103

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            EIST R YACKSI KRKLVSK DKEDI+REIQIMQHLSGQPNIV   G +
Sbjct  104  EISTGRQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQPNIVEFCGAY  153



>ref|XP_009144515.1| PREDICTED: calcium-dependent protein kinase 21 [Brassica rapa]
 emb|CDX97315.1| BnaA02g21060D [Brassica napus]
Length=520

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 83/127 (65%), Gaps = 11/127 (9%)
 Frame = +3

Query  324  THAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYS  503
            T AQT+  PE      P ++  +  P                +P+ ILGKPFEDI+  YS
Sbjct  22   TPAQTHVVPEHRKPQTPPTHHQISAPP-----------ATVRDPDTILGKPFEDIRKFYS  70

Query  504  LGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNI  683
            LGKELGRGQFG+TY C EIST   YACKSILKRKL+SK DKED+KREIQIMQ+LSGQ NI
Sbjct  71   LGKELGRGQFGITYRCREISTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQANI  130

Query  684  VLXAGCF  704
            V   G +
Sbjct  131  VEIKGAY  137


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  ++GA+EDRQSVHLVMEL + GEL DRIIA
Sbjct  126  GQANIVEIKGAYEDRQSVHLVMELCAGGELFDRIIA  161



>gb|KDO78217.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=544

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 97/170 (57%), Gaps = 12/170 (7%)
 Frame = +3

Query  210  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST  +YACKSILKRKLV+K D+EDIKREIQIMQHLSGQ NIV   G +
Sbjct  115  ENSTGNSYACKSILKRKLVNKQDREDIKREIQIMQHLSGQQNIVEFRGAY  164


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G + +   +GA+EDRQSVHLVMEL S GEL D+IIA
Sbjct  153  GQQNIVEFRGAYEDRQSVHLVMELCSGGELFDKIIA  188



>gb|KDO78218.1| hypothetical protein CISIN_1g009091mg [Citrus sinensis]
Length=523

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 97/170 (57%), Gaps = 12/170 (7%)
 Frame = +3

Query  210  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST  +YACKSILKRKLV+K D+EDIKREIQIMQHLSGQ NIV   G +
Sbjct  115  ENSTGNSYACKSILKRKLVNKQDREDIKREIQIMQHLSGQQNIVEFRGAY  164


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G + +   +GA+EDRQSVHLVMEL S GEL D+IIA
Sbjct  153  GQQNIVEFRGAYEDRQSVHLVMELCSGGELFDKIIA  188



>gb|AEY99979.1| calcium-dependent protein kinase [Nicotiana tabacum]
Length=522

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
             ILGKPFED+KA+Y+LGKELGRGQFGVT+LCTEI+T   YACKSI K+KLV+K+DKED++
Sbjct  61   TILGKPFEDVKAYYTLGKELGRGQFGVTFLCTEIATGHQYACKSISKKKLVTKSDKEDMR  120

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  121  REIQIMQHLSGQPNIVEFKGAY  142



>ref|XP_009592788.1| PREDICTED: calcium-dependent protein kinase 2 [Nicotiana tomentosiformis]
Length=522

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
             ILGKPFED+KA+Y+LGKELGRGQFGVT+LCTEI+T   YACKSI K+KLV+K+DKED++
Sbjct  61   TILGKPFEDVKAYYTLGKELGRGQFGVTFLCTEIATGHQYACKSISKKKLVTKSDKEDMR  120

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  121  REIQIMQHLSGQPNIVEFKGAY  142



>ref|XP_003529633.1| PREDICTED: calcium-dependent protein kinase isoform [Glycine 
max]
Length=529

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
             +I+GKPF+DIK +YS+GKELGRGQFG+TYLCTE S+   YACKSILKRKLVSK D+ED+
Sbjct  67   TSIVGKPFDDIKKYYSIGKELGRGQFGITYLCTENSSGGTYACKSILKRKLVSKADREDM  126

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQPNIV   G F
Sbjct  127  KREIQIMQHLSGQPNIVEFKGAF  149



>ref|XP_010545509.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
 ref|XP_010545510.1| PREDICTED: calcium-dependent protein kinase 33 [Tarenaya hassleriana]
Length=534

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 106/171 (62%), Gaps = 21/171 (12%)
 Frame = +3

Query  204  MGGCFSK-SKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYT-QPERPY--NPQ  371
            MG CFSK +   +   NGYR     A  ++    SHQ      AQ  + QPE+P   N Q
Sbjct  1    MGICFSKKNHGLKPQQNGYRSAE--AENHR----SHQDPPPYAAQQRSAQPEKPAGANQQ  54

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
            P S + + VP+   +             + IL KP+ED++  YSLGKELGRGQFGVTYLC
Sbjct  55   PPSRSSMPVPSPKGTKH-----------STILEKPYEDVRLFYSLGKELGRGQFGVTYLC  103

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST + YACKSI K+KLV+K D+ED++REIQIMQHLSGQPNIV   G +
Sbjct  104  TENSTGKQYACKSISKKKLVTKGDREDMRREIQIMQHLSGQPNIVEFKGAY  154



>ref|XP_010529441.1| PREDICTED: calcium-dependent protein kinase 21 [Tarenaya hassleriana]
Length=544

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 100/172 (58%), Gaps = 19/172 (11%)
 Frame = +3

Query  210  GCFS-KSKSRQGDVNGYRQG------RGVATGYQPVTESHQKASSTHAQTYTQPERPYNP  368
            GCFS K +  Q  V+G R        +     + P         +   QT +QP+    P
Sbjct  2    GCFSNKHRGAQAGVSGGRSSVPTNPTQTHVVHHVPEPRKQSDPQNHQPQTNSQPKPANQP  61

Query  369  QPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
             PQ    V  P KP +V          EP+ ILGK FEDIK  Y+LGKELGRGQFG+TY 
Sbjct  62   IPQQ---VSTPLKPVAVR---------EPDTILGKSFEDIKKFYTLGKELGRGQFGITYR  109

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            CTEIST   YACKSILKRKL S+ DKED+KREIQIMQ+LSGQ NIV   G +
Sbjct  110  CTEISTGNTYACKSILKRKLTSRQDKEDVKREIQIMQYLSGQANIVEIKGAY  161



>ref|XP_006391947.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
 gb|ESQ29233.1| hypothetical protein EUTSA_v10023804mg [Eutrema salsugineum]
Length=553

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (75%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TYLCTEIS+ ++YACKSILKRKL+   D+E
Sbjct  84   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYLCTEISSGKSYACKSILKRKLIRTQDRE  143

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIMQ+LSGQPNIV   G +        V   C G  L
Sbjct  144  DVRREIQIMQYLSGQPNIVEIKGSYEDRQSVHLVMELCEGGEL  186



>ref|XP_002278179.1| PREDICTED: calcium-dependent protein kinase 2 [Vitis vinifera]
Length=536

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGK FED+K HY++GKELGRGQFGVTYLCTE ST   YACKSI KRKLV+KNDKED
Sbjct  73   PDTILGKSFEDVKLHYTIGKELGRGQFGVTYLCTENSTGLQYACKSISKRKLVTKNDKED  132

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            I+REIQIMQ LSGQPNIV   G +
Sbjct  133  IRREIQIMQDLSGQPNIVEFKGAY  156



>gb|ADM14342.1| calcium-dependent protein kinase 19 [Oryza sativa Japonica Group]
Length=533

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 103/167 (62%), Gaps = 14/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ S          GRG A GY     SHQ   +    +Y  P+ P  P    Y
Sbjct  1    MGSCCSRATSPDS-------GRGGANGY---GYSHQTKPAQTTPSYNHPQPP-PPAEVRY  49

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P    A    V  PV    +P P+ ILGKP++D+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  50   TP---SAMNPPVVPPVVAPPKPTPDTILGKPYDDVRSVYSLGKELGRGQFGVTYLCTEIA  106

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            + + YACKSI KRKLVSK DKEDI+REIQIMQHL GQ NIV   G +
Sbjct  107  SGKQYACKSISKRKLVSKADKEDIRREIQIMQHLYGQQNIVEFRGAY  153



>ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
 gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum]
Length=535

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P+ ILGKPFEDI+  YSLGKELGRGQFG+TY C EIST   YACKSILKRKL+SK DKE
Sbjct  68   DPDTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSILKRKLISKQDKE  127

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQ+LSGQ NIV   G +
Sbjct  128  DVKREIQIMQYLSGQANIVEIKGAY  152


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  ++GA+EDRQSVHLVMEL + GEL DRIIA
Sbjct  141  GQANIVEIKGAYEDRQSVHLVMELCAGGELFDRIIA  176



>emb|CAA65500.1| protein kinase [Medicago sativa]
Length=542

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 103/170 (61%), Gaps = 17/170 (10%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVN--GYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ-P  374
            MG   SK K  + + N  GYR     ++G      +H++ +++     T P   Y PQ P
Sbjct  1    MGCLLSKDKDSEQEHNNGGYRYAE--SSGMHNHRNNHEQVNTSR----TAPTSSYQPQIP  54

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
               + +  P+    + Q        + N ILGK  ED+K  Y+LGKELGRGQFGVT+LCT
Sbjct  55   TKPSSISAPSPKPLIKQ--------DTNTILGKGLEDVKQFYTLGKELGRGQFGVTFLCT  106

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST   YACKSI KRKLVSK+D+EDIKREIQIMQHLSGQPNIV   G +
Sbjct  107  ENSTGLLYACKSISKRKLVSKSDREDIKREIQIMQHLSGQPNIVEFKGAY  156



>dbj|BAE71239.1| putative calcium dependent protein kinase [Trifolium pratense]
Length=558

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            ILGKPFEDIK  Y+LGKELGRGQFG+TY CTE ST   YACKSILKRKLVSK D+EDIKR
Sbjct  98   ILGKPFEDIKKFYTLGKELGRGQFGITYFCTENSTGLNYACKSILKRKLVSKADREDIKR  157

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQI+QHLSGQPNIV   G +
Sbjct  158  EIQILQHLSGQPNIVEFKGAY  178



>ref|XP_010093289.1| Calcium-dependent protein kinase 15 [Morus notabilis]
 gb|EXB53814.1| Calcium-dependent protein kinase 15 [Morus notabilis]
Length=539

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 101/176 (57%), Gaps = 25/176 (14%)
 Frame = +3

Query  204  MGGCFSKSKS-----RQGDVNGYRQGRGVATGYQ----PVTESHQKASSTHAQTYTQPER  356
            MG C SK+K+     R  + N +      +T  Q    P+    QK  +T       PE 
Sbjct  1    MGCCGSKTKTITSTARPNNDNVHGSSTITSTSQQAHQEPIIHP-QKVQTTFPPPKHTPEP  59

Query  357  PYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFG  536
              +P+PQ   P   P                 P+ ILG+PFEDIK HY+LGKELGRGQFG
Sbjct  60   ERHPKPQPVLPQTNPVP---------------PDAILGRPFEDIKQHYTLGKELGRGQFG  104

Query  537  VTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            +TYLCTE ST   +ACKSILKRKL  ++D++D+KREIQIMQHLSGQ NIV   G +
Sbjct  105  ITYLCTENSTGETFACKSILKRKLARQSDRDDVKREIQIMQHLSGQSNIVQIKGAY  160



>ref|XP_006467440.1| PREDICTED: calcium-dependent protein kinase 21-like [Citrus sinensis]
Length=544

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 97/170 (57%), Gaps = 12/170 (7%)
 Frame = +3

Query  210  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            +  AP   P +              +P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQKPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST  +YACKSILKRKLV+K D+EDIKREIQIMQHL+GQ NIV   G +
Sbjct  115  ENSTGNSYACKSILKRKLVNKQDREDIKREIQIMQHLAGQQNIVEFRGAY  164


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  667  VGSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
             G + +   +GA+EDRQSVHLVMEL S GEL D+IIA
Sbjct  152  AGQQNIVEFRGAYEDRQSVHLVMELCSGGELFDKIIA  188



>ref|XP_006449723.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
 gb|ESR62963.1| hypothetical protein CICLE_v10014823mg [Citrus clementina]
Length=544

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 95/170 (56%), Gaps = 12/170 (7%)
 Frame = +3

Query  210  GCF-SKSKSRQGDVNGYRQGRG----VATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            GC+ SK +    D+NGYR         ATG    T           Q + QP       P
Sbjct  2    GCWGSKERVPPSDMNGYRSSTAHSSHQATGVATQTPYQTYQQQQQQQLHVQP-------P  54

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            +  AP   P +               P  +LGKP EDI+  Y+LGKELGRGQFG+TYLCT
Sbjct  55   KMSAPQPQPRQQPMKSSATSTRPVQMPETVLGKPLEDIRQFYTLGKELGRGQFGITYLCT  114

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST   YACKSILKRKLV+K D+EDIKREIQIMQHLSGQ NIV   G +
Sbjct  115  ENSTGNTYACKSILKRKLVNKQDREDIKREIQIMQHLSGQQNIVEFRGAY  164


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G + +   +GA+EDRQSVHLVMEL S GEL D+IIA
Sbjct  153  GQQNIVEFRGAYEDRQSVHLVMELCSGGELFDKIIA  188



>ref|XP_003610427.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92624.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=539

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            ILGKP+EDIK  Y+LGKELGRGQFG+TY CTE ST   YACKSILKRKLVSK D+EDIKR
Sbjct  79   ILGKPYEDIKKFYTLGKELGRGQFGITYFCTENSTGLNYACKSILKRKLVSKADREDIKR  138

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQI+QHLSGQPNIV   G F
Sbjct  139  EIQILQHLSGQPNIVEFKGAF  159



>gb|KDO62703.1| hypothetical protein CISIN_1g009382mg [Citrus sinensis]
Length=536

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGKP+ED+K+HY++GKELGRGQ+G+ YLC E ST R +ACKS+ KRKLVSK D++D
Sbjct  54   PDTILGKPYEDVKSHYTMGKELGRGQYGIIYLCIENSTGRQFACKSVAKRKLVSKTDRDD  113

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKRE+QIMQHLSGQPNIV   G +
Sbjct  114  IKREVQIMQHLSGQPNIVEFKGAY  137



>gb|AAQ17506.1| calcium dependent protein kinase 3 [Oryza sativa Japonica Group]
Length=527

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 103/167 (62%), Gaps = 14/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ S          GRG A GY     SHQ   +    +Y  P+ P  P    Y
Sbjct  1    MGSCCSRATSPDS-------GRGGANGY---GYSHQTKPAQTTPSYNHPQPP-PPAEVRY  49

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P    A    V  PV    +P P+ ILGK ++D+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  50   TP---SAMNPPVVPPVVAPPKPTPDTILGKLYDDVRSVYSLGKELGRGQFGVTYLCTEIA  106

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            + + YACKSI KRKLVSK DKEDI+REIQIMQHLSGQ NIV   G +
Sbjct  107  SGKQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQQNIVEFRGAY  153



>ref|XP_009604147.1| PREDICTED: calcium-dependent protein kinase 2-like [Nicotiana 
tomentosiformis]
Length=521

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
             ILGKP+ED++ HY+LGKELGRGQFGVTYLCTEIST + YACKSI K+KLV+K DK+D++
Sbjct  60   TILGKPYEDVRVHYTLGKELGRGQFGVTYLCTEISTGQQYACKSISKKKLVTKADKDDMR  119

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  120  REIQIMQHLSGQPNIVEFKGAY  141



>ref|XP_006600312.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Glycine 
max]
 gb|KHN03472.1| Calcium-dependent protein kinase 21 [Glycine soja]
Length=538

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            ILGKPF+DIK +YSLGKELGRGQFG+TYLCT+ ++   YACKSILKRKLVSK D+ED+KR
Sbjct  78   ILGKPFDDIKKYYSLGKELGRGQFGITYLCTDNASGGTYACKSILKRKLVSKADREDMKR  137

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQIMQHLSGQPNIV   G +
Sbjct  138  EIQIMQHLSGQPNIVEFKGAY  158



>emb|CAA57157.1| calcium-dependent protein kinase [Oryza sativa Japonica Group]
 gb|EAZ04052.1| hypothetical protein OsI_26188 [Oryza sativa Indica Group]
Length=533

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 103/167 (62%), Gaps = 14/167 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ S          GRG A GY     SHQ   +    +Y  P+ P  P    Y
Sbjct  1    MGSCCSRATSPDS-------GRGGANGY---GYSHQTKPAQTTPSYNHPQPP-PPAEVRY  49

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
             P    A    V  PV    +P P+ ILGK ++D+++ YSLGKELGRGQFGVTYLCTEI+
Sbjct  50   TP---SAMNPPVVPPVVAPPKPTPDTILGKLYDDVRSVYSLGKELGRGQFGVTYLCTEIA  106

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            + + YACKSI KRKLVSK DKEDI+REIQIMQHLSGQ NIV   G +
Sbjct  107  SGKQYACKSISKRKLVSKADKEDIRREIQIMQHLSGQQNIVEFRGAY  153



>ref|XP_008651864.1| PREDICTED: calcium-dependent protein kinase 2 isoform X1 [Zea 
mays]
Length=531

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 103/168 (61%), Gaps = 18/168 (11%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ +          GRG A GY           S  A+    P   YNP  Q+ 
Sbjct  1    MGQCCSRATAPDS-------GRGGANGY---------GYSNQAKPAQAPP-SYNPPQQAA  43

Query  384  APVHVP-AKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
               + P A  SS   PV    +P  + ILGK +ED+++ YSLGKELGRGQFGVTYLCTEI
Sbjct  44   EVRYTPSATNSSAVPPVAVPPKPTADTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEI  103

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ++ R YACKSI KRKLVSK D+EDI+REIQIMQHLSGQPNIV   G +
Sbjct  104  ASGRQYACKSISKRKLVSKADREDIRREIQIMQHLSGQPNIVEFRGAY  151



>ref|XP_012091348.1| PREDICTED: calcium-dependent protein kinase 21-like [Jatropha 
curcas]
 gb|KDP20751.1| hypothetical protein JCGZ_21222 [Jatropha curcas]
Length=562

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P  +LGKP EDIK  Y+LGKE+GRGQFG+TYLCTE ST   YACKSILKRKL SK+D+ED
Sbjct  105  PETVLGKPLEDIKTFYTLGKEVGRGQFGITYLCTENSTGDTYACKSILKRKLKSKSDRED  164

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKRE+QIMQHLSGQPNIV   G +
Sbjct  165  IKREVQIMQHLSGQPNIVEFRGAY  188



>dbj|BAA13440.1| calcium dependent protein kinase [Ipomoea batatas]
Length=514

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED++AHYSLGKELGRGQFGVTYLCTEI T + YACKSI K+KLV+K DK+D+
Sbjct  52   DAILGKAYEDVRAHYSLGKELGRGQFGVTYLCTEIRTGKQYACKSISKKKLVTKGDKDDM  111

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +RE+QIMQHLSGQPNIV   G +
Sbjct  112  RREVQIMQHLSGQPNIVEFKGAY  134



>ref|XP_002518484.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=551

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P  ILGKP +DI+  Y+LGKELGRGQFG+TYLCTE ST   YACKSILKRKL+SK+D+ED
Sbjct  88   PETILGKPLDDIRQFYTLGKELGRGQFGITYLCTENSTGHTYACKSILKRKLISKSDRED  147

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IK+E+QIMQHLSGQPNIV   G +
Sbjct  148  IKKEVQIMQHLSGQPNIVEFRGAY  171



>ref|NP_001105542.1| calcium-dependent protein kinase 2 [Zea mays]
 sp|P49101.1|CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2; Short=CDPK 
2 [Zea mays]
 gb|AAA69507.1| calcium-dependent protein kinase [Zea mays]
Length=513

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 91/136 (67%), Gaps = 5/136 (4%)
 Frame = +3

Query  354  RPYNPQPQSYAPVHVP-AKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQ  530
            R YNP  Q+    + P A  SS   PV    +P  + ILGK +ED+++ YS GKELGRGQ
Sbjct  16   RVYNPPQQAAEVRYTPSATNSSAVPPVAVPPKPTADTILGKQYEDVRSVYSFGKELGRGQ  75

Query  531  FGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCFRG  710
            FGVTYLCTEI++ R YACKSI KRKLVSK D+EDI+REIQIMQHLSGQPNIV   G +  
Sbjct  76   FGVTYLCTEIASGRQYACKSISKRKLVSKADREDIRREIQIMQHLSGQPNIVEFRGAYED  135

Query  711  *A----VSAPCHGASL  746
             +    V   C G  L
Sbjct  136  KSNVHVVMELCAGGEL  151



>gb|ACJ61504.1| calcium-dependent protein kinase [Glycine max]
 gb|KHM99562.1| Calcium-dependent protein kinase isoform 2 [Glycine soja]
Length=551

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 100/170 (59%), Gaps = 8/170 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C SK    Q   NGYR      TG     ++H+   +       QP   +     S 
Sbjct  1    MGCCASKESEPQH--NGYRHA---GTGGVHNQKTHEPLVNQSRAPANQPYHLHEKHAAST  55

Query  384  A---PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
            A   P ++P KP       +PV     + ILGK FED+K  Y+LGKELGRGQFGVTYLCT
Sbjct  56   AQTVPQNMPWKPPGPALSPKPVVGVRQDTILGKQFEDVKQFYTLGKELGRGQFGVTYLCT  115

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST   YACKSI KRKL SK+DKEDIKREIQIMQHLSGQPNIV   G +
Sbjct  116  ENSTGLQYACKSISKRKLASKSDKEDIKREIQIMQHLSGQPNIVEFKGAY  165



>gb|EYU27336.1| hypothetical protein MIMGU_mgv1a004414mg [Erythranthe guttata]
Length=528

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            N ILGKP+EDIK HY+LG+ELGRGQFGVT+LCT+I+T + YACKSI K+KLV+++DKED+
Sbjct  64   NTILGKPYEDIKIHYTLGRELGRGQFGVTHLCTDIATGQEYACKSISKKKLVTRSDKEDM  123

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REIQ+MQHLSGQPNIV   G +
Sbjct  124  RREIQLMQHLSGQPNIVEFKGAY  146



>ref|NP_001275322.1| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ACZ26302.1| calcium dependant protein kinase [Solanum tuberosum]
Length=532

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
             ILGK FED+KAHY+LGKELGRGQFGVT+LCTEI+T   YACKSI K+KLV+K+DK D++
Sbjct  71   TILGKAFEDVKAHYTLGKELGRGQFGVTFLCTEIATGHQYACKSISKKKLVTKSDKADMR  130

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  131  REIQIMQHLSGQPNIVAFKGAY  152



>emb|CDX91224.1| BnaC02g26350D [Brassica napus]
Length=434

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGKPFEDI+  YSLGKELGRGQFG+TY C EIST   YACKSILKRKL+SK DKED+
Sbjct  60   DTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSILKRKLISKQDKEDV  119

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQ+LSGQ NIV   G +
Sbjct  120  KREIQIMQYLSGQANIVEIKGAY  142


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  ++GA+EDRQSVHLVMEL + GEL DRIIA
Sbjct  131  GQANIVEIKGAYEDRQSVHLVMELCAGGELFDRIIA  166



>ref|XP_010929942.1| PREDICTED: calcium-dependent protein kinase 2-like [Elaeis guineensis]
Length=544

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 106/174 (61%), Gaps = 16/174 (9%)
 Frame = +3

Query  204  MGGCFSKSKS--RQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP-  374
            MG CFSK K   R+G  NGY       + +Q  +++ Q +SS H   Y QP  P  P P 
Sbjct  1    MGHCFSKEKEPGRRGGANGY-------SSHQQESKASQTSSSYHG--YNQPRPPPPPPPP  51

Query  375  ----QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  542
                Q+     VPA   +             + +LGK FED+++ Y+LGKELGRGQFGVT
Sbjct  52   AEVRQAPPKPSVPAPAPAPASASAIAAARAADTVLGKSFEDVRSLYTLGKELGRGQFGVT  111

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            YLCTEI+T   YACKSI KRKL SKND+EDI+RE+QIMQHL+GQ NIV   G +
Sbjct  112  YLCTEIATGNRYACKSISKRKLSSKNDREDIRREVQIMQHLTGQANIVEFKGAY  165



>gb|AAP03014.1| seed calcium dependent protein kinase c [Glycine max]
Length=537

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 86/133 (65%), Gaps = 15/133 (11%)
 Frame = +3

Query  306  HQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFED  485
            H+K +++ AQT  Q   P+ P   + +P  V                   + ILGK FED
Sbjct  35   HEKHAASTAQTVPQ-NMPWKPPGPALSPKPVVG--------------VRQDTILGKQFED  79

Query  486  IKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHL  665
            +K  Y+LGKELGRGQFGVTYLCTE ST   YACKSI KRKL SK+DKEDIKREIQIMQHL
Sbjct  80   VKQFYTLGKELGRGQFGVTYLCTENSTGLQYACKSISKRKLASKSDKEDIKREIQIMQHL  139

Query  666  SGQPNIVLXAGCF  704
            SGQPNIV   G +
Sbjct  140  SGQPNIVEFKGAY  152



>gb|ABE72958.1| calcium dependent protein kinase 3 [Medicago truncatula]
Length=538

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 98/170 (58%), Gaps = 21/170 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVN--GYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ-P  374
            MG   SK K  + + N  GYR G            +H+        + T P   Y PQ P
Sbjct  1    MGCLLSKDKDSEPEHNNGGYRYGE----------HNHRNNHEQVNTSRTAPTSSYQPQIP  50

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
               + +  P+    + Q        + N ILGK  ED+K  Y+LGKELGRGQFGVT+LCT
Sbjct  51   TKPSSISAPSPKPLIKQ--------DSNTILGKGLEDVKQFYTLGKELGRGQFGVTFLCT  102

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST   YACKSI KRKLVSK+D+EDIKREIQIMQHLSGQPNIV   G +
Sbjct  103  ENSTGLLYACKSISKRKLVSKSDREDIKREIQIMQHLSGQPNIVEFKGAY  152



>gb|KEH33831.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=538

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 98/170 (58%), Gaps = 21/170 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVN--GYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ-P  374
            MG   SK K  + + N  GYR G            +H+        + T P   Y PQ P
Sbjct  1    MGCLLSKDKDSEPEHNNGGYRYGE----------HNHRNNHEQVNTSRTAPTSSYQPQIP  50

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
               + +  P+    + Q        + N ILGK  ED+K  Y+LGKELGRGQFGVT+LCT
Sbjct  51   TKPSSISAPSPKPLIKQ--------DSNTILGKGLEDVKQFYTLGKELGRGQFGVTFLCT  102

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST   YACKSI KRKLVSK+D+EDIKREIQIMQHLSGQPNIV   G +
Sbjct  103  ENSTGLLYACKSISKRKLVSKSDREDIKREIQIMQHLSGQPNIVEFKGAY  152



>ref|XP_010508871.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
 ref|XP_010508878.1| PREDICTED: calcium-dependent protein kinase 9 [Camelina sativa]
Length=541

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 101/170 (59%), Gaps = 14/170 (8%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ-PERPY--NPQP  374
            MG CF+K+             R V  G   VT     + +  A+T TQ PE+P   N QP
Sbjct  1    MGNCFAKNNGLMKPQQNVHTNRSVDVG---VTNQDPPSYTPQARTTTQQPEKPGSGNSQP  57

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCT  554
                    P   ++   P    +  + N+IL   FED+K  Y+LGKELGRGQFGVTYLCT
Sbjct  58   --------PPWRTAAAAPGPSPKTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCT  109

Query  555  EISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            E ST + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  110  ENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  159



>ref|XP_003545165.1| PREDICTED: calcium-dependent protein kinase 17-like [Glycine 
max]
Length=529

 Score =   121 bits (303),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+K+ YS+GKELGRGQFGVT+LCT  ST + YACK+I KRKLV+K D ED+KR
Sbjct  62   VLGRPMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDIEDVKR  121

Query  642  EIQIMQHLSGQPNIV  686
            E+QIM HLSGQPNIV
Sbjct  122  EVQIMHHLSGQPNIV  136


 Score = 45.1 bits (105),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  L   +ED+QSVHLVMEL + GEL DRIIA
Sbjct  131  GQPNIVELVNVYEDKQSVHLVMELCAGGELFDRIIA  166



>ref|NP_001234582.1| calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
 gb|AAK52801.1|AF363784_1 calcium-dependent protein kinase CDPK1 [Solanum lycopersicum]
Length=521

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGKP+ED+K HY+LGKELGRGQFGVTYLCTEI+T + YACKSI K+KLV+K DK+D+
Sbjct  59   DTILGKPYEDVKLHYTLGKELGRGQFGVTYLCTEIATGQQYACKSISKKKLVTKADKDDM  118

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REI+IMQHLSGQPNIV   G +
Sbjct  119  RREIKIMQHLSGQPNIVEFKGAY  141



>gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus]
Length=525

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGKPFEDI+  YSLGKELGRGQFG+TY C EIST   YACKSILKRKL+SK DKED+
Sbjct  60   DTILGKPFEDIRKFYSLGKELGRGQFGITYRCREISTGNTYACKSILKRKLISKQDKEDV  119

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQ+LSGQ NIV   G +
Sbjct  120  KREIQIMQYLSGQANIVEIKGAY  142


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  ++GA+EDRQSVHLVMEL + GEL DRIIA
Sbjct  131  GQANIVEIKGAYEDRQSVHLVMELCAGGELFDRIIA  166



>gb|AET00506.2| calcium-dependent kinase [Medicago truncatula]
Length=540

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            N ILGK FED+K  Y+LGKELGRGQFGVTYLCTE ST   YACKSI KRKLVSK+DKEDI
Sbjct  78   NAILGKQFEDVKQIYTLGKELGRGQFGVTYLCTENSTGLKYACKSISKRKLVSKSDKEDI  137

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQH+SGQPNIV   G +
Sbjct  138  KREIQIMQHMSGQPNIVEFKGAY  160



>emb|CDY07254.1| BnaC04g19170D [Brassica napus]
Length=543

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 97/167 (58%), Gaps = 26/167 (16%)
 Frame = +3

Query  270  GVATGYQPVTESHQKASSTHAQTYTQPER---PYN-PQPQSYAPVHVPAKpssvpqpvrp  437
            G AT  QP+ +  Q A   + Q   QP +   P + PQPQ    +               
Sbjct  30   GEATQKQPLRQ-RQTAPRANIQIVVQPHKLPLPVSIPQPQEQQKL---------------  73

Query  438  vqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSK  617
                +P  ILGKPFED+K  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSILKRKL+  
Sbjct  74   --MHQPEPILGKPFEDVKETYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRT  131

Query  618  NDKEDIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
             D+ED++REIQIMQ+LSGQPNIV   G +        V   C G  L
Sbjct  132  QDREDVRREIQIMQYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  178



>gb|KFK40633.1| hypothetical protein AALP_AA2G022000 [Arabis alpina]
Length=551

 Score =   132 bits (333),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 76/103 (74%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  ILGKPFED+K  YSLG+ELGRGQFG+TYLCTEIS+ + +ACKSILKRKL+   D+E
Sbjct  85   QPEPILGKPFEDVKEKYSLGRELGRGQFGITYLCTEISSGKNFACKSILKRKLIRTQDRE  144

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIMQ+LSGQPNIV   G +        V   C G  L
Sbjct  145  DVRREIQIMQYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  187



>ref|XP_006346214.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Solanum 
tuberosum]
Length=521

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGKP+ED+K HY+LGKELGRGQFGVTYLCTEI T + YACKSI K+KLV+K DK+D+
Sbjct  59   DTILGKPYEDVKLHYTLGKELGRGQFGVTYLCTEIVTGQQYACKSISKKKLVTKADKDDM  118

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REI+IMQHLSGQPNIV   G +
Sbjct  119  RREIKIMQHLSGQPNIVEFKGAY  141



>ref|XP_010466227.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466228.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
 ref|XP_010466229.1| PREDICTED: calcium-dependent protein kinase 9-like [Camelina 
sativa]
Length=542

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 105/173 (61%), Gaps = 19/173 (11%)
 Frame = +3

Query  204  MGGCFSKSKSR---QGDVNGYRQ-GRGVATGYQPVTESHQKASSTHAQTYTQPERPY--N  365
            MG CF+K+      Q +V+  R    GV T   P + + Q  ++T      QPE+P   N
Sbjct  1    MGNCFAKNNGLMKPQQNVHTNRSVDVGVVTNQDPPSYTPQARATTQ-----QPEKPGSGN  55

Query  366  PQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
             QP        P   ++   P    +  + N+IL   FED+K  Y+LGKELGRGQFGVTY
Sbjct  56   SQP--------PPWRTAAAAPGPSPKTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTY  107

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            LCTE ST + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  108  LCTENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  160



>ref|XP_004957849.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Setaria italica]
 gb|AGG54988.1| CDPK1, partial [Setaria italica]
Length=531

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED++  YSLGKELGRGQFGVTYLCTEI+T R YACKSI KRKL SK D+EDI
Sbjct  69   DTILGKQYEDVRTVYSLGKELGRGQFGVTYLCTEIATGRQYACKSISKRKLTSKADREDI  128

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REIQIMQHLSGQPNIV   G +
Sbjct  129  RREIQIMQHLSGQPNIVEFRGAY  151



>ref|XP_006452344.1| hypothetical protein CICLE_v10007980mg [Citrus clementina]
 ref|XP_006475076.1| PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis]
 gb|ESR65584.1| hypothetical protein CICLE_v10007980mg [Citrus clementina]
Length=531

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
             ILGKP+ED+K HY++GKELGRGQ+G+ YLCTE ST R +ACKS+ KRKLVSK D++DIK
Sbjct  51   TILGKPYEDVKCHYTMGKELGRGQYGIIYLCTENSTGRQFACKSVAKRKLVSKTDRDDIK  110

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            RE+QIMQHLSGQPNIV   G +
Sbjct  111  REVQIMQHLSGQPNIVEFKGAY  132



>ref|NP_001275371.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|AAL09044.3|AF418563_1 calcium-dependent protein kinase 2 [Solanum tuberosum]
 gb|ADK10908.1| calcium-dependent protein kinase 2 [Solanum tuberosum]
Length=515

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGKP+ED+K HY+LGKELGRGQFGVTYLCTEI T + YACKSI K+KLV+K DK+D+
Sbjct  59   DTILGKPYEDVKLHYTLGKELGRGQFGVTYLCTEIVTGQQYACKSISKKKLVTKADKDDM  118

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REI+IMQHLSGQPNIV   G +
Sbjct  119  RREIKIMQHLSGQPNIVEFKGAY  141



>ref|NP_176386.2| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
 sp|Q1PFH8.1|CDPKJ_ARATH RecName: Full=Calcium-dependent protein kinase 19 [Arabidopsis 
thaliana]
 gb|ABE65733.1| calcium-dependent protein kinase/CDPK [Arabidopsis thaliana]
 gb|AEE33906.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana]
Length=551

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 96/173 (55%), Gaps = 13/173 (8%)
 Frame = +3

Query  240  GDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssv  419
            G+ N   + R +    QP     Q A     Q   QP +   P PQ       P +   +
Sbjct  21   GEQNTEVKSREITPKEQP--RQRQPAPRAKFQIVVQPHKLPLPLPQ-------PQEKQKL  71

Query  420  pqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILK  599
                +     +P  ILG+PFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSILK
Sbjct  72   INHQKQSTLQQPEPILGRPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILK  131

Query  600  RKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            RKL+   D+ED++REIQIM +LSGQPNIV   G +        V   C G  L
Sbjct  132  RKLIRTKDREDVRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  184



>gb|AAD28192.2| calcium-dependent protein kinase [Solanum tuberosum]
 gb|ABF56558.1| calcium-dependent protein kinase 1 [Solanum tuberosum]
Length=532

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
             ILGK FED+KAHY+LGKELGRGQ+GVT+LCTEI+T   YACKSI K+KLV+K+DK D++
Sbjct  71   TILGKAFEDVKAHYTLGKELGRGQYGVTFLCTEIATGHQYACKSISKKKLVTKSDKADMR  130

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  131  REIQIMQHLSGQPNIVEFKGAY  152



>gb|AIU98507.1| calcium-dependent protein kinase [Musa acuminata AAA Group]
Length=519

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            PN ILGKPF D+++ YSLGKELGRGQFGVTYLCTE +T   YACKS+ KRKL +K+D+ED
Sbjct  56   PNAILGKPFADVRSLYSLGKELGRGQFGVTYLCTETATGAQYACKSVSKRKLATKSDRED  115

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQIMQHL+GQ NIV   G +
Sbjct  116  IKREIQIMQHLTGQANIVEFKGAY  139



>ref|NP_001235641.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
 gb|AAB80693.1| calmodulin-like domain protein kinase isoenzyme gamma [Glycine 
max]
Length=538

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 86/133 (65%), Gaps = 15/133 (11%)
 Frame = +3

Query  306  HQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFED  485
            H+K +++ AQT  Q   P+ P   + +P  V                   + ILGK FED
Sbjct  35   HEKHAASTAQTVPQ-NMPWKPPGPALSPKPVVG--------------VRQDTILGKQFED  79

Query  486  IKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHL  665
            +K  ++LGKELGRGQFGVTYLCTE ST   YACKSI KRKL SK+DKEDIKREIQIMQHL
Sbjct  80   VKQFHTLGKELGRGQFGVTYLCTENSTGLQYACKSISKRKLASKSDKEDIKREIQIMQHL  139

Query  666  SGQPNIVLXAGCF  704
            SGQPNIV   G +
Sbjct  140  SGQPNIVEFKGAY  152



>ref|NP_188676.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
 sp|Q38868.1|CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9; AltName: Full=Calmodulin-domain 
protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAB03242.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 dbj|BAB02824.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAM53285.1| calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis 
thaliana]
 gb|AAP68337.1| At3g20410 [Arabidopsis thaliana]
 gb|AEE76375.1| calmodulin-domain protein kinase 9 [Arabidopsis thaliana]
Length=541

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 99/167 (59%), Gaps = 8/167 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG CF+K+             R V  G   VT     + +  A+T  QPE+P +   Q  
Sbjct  1    MGNCFAKNHGLMKPQQNGNTTRSVEVG---VTNQDPPSYTPQARTTQQPEKPGSVNSQPP  57

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                   + ++    + P    + N+IL   FED+K  Y+LGKELGRGQFGVTYLCTE S
Sbjct  58   P-----WRAAAAAPGLSPKTTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENS  112

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  113  TGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  159



>ref|XP_009406510.1| PREDICTED: calcium-dependent protein kinase isoform 2 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            PN ILGKPF D+++ YSLGKELGRGQFGVTYLCTE +T   YACKS+ KRKL +K+D+ED
Sbjct  56   PNAILGKPFADVRSLYSLGKELGRGQFGVTYLCTETATGAQYACKSVSKRKLATKSDRED  115

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            IKREIQIMQHL+GQ NIV   G +
Sbjct  116  IKREIQIMQHLTGQANIVEFKGAY  139



>ref|XP_010538709.1| PREDICTED: calcium-dependent protein kinase 21-like [Tarenaya 
hassleriana]
Length=545

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 99/173 (57%), Gaps = 20/173 (12%)
 Frame = +3

Query  210  GCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQ---KASSTHA-----QTYTQPERPYN  365
            GCFS    R    N   QG   A   Q     H    +  S H      QT +QP    +
Sbjct  2    GCFSSKHRRAQAGNNGGQGSVPANPTQSHVVHHVPEPRKPSIHQNHQAQQTKSQPNPTNH  61

Query  366  PQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTY  545
            P P   AP   P+KP +V          EP  ILGKPFEDI+  Y+LGKELGRGQFG+TY
Sbjct  62   PTPHQ-APT--PSKPVAVR---------EPETILGKPFEDIRKFYTLGKELGRGQFGITY  109

Query  546  LCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             C E ST   YACKSILKRKL S+ D++D+KREIQIMQ+LSGQPNIV   G +
Sbjct  110  RCKENSTGNTYACKSILKRKLTSRQDRDDVKREIQIMQYLSGQPNIVEIKGAY  162



>gb|ACR34538.1| unknown [Zea mays]
Length=531

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 102/168 (61%), Gaps = 18/168 (11%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG C S++ +          GRG A GY           S  A+    P   YNP  Q+ 
Sbjct  1    MGQCCSRATAPDS-------GRGGANGY---------GYSNQAKPAQAPP-SYNPPQQAA  43

Query  384  APVHVP-AKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
               + P A  SS   PV    +P  + ILGK +ED+++ YSLGKELGRGQF VTYLCTEI
Sbjct  44   EVRYTPSATNSSAVPPVAVPPKPTADTILGKQYEDVRSVYSLGKELGRGQFRVTYLCTEI  103

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            ++ R YACKSI KRKLVSK D+EDI+REIQIMQHLSGQPNIV   G +
Sbjct  104  ASGRQYACKSISKRKLVSKADREDIRREIQIMQHLSGQPNIVEFRGAY  151



>ref|XP_004957848.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Setaria italica]
Length=559

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED++  YSLGKELGRGQFGVTYLCTEI+T R YACKSI KRKL SK D+EDI
Sbjct  69   DTILGKQYEDVRTVYSLGKELGRGQFGVTYLCTEIATGRQYACKSISKRKLTSKADREDI  128

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REIQIMQHLSGQPNIV   G +
Sbjct  129  RREIQIMQHLSGQPNIVEFRGAY  151



>ref|XP_009603797.1| PREDICTED: calcium-dependent protein kinase 17-like [Nicotiana 
tomentosiformis]
Length=536

 Score =   117 bits (292),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 92/174 (53%), Gaps = 34/174 (20%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPER-------PY  362
            MGGC SK++S             +A  Y    ESH  A +   Q  T P +        +
Sbjct  1    MGGCCSKAESDPAQ----NSNEEIAQSYSKQGESH--AGNHDMQGSTTPSKIPPHASPNH  54

Query  363  NPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  542
            + +P   AP+                       +LG+P EDIKA Y+LGKELGRGQFGVT
Sbjct  55   SSKPSKAAPI---------------------GPVLGRPMEDIKATYTLGKELGRGQFGVT  93

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            +LCT   T   +ACK+I KRKLV+K D ED++RE+QIM HL+ QPNIV   G +
Sbjct  94   HLCTHKQTGEQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTEQPNIVELKGAY  147


 Score = 47.0 bits (110),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  679  TLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
             +  L+GA+ED+ SVHLVMEL + GEL DRIIA
Sbjct  139  NIVELKGAYEDKHSVHLVMELCAGGELFDRIIA  171



>ref|XP_011037643.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037644.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
 ref|XP_011037646.1| PREDICTED: calcium-dependent protein kinase-like [Populus euphratica]
Length=532

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + +LGKPFEDIK  Y+LGKELGRGQFG+TYLCTE +T  +YACKSIL+RKLV+KND++DI
Sbjct  72   DTMLGKPFEDIKQLYTLGKELGRGQFGITYLCTENATGHSYACKSILRRKLVNKNDRDDI  131

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KRE+ IMQHLSGQPN V   G +
Sbjct  132  KREVNIMQHLSGQPNTVEFRGVY  154



>ref|XP_010430219.1| PREDICTED: calcium-dependent protein kinase 19 [Camelina sativa]
Length=482

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSILKRKL+   D+E
Sbjct  11   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTQDRE  70

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIM +LSGQPNIV   G +        V   C G  L
Sbjct  71   DVRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  113



>ref|XP_002305576.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
 gb|EEE86087.2| hypothetical protein POPTR_0004s01530g [Populus trichocarpa]
Length=532

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 102/174 (59%), Gaps = 30/174 (17%)
 Frame = +3

Query  210  GCFS-KSKSRQGDVNG--YRQGRGVATGYQ-----PVTESHQKASSTHAQTYTQPERPYN  365
            GCFS K K+ + D NG  YR      TGY         +S QKA +   QT + P RP  
Sbjct  2    GCFSSKEKAPRPDANGCTYRPS---TTGYSRQQQPQYHQSQQKAVAPQIQTQSPPRRP--  56

Query  366  PQPQSYAPVH-VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVT  542
             Q Q   P   VP                + + ILGKPFEDIK  Y+L KELGRGQFG+T
Sbjct  57   QQTQQKTPTRPVP----------------KVDTILGKPFEDIKQLYTLSKELGRGQFGIT  100

Query  543  YLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            YLCTE +T  +YACKSIL+RKLV+K D +DIKRE+ IMQHLSGQPN V   G +
Sbjct  101  YLCTENATGHSYACKSILRRKLVNKKDGDDIKREVNIMQHLSGQPNTVEFRGVY  154



>gb|KHN12036.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=580

 Score =   118 bits (296),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+  ED+K+ YS+GKELGRGQFGVT+LCT  ST + YACK+I KRKLV+K D ED+KR
Sbjct  51   VLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDIEDVKR  110

Query  642  EIQIMQHLSGQPNIV  686
            E+QIM HLSGQPNIV
Sbjct  111  EVQIMHHLSGQPNIV  125


 Score = 45.1 bits (105),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  L   +ED+QSVHLVMEL + GEL DRIIA
Sbjct  120  GQPNIVELVNVYEDKQSVHLVMELCAGGELFDRIIA  155



>ref|XP_006297378.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
 gb|EOA30276.1| hypothetical protein CARUB_v10013403mg [Capsella rubella]
Length=540

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 98/167 (59%), Gaps = 9/167 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG CF+K+             R V  G   VT     + +  A++  QPE+P +   Q  
Sbjct  1    MGNCFAKNNGLMKPQQNGHTNRSVEVG---VTNQDPPSYTPQARSTQQPEKPGSGNSQPP  57

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                    P+  P+        + N+IL   FED+K  Y+LGKELGRGQFGVTYLCTE S
Sbjct  58   PWRTAAPAPAPSPKTT------KSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENS  111

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  112  TGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  158



>ref|XP_010418170.1| PREDICTED: calcium-dependent protein kinase 19-like [Camelina 
sativa]
Length=555

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSILKRKL+   D+E
Sbjct  84   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTQDRE  143

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIM +LSGQPNIV   G +        V   C G  L
Sbjct  144  DVRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  186



>ref|XP_010434101.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
15-like [Camelina sativa]
Length=556

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = +3

Query  210  GCFS-KSKSRQGD-VNGYRQGRGVATGYQPVTESH----QKASSTHAQTYTQPERPYNPQ  371
            GCFS K ++ + D +NG  Q        Q     +    QK  S    T TQP    N Q
Sbjct  2    GCFSSKHRNTESDLINGSVQSSIPTNQSQSYVSRNVSEPQKPPSHQIPTTTQPNH-RNQQ  60

Query  372  PQSYAPVH-VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
             Q   P+  V  +      P++P+   E   ILGKPFE+I+ HY+LG ELGRGQFG+TY 
Sbjct  61   QQEAKPIDKVIEEKQVRTTPLKPIVFRETETILGKPFEEIRKHYTLGHELGRGQFGITYS  120

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            C EIST   YACKSILKRKL+ K D++D+KREIQIMQHLSGQ NIV   G +
Sbjct  121  CKEISTGNVYACKSILKRKLMRKQDRDDVKREIQIMQHLSGQENIVEIRGAY  172



>ref|XP_009789543.1| PREDICTED: calcium-dependent protein kinase 34-like [Nicotiana 
sylvestris]
Length=532

 Score =   116 bits (290),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 88/168 (52%), Gaps = 26/168 (15%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERP-YNPQPQS  380
            MGGC SK++S             +A  Y    ESH     T          P ++ +P  
Sbjct  1    MGGCCSKAESDPAQ----NSNEEIAQSYSKQGESHAGNHDTTPSKIPPHASPNHSSKPSK  56

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
             AP+                       +LG+P EDIKA Y+LGKELGRGQFGVT+LCT  
Sbjct  57   AAPI---------------------GPVLGRPMEDIKATYTLGKELGRGQFGVTHLCTHK  95

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
             T   +ACK+I KRKLV+K D ED++RE+QIM HL+ QPNIV   G +
Sbjct  96   QTGEQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTEQPNIVELKGAY  143


 Score = 47.0 bits (110),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  679  TLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
             +  L+GA+ED+ SVHLVMEL + GEL DRIIA
Sbjct  135  NIVELKGAYEDKHSVHLVMELCAGGELFDRIIA  167



>gb|KJB69279.1| hypothetical protein B456_011G014200 [Gossypium raimondii]
Length=551

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 87/139 (63%), Gaps = 12/139 (9%)
 Frame = +3

Query  288  QPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNIL  467
            QP     QK S   AQ       P   QPQ+   V VP KPS+             + +L
Sbjct  36   QPQQVQTQKVSVPEAQV------PQTRQPQA---VSVPLKPSAASTRPIQTME---DTVL  83

Query  468  GKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREI  647
            GKP EDIK +Y LGKELGRGQFG+TYLCTE ST   YACKSILKRKL SK D+EDIK+E+
Sbjct  84   GKPLEDIKQYYKLGKELGRGQFGITYLCTENSTGNTYACKSILKRKLRSKQDREDIKKEV  143

Query  648  QIMQHLSGQPNIVLXAGCF  704
            QIMQHLSGQP IV   G +
Sbjct  144  QIMQHLSGQPCIVEFRGAY  162



>ref|XP_006301218.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
 gb|EOA34116.1| hypothetical protein CARUB_v10021616mg [Capsella rubella]
Length=547

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSILKRKL+   D+E
Sbjct  78   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTQDRE  137

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIM +LSGQPNIV   G +        V   C G  L
Sbjct  138  DVRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  180



>ref|XP_002883243.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59502.1| calmodulin-domain protein kinase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 98/167 (59%), Gaps = 8/167 (5%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG CF+K+             R V  G   VT     + +  A++  QPE+P +   Q  
Sbjct  1    MGNCFAKNHGLMKPQQNGHTTRSVEVG---VTNQDPPSYTPQARSTQQPEKPGSVNSQPP  57

Query  384  APVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEIS  563
                   + ++      P    + N+IL   FED+K  Y+LGKELGRGQFGVTYLCTE S
Sbjct  58   P-----WRAAAAAPGPSPKTTSKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLCTENS  112

Query  564  TRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            T + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  113  TGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  159



>ref|XP_002888057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64316.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=553

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  ILGKPFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSILKRKL+   D+E
Sbjct  82   QPEPILGKPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTQDRE  141

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIM +LSGQPNIV   G +        V   C G  L
Sbjct  142  DVRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  184



>ref|XP_010923910.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X2 [Elaeis guineensis]
Length=503

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGK FED+++ Y+LGKELGRGQFGVTYLCTE++T + YACKSI KRKL S ND+ED
Sbjct  88   PDTILGKAFEDVRSFYTLGKELGRGQFGVTYLCTEMATGKRYACKSISKRKLSSANDRED  147

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            I+RE+QIMQHL+GQ NIV   G +
Sbjct  148  IRREVQIMQHLTGQANIVEFKGAY  171



>gb|KHG10851.1| Calcium-dependent protein kinase 21 [Gossypium arboreum]
Length=552

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 87/138 (63%), Gaps = 6/138 (4%)
 Frame = +3

Query  291  PVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILG  470
            P T   Q+   T   +  + + P   QPQ+   V VP KPS              + +LG
Sbjct  32   PQTRRPQQQVQTQKVSVPEAQVPQTRQPQA---VSVPLKPSPASTRPIQTME---DTVLG  85

Query  471  KPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQ  650
            KP EDIK +Y LGKELGRGQFG+TYLCTE ST   YACKSILKRKL SK D+EDIK+E+Q
Sbjct  86   KPLEDIKQYYKLGKELGRGQFGITYLCTENSTGNTYACKSILKRKLRSKQDREDIKKEVQ  145

Query  651  IMQHLSGQPNIVLXAGCF  704
            IMQHLSGQP IV   G +
Sbjct  146  IMQHLSGQPCIVEFRGAY  163



>ref|XP_006349794.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349795.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum tuberosum]
 ref|XP_006349796.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X3 
[Solanum tuberosum]
 ref|XP_010314698.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
 ref|XP_010314699.1| PREDICTED: calcium-dependent protein kinase 17-like isoform X2 
[Solanum lycopersicum]
Length=500

 Score =   115 bits (287),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P EDIKA Y+LGKELGRGQFGVT+LCT   T   +ACK+I KRKLV+K D ED++R
Sbjct  31   VLGRPMEDIKATYTLGKELGRGQFGVTHLCTHKQTGEQFACKTIAKRKLVNKEDIEDVRR  90

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HL+ QPNIV   G +
Sbjct  91   EVQIMHHLTEQPNIVELKGAY  111


 Score = 47.0 bits (110),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  679  TLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
             +  L+GA+ED+ SVHLVMEL + GEL DRIIA
Sbjct  103  NIVELKGAYEDKHSVHLVMELCAGGELFDRIIA  135



>ref|XP_010923909.1| PREDICTED: calcium-dependent protein kinase isoform 2-like isoform 
X1 [Elaeis guineensis]
Length=551

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  453  PNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKED  632
            P+ ILGK FED+++ Y+LGKELGRGQFGVTYLCTE++T + YACKSI KRKL S ND+ED
Sbjct  88   PDTILGKAFEDVRSFYTLGKELGRGQFGVTYLCTEMATGKRYACKSISKRKLSSANDRED  147

Query  633  IKREIQIMQHLSGQPNIVLXAGCF  704
            I+RE+QIMQHL+GQ NIV   G +
Sbjct  148  IRREVQIMQHLTGQANIVEFKGAY  171



>gb|KFK39368.1| hypothetical protein AALP_AA3G235800 [Arabis alpina]
Length=535

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 101/175 (58%), Gaps = 28/175 (16%)
 Frame = +3

Query  204  MGGCFSKS----KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ-PERPYNP  368
            MG CF+K+    K +Q   N +   R V         S Q   S   Q  +Q PE+P  P
Sbjct  1    MGNCFAKNHGLMKPQQ---NVHTNNRSVEVD----NRSQQDPPSYTPQARSQTPEKPSQP  53

Query  369  QPQ---SYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGV  539
             P    + AP   P             +  + N+IL   FED+K  Y+LGKELGRGQFGV
Sbjct  54   PPWRMAAAAPGPSP-------------KTTKSNSILENAFEDVKLFYTLGKELGRGQFGV  100

Query  540  TYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TYLCTE ST + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  101  TYLCTENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  155



>ref|XP_008804309.1| PREDICTED: calcium-dependent protein kinase isoform 2-like [Phoenix 
dactylifera]
Length=538

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + +LGKPFED+++ Y+LGKELGRGQFGVTYLCTEI+T   YACKSI KRKL SKND++DI
Sbjct  77   DTVLGKPFEDVRSLYTLGKELGRGQFGVTYLCTEIATGNRYACKSISKRKLSSKNDRDDI  136

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +RE+QIMQHL+GQ NIV   G +
Sbjct  137  RREVQIMQHLTGQANIVEFKGAY  159



>emb|CDY24863.1| BnaA03g59670D [Brassica napus]
Length=543

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  I GKPFED+K  YSLG+ELGRGQFG+TYLCTEIS+ + +ACKSILKRKL+   D+E
Sbjct  76   QPEPISGKPFEDVKETYSLGRELGRGQFGITYLCTEISSGKNFACKSILKRKLIRTQDRE  135

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIMQ+LSGQPNIV   G +        V   C G  L
Sbjct  136  DVRREIQIMQYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  178



>ref|NP_001105306.1| calcium-dependent protein kinase [Zea mays]
 dbj|BAA12715.1| calcium-dependent protein kinase [Zea mays]
 gb|ACN30810.1| unknown [Zea mays]
 gb|ACN34633.1| unknown [Zea mays]
 tpg|DAA40972.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 1 [Zea mays]
 tpg|DAA40973.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 2 [Zea mays]
 tpg|DAA40974.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 3 [Zea mays]
 tpg|DAA40975.1| TPA: putative calcium-dependent protein kinase family protein 
isoform 4 [Zea mays]
Length=531

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED+++ YSLGKELGRGQFGVTYLCTE+++ + YACKSI KRKL SK D+EDI
Sbjct  69   DTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEVASGKQYACKSISKRKLTSKADREDI  128

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            +REIQIMQHLSGQPNIV   G +
Sbjct  129  RREIQIMQHLSGQPNIVEFRGAY  151



>ref|XP_003617547.1| Calcium dependent protein kinase [Medicago truncatula]
Length=1052

 Score =   132 bits (331),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 101/171 (59%), Gaps = 15/171 (9%)
 Frame = +3

Query  204  MGGCFSKSKS----RQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ  371
            MGGC SK +S    R   V+G                +H+       Q+ T  ++PY   
Sbjct  1    MGGCLSKKESKPDHRHVGVSGIHNHNHNHNHNHNHNHNHKNHEPYVNQSKTPSQQPYQ-S  59

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
            P  +AP            P   VQRP  N ILGK FED+K  Y+LGKELGRGQFGVTYLC
Sbjct  60   PNKHAP----------RSPKPIVQRPNTNAILGKQFEDVKQIYTLGKELGRGQFGVTYLC  109

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST   YACKSI KRKLVSK+DKEDIKREIQIMQH+SGQPNIV   G +
Sbjct  110  TENSTGLKYACKSISKRKLVSKSDKEDIKREIQIMQHMSGQPNIVEFKGAY  160


 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            + N I GK FED+K  Y+LGKELGRGQFGVTYLCTE ST   YACKSI KR LVS+ DKE
Sbjct  632  DTNTIPGKQFEDVKQIYTLGKELGRGQFGVTYLCTENSTGLKYACKSISKRNLVSEPDKE  691

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            +IKREIQIMQH+SGQPNIV   G +
Sbjct  692  EIKREIQIMQHMSGQPNIVEFKGAY  716



>ref|XP_004491400.1| PREDICTED: calcium-dependent protein kinase 9-like [Cicer arietinum]
Length=559

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            + N ILGK FED+K  Y+LGKELGRGQFGVTYLCTE ST   YACKSI KRKLVSK DKE
Sbjct  95   DSNTILGKNFEDVKQIYTLGKELGRGQFGVTYLCTENSTGLKYACKSISKRKLVSKADKE  154

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            DIKRE QIMQH+SGQPNIV   G +
Sbjct  155  DIKRENQIMQHMSGQPNIVEFKGSY  179



>ref|XP_006406385.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
 gb|ESQ47838.1| hypothetical protein EUTSA_v10020475mg [Eutrema salsugineum]
Length=537

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 99/172 (58%), Gaps = 20/172 (12%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG CF+K+    G V   + G+  +       E   +   TH     Q    Y PQP+S 
Sbjct  1    MGNCFAKN---HGLVKPQQNGQTRSV------EIDHRGGGTH-----QDPPSYTPQPRSQ  46

Query  384  APVHVPAKpssvpqpvrpvqrpEP-----NNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
             P   PA      +       P P     N+IL   FED+K  Y+LGKELGRGQFGVTYL
Sbjct  47   TP-EKPASQPPPWRMAAAAPGPSPKATKSNSILENAFEDVKLFYTLGKELGRGQFGVTYL  105

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            CTE ST + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  106  CTENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  157



>gb|AGG35967.1| calcium-dependent protein kinase 15, partial [Brassica napus]
Length=570

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 106/184 (58%), Gaps = 19/184 (10%)
 Frame = +3

Query  210  GCFS-KSKSRQGDVNGYRQGRGVATGYQPV-----TESHQKASSTHAQTY-----TQPER  356
            GCFS K +  Q DV      R + T            +H    +  +QT+     T+P+ 
Sbjct  2    GCFSSKHRRTQSDVVNGNVQRSIPTNQSQTHVPRDVTAHSSIPTNQSQTHVSRDATEPQI  61

Query  357  P-------YNPQPQSYA-PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGK  512
            P       +NPQ Q  + PV+ P +   V +P++P+   E   ILGKPFE IK  Y+LG 
Sbjct  62   PTTTQNHHHNPQEQQESKPVNQPIEEYQVFKPLKPIALLETETILGKPFEQIKRLYTLGH  121

Query  513  ELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLX  692
            ELGRGQFG+TY C E ST   YACKSILKRKL  K D++D+K+EIQIMQHLSGQ NIV  
Sbjct  122  ELGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQDRDDVKKEIQIMQHLSGQKNIVEI  181

Query  693  AGCF  704
             G +
Sbjct  182  RGAY  185


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G + +  ++GA+EDRQS+HLVMEL   GEL DRIIA
Sbjct  174  GQKNIVEIRGAYEDRQSIHLVMELCGGGELFDRIIA  209



>ref|XP_006452345.1| hypothetical protein CICLE_v10007978mg [Citrus clementina]
 ref|XP_006475077.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
 gb|ESR65585.1| hypothetical protein CICLE_v10007978mg [Citrus clementina]
 gb|KDO62704.1| hypothetical protein CISIN_1g009561mg [Citrus sinensis]
Length=532

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LGK ++D++ +Y+LGK+LGRGQFGVTYLCTE ST R +ACKSI KRKLV+KNDK+DIKR
Sbjct  54   VLGKAYDDVRLYYNLGKKLGRGQFGVTYLCTEKSTGRQFACKSIAKRKLVTKNDKDDIKR  113

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQIMQHLSGQP+IV   G +
Sbjct  114  EIQIMQHLSGQPSIVDFKGAY  134



>ref|XP_007146136.1| hypothetical protein PHAVU_006G015300g [Phaseolus vulgaris]
 gb|ESW18130.1| hypothetical protein PHAVU_006G015300g [Phaseolus vulgaris]
Length=544

 Score =   112 bits (279),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +L +P ED++A Y++GKELGRGQFGVT+LCT+ +T   +ACK+I KRKLVSK D ED++R
Sbjct  76   VLQRPMEDVRAAYTIGKELGRGQFGVTHLCTDKTTGEQFACKTIAKRKLVSKEDIEDVRR  135

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E++IM HLS QPNIV   G +
Sbjct  136  EVEIMLHLSQQPNIVELKGAY  156


 Score = 48.9 bits (115),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  679  TLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
             +  L+GA+ED+QSVHLVMEL + GEL DRIIA
Sbjct  148  NIVELKGAYEDKQSVHLVMELCAGGELFDRIIA  180



>gb|AGA83664.1| calcium-dependent protein kinase 1 [Dendrobium catenatum]
Length=534

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + IL KPF+D++ +Y+LGKELGRGQFGVTYLCTE ST  +YACKSI KRKLV KNDKED 
Sbjct  73   DTILDKPFDDVRRNYTLGKELGRGQFGVTYLCTENSTGHSYACKSISKRKLVHKNDKEDT  132

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQ NIV   G +
Sbjct  133  KREIQIMQHLSGQSNIVEFKGAY  155



>gb|KHN38392.1| Calcium-dependent protein kinase 17 [Glycine soja]
Length=511

 Score =   116 bits (290),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+  ED+K+ YS+GKELGRGQFGVT+LCT  ST + YACK+I KRKLV+K D ED+KR
Sbjct  60   VLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDIEDVKR  119

Query  642  EIQIMQHLSGQPNIV  686
            E+QIM HLSGQ NIV
Sbjct  120  EVQIMHHLSGQANIV  134


 Score = 44.7 bits (104),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  L   +ED+QSVHLVMEL + GEL DRIIA
Sbjct  129  GQANIVELVNVYEDKQSVHLVMELCAGGELFDRIIA  164



>gb|KJB68586.1| hypothetical protein B456_010G252400 [Gossypium raimondii]
Length=527

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + +LGKP EDI+ +Y+LG ELGRGQFGV YLCTE ST   YACKSILKRKL S  DKEDI
Sbjct  65   DTVLGKPLEDIRQYYTLGDELGRGQFGVIYLCTENSTGHTYACKSILKRKLTSLQDKEDI  124

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            K+E+QIMQHLSGQPNIV   G +
Sbjct  125  KKEVQIMQHLSGQPNIVEFKGAY  147



>ref|XP_006575622.1| PREDICTED: calcium-dependent protein kinase 34-like [Glycine 
max]
Length=527

 Score =   115 bits (289),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+  ED+K+ YS+GKELGRGQFGVT+LCT  ST + YACK+I KRKLV+K D ED+KR
Sbjct  60   VLGRAMEDVKSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDIEDVKR  119

Query  642  EIQIMQHLSGQPNIV  686
            E+QIM HLSGQ NIV
Sbjct  120  EVQIMHHLSGQANIV  134


 Score = 44.7 bits (104),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  L   +ED+QSVHLVMEL + GEL DRIIA
Sbjct  129  GQANIVELVNVYEDKQSVHLVMELCAGGELFDRIIA  164



>emb|CDX82886.1| BnaC01g13360D [Brassica napus]
Length=557

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 101/172 (59%), Gaps = 10/172 (6%)
 Frame = +3

Query  210  GCFS-KSKSRQGDVNGYRQGRGVATGYQPV-----TESHQKASSTHAQTYTQPERPYNPQ  371
            GCFS K +  Q DV      R + T            +H    +  +QT+      +NPQ
Sbjct  2    GCFSSKHRRTQSDVVNGNVQRSIPTNQSQTHVPRDVTAHSSIPTNQSQTHNHH---HNPQ  58

Query  372  PQSYA-PVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
             Q  + PV+ P +   V +P++P+   E   ILGKPFE IK  Y+LG ELGRGQFG+TY 
Sbjct  59   EQQESKPVNQPIEEYQVFKPLKPIALLETETILGKPFEQIKRLYTLGHELGRGQFGITYT  118

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            C E ST   YACKSILKRKL  K D++D+K+EIQIMQHLSGQ NIV   G +
Sbjct  119  CKENSTGNTYACKSILKRKLTRKQDRDDVKKEIQIMQHLSGQKNIVEIRGAY  170


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G + +  ++GA+EDRQS+HLVMEL   GEL DRIIA
Sbjct  159  GQKNIVEIRGAYEDRQSIHLVMELCGGGELFDRIIA  194



>ref|XP_002891589.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67848.1| calcium-dependent protein kinase 33 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            IL KP+ED+K  Y+L KELGRGQFGVTYLCTE STR+ +ACKSI K+KLV+K DKED++R
Sbjct  61   ILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTRKRFACKSISKKKLVTKADKEDMRR  120

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQIMQHLSGQPNIV   G +
Sbjct  121  EIQIMQHLSGQPNIVEFKGAY  141



>ref|XP_010533815.1| PREDICTED: calcium-dependent protein kinase 19 [Tarenaya hassleriana]
Length=548

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  ILGKP EDIK  ++ G+ELGRGQFG+TYLCTEIST R +ACKSILKRKL    D+E
Sbjct  81   QPEPILGKPLEDIKEKFTFGRELGRGQFGITYLCTEISTGRTFACKSILKRKLHRVQDRE  140

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++RE+QIMQ+LSGQPNIV   G +        V   C G  L
Sbjct  141  DVRREVQIMQYLSGQPNIVEFKGAYEDRQSVHLVMELCEGGEL  183



>ref|XP_009113383.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 
19 [Brassica rapa]
Length=543

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 74/103 (72%), Gaps = 4/103 (4%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            +P  I GKPFED+K  YSLG+ELGRG FG+TYLCTEIS+ + +ACKSILKRKL+   D+E
Sbjct  76   QPEPISGKPFEDVKETYSLGRELGRGXFGITYLCTEISSGKNFACKSILKRKLIRTQDRE  135

Query  630  DIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            D++REIQIMQ+LSGQPNIV   G +        V   C G  L
Sbjct  136  DVRREIQIMQYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  178



>ref|XP_010448965.1| PREDICTED: calcium-dependent protein kinase 15 [Camelina sativa]
Length=558

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            E   ILGKPFE I+ HY+LG ELGRGQFG+TY C EIST   YACKSILKRKL+ K D++
Sbjct  90   ETETILGKPFEGIRKHYTLGHELGRGQFGITYSCKEISTGNVYACKSILKRKLMRKQDRD  149

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQHLSGQ NIV   G +
Sbjct  150  DVKREIQIMQHLSGQENIVEIRGAY  174



>gb|AAC28510.1| Similar to gb|AF072908 calcium-dependent protein kinase from 
Nicotiana tabacum [Arabidopsis thaliana]
Length=553

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 96/175 (55%), Gaps = 15/175 (9%)
 Frame = +3

Query  240  GDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSYAPVHVPAKpssv  419
            G+ N   + R +    QP     Q A     Q   QP +   P PQ       P +   +
Sbjct  21   GEQNTEVKSREITPKEQP--RQRQPAPRAKFQIVVQPHKLPLPLPQ-------PQEKQKL  71

Query  420  pqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILK  599
                +     +P  ILG+PFEDIK  YSLG+ELGRGQFG+TY+CTEIS+ + +ACKSILK
Sbjct  72   INHQKQSTLQQPEPILGRPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILK  131

Query  600  RKLV--SKNDKEDIKREIQIMQHLSGQPNIVLXAGCFRG----*AVSAPCHGASL  746
            RKL+     D+ED++REIQIM +LSGQPNIV   G +        V   C G  L
Sbjct  132  RKLIRTKARDREDVRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGEL  186



>ref|XP_010439398.1| PREDICTED: calcium-dependent protein kinase 15-like [Camelina 
sativa]
Length=560

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 106/185 (57%), Gaps = 30/185 (16%)
 Frame = +3

Query  210  GCFS-KSKSRQGD-VNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERP-YNPQPQS  380
            GCFS K ++ + D +NG           Q    +HQ  SS  ++  ++P++P ++  P +
Sbjct  2    GCFSSKHRNTESDLING---------SVQSSITTHQSQSSV-SRNVSEPQKPPFHQIPTT  51

Query  381  YAPVH-----------------VPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLG  509
              P H                 V  +      P++P+   E   ILGKPFE+I+ HY+L 
Sbjct  52   TQPNHRNQQQKQQEEEAKPIVKVIEEKQVRTTPLKPIVFRETETILGKPFEEIRKHYTLD  111

Query  510  KELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVL  689
             ELGRGQFG+TY C EIST   YACKSILKRKL+ K D++D+KREIQIMQHLSGQ NIV 
Sbjct  112  HELGRGQFGITYSCKEISTGNVYACKSILKRKLMRKQDRDDVKREIQIMQHLSGQENIVE  171

Query  690  XAGCF  704
              G +
Sbjct  172  IRGAY  176



>gb|KFK35914.1| hypothetical protein AALP_AA4G052700 [Arabis alpina]
Length=512

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + IL KP+ED+K  Y+L KELGRGQFGVTYLCTEI+T + +ACKSI K+KLV+K+DKED+
Sbjct  50   STILEKPYEDVKQFYTLSKELGRGQFGVTYLCTEITTGKRFACKSISKKKLVTKSDKEDM  109

Query  636  KREIQIMQHLSGQPNIVLXAGCF  704
            KREIQIMQHLSGQ NIV   G +
Sbjct  110  KREIQIMQHLSGQANIVEFKGAY  132



>emb|CAD70165.1| calcium-dependent protein kinase [Landoltia punctata]
Length=548

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LGKPFED+KA Y++GK LGRGQFGVTYLCT  ST   YACKSI KRKLV++ND+ED+KR
Sbjct  89   VLGKPFEDVKAKYTIGKVLGRGQFGVTYLCTCNSTGAKYACKSISKRKLVNRNDREDVKR  148

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQIMQHLSGQ NIV   G +
Sbjct  149  EIQIMQHLSGQENIVEFKGAY  169



>ref|NP_175485.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
 sp|Q9C6P3.1|CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33 [Arabidopsis 
thaliana]
 gb|AAG51192.1|AC079279_13 calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAT06478.1| At1g50700 [Arabidopsis thaliana]
 dbj|BAD43386.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32581.1| calcium-dependent protein kinase 33 [Arabidopsis thaliana]
Length=521

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI K+KLV+K DKED++R
Sbjct  61   ILEKPYEDVKLFYTLSKELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKGDKEDMRR  120

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQIMQHLSGQPNIV   G +
Sbjct  121  EIQIMQHLSGQPNIVEFKGAY  141



>ref|XP_006828852.1| PREDICTED: calcium-dependent protein kinase isoform 2 isoform 
X2 [Amborella trichopoda]
 gb|ERM96268.1| hypothetical protein AMTR_s00001p00158780 [Amborella trichopoda]
Length=532

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 101/182 (55%), Gaps = 35/182 (19%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKAS--------STHAQTYTQPERP  359
            MG CFSK K  +   +  R+   V+ G  PV    +K          STH QT  +P  P
Sbjct  1    MGDCFSKPKFPE---SPPRRTLPVSNGSSPVPSLPKKEQPTRPANRPSTHQQT-RKPATP  56

Query  360  YNP----QP---QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKEL  518
             NP    QP    S    HV A+                N ILGKP  D+ + Y+L +EL
Sbjct  57   SNPSANRQPLPLTSALKSHVSAE----------------NTILGKPMVDVSSLYALDREL  100

Query  519  GRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAG  698
            GRGQFGVTYLCTE +T   YACKS+ KRKL+SK+D EDIKRE+ I+QHL+GQPNIV   G
Sbjct  101  GRGQFGVTYLCTERTTGLQYACKSVSKRKLMSKSDVEDIKREVLILQHLTGQPNIVEFKG  160

Query  699  CF  704
             +
Sbjct  161  AY  162



>gb|KDO62705.1| hypothetical protein CISIN_1g040917mg, partial [Citrus sinensis]
Length=494

 Score =   114 bits (285),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED++ HY++G+E+GRG+FG+TYLCTE ST   +ACKSI KRKLV   +K+D+
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSIPKRKLVKDVEKDDV  80

Query  636  KREIQIMQHLSGQPNIV  686
            +REI+IM+HLSGQPNIV
Sbjct  81   RREIEIMRHLSGQPNIV  97


 Score = 41.6 bits (96),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +   + A+ED Q VH+VMEL + GEL DRI+A
Sbjct  92   GQPNIVQFKAAYEDDQFVHIVMELCAGGELFDRIVA  127



>ref|XP_006452346.1| hypothetical protein CICLE_v10010522mg, partial [Citrus clementina]
 gb|ESR65586.1| hypothetical protein CICLE_v10010522mg, partial [Citrus clementina]
Length=456

 Score =   114 bits (285),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED++ HY++G+E+GRG+FG+TYLCTE ST   +ACKSI KRKLV   +K+D+
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSIPKRKLVKDVEKDDV  80

Query  636  KREIQIMQHLSGQPNIV  686
            +REI+IM+HLSGQPNIV
Sbjct  81   RREIEIMRHLSGQPNIV  97


 Score = 41.6 bits (96),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +   + A+ED Q VH+VMEL + GEL DRI+A
Sbjct  92   GQPNIVQFKAAYEDDQFVHIVMELCAGGELFDRIVA  127



>ref|XP_009135689.1| PREDICTED: calcium-dependent protein kinase 9 [Brassica rapa]
Length=542

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 103/172 (60%), Gaps = 21/172 (12%)
 Frame = +3

Query  204  MGGCFSKS----KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQ-PERPYNP  368
            MG CF+K+    K +Q   NG  Q R V      V ++HQ   S   Q  +Q PE+P + 
Sbjct  1    MGNCFAKNHGLMKPQQ---NG--QTRSV-----EVDQTHQDPPSYTPQPRSQTPEKPSSE  50

Query  369  QPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
              Q       P    + P P     +    +IL   +ED+K  Y+LGKELGRGQFGVTYL
Sbjct  51   TNQP------PPWRMAAPAPSPKAAKSSSTSILENAYEDVKLFYTLGKELGRGQFGVTYL  104

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            CTE ST + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  105  CTENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  156



>ref|XP_011628928.1| PREDICTED: calcium-dependent protein kinase 2 isoform X1 [Amborella 
trichopoda]
Length=563

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 101/182 (55%), Gaps = 35/182 (19%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKAS--------STHAQTYTQPERP  359
            MG CFSK K  +   +  R+   V+ G  PV    +K          STH QT  +P  P
Sbjct  1    MGDCFSKPKFPE---SPPRRTLPVSNGSSPVPSLPKKEQPTRPANRPSTHQQT-RKPATP  56

Query  360  YNP----QP---QSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKEL  518
             NP    QP    S    HV A+                N ILGKP  D+ + Y+L +EL
Sbjct  57   SNPSANRQPLPLTSALKSHVSAE----------------NTILGKPMVDVSSLYALDREL  100

Query  519  GRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAG  698
            GRGQFGVTYLCTE +T   YACKS+ KRKL+SK+D EDIKRE+ I+QHL+GQPNIV   G
Sbjct  101  GRGQFGVTYLCTERTTGLQYACKSVSKRKLMSKSDVEDIKREVLILQHLTGQPNIVEFKG  160

Query  699  CF  704
             +
Sbjct  161  AY  162



>ref|XP_006475078.1| PREDICTED: calcium-dependent protein kinase 33-like [Citrus sinensis]
Length=551

 Score =   114 bits (284),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED++ HY++G+E+GRG+FG+TYLCTE ST   +ACKSI KRKLV   +K+D+
Sbjct  21   DAILGKAYEDVQLHYTIGREVGRGEFGITYLCTENSTGLEFACKSIPKRKLVKDVEKDDV  80

Query  636  KREIQIMQHLSGQPNIV  686
            +REI+IM+HLSGQPNIV
Sbjct  81   RREIEIMRHLSGQPNIV  97


 Score = 41.6 bits (96),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +   + A+ED Q VH+VMEL + GEL DRI+A
Sbjct  92   GQPNIVQFKAAYEDDQFVHIVMELCAGGELFDRIVA  127



>ref|XP_009388872.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388873.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388874.1| PREDICTED: calcium-dependent protein kinase 2-like [Musa acuminata 
subsp. malaccensis]
Length=557

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            ILGKPFED+++ Y+ GKELGRGQFGVTYLCTE +T   YACKSI KRKL +K+D+EDIKR
Sbjct  97   ILGKPFEDVRSLYTFGKELGRGQFGVTYLCTENATGLRYACKSISKRKLSNKSDREDIKR  156

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQIMQHL+GQ NIV   G +
Sbjct  157  EIQIMQHLTGQANIVEFKGAY  177



>gb|KEH28424.1| calcium-dependent kinase [Medicago truncatula]
Length=396

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            + N I GK FED+K  Y+LGKELGRGQFGVTYLCTE ST   YACKSI KR LVS+ DKE
Sbjct  75   DTNTIPGKQFEDVKQIYTLGKELGRGQFGVTYLCTENSTGLKYACKSISKRNLVSEPDKE  134

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            +IKREIQIMQH+SGQPNIV   G +
Sbjct  135  EIKREIQIMQHMSGQPNIVEFKGAY  159



>ref|XP_010461925.1| PREDICTED: calcium-dependent protein kinase 33 [Camelina sativa]
Length=521

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
            +IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI K+KLV+K DKED++
Sbjct  60   SILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKADKEDMR  119

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  120  REIQIMQHLSGQPNIVEFKGAY  141



>ref|XP_010479536.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=521

 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
            +IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI K+KLV+K DKED++
Sbjct  60   SILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKADKEDMR  119

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  120  REIQIMQHLSGQPNIVEFKGAY  141



>gb|AGG35978.1| calcium-dependent protein kinase 9, partial [Brassica napus]
Length=539

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 99/172 (58%), Gaps = 23/172 (13%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQSY  383
            MG CF+K+                  G     ++ Q  S    QT+  P   Y PQP+S+
Sbjct  1    MGNCFAKNH-----------------GLMKPQQNGQTRSVEVDQTHQDPP-SYTPQPRSH  42

Query  384  APVHVPAKp-----ssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
             P    ++        +  P    +  + ++IL   +ED+K  Y+LGKELGRGQFGVTYL
Sbjct  43   TPEKRSSETNQPPPWRMAAPAPSPKAAKSSSILENAYEDVKLFYTLGKELGRGQFGVTYL  102

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            CTE ST + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  103  CTENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  154



>ref|XP_003610425.1| Calcium-dependent protein kinase [Medicago truncatula]
 gb|AES92622.1| calcium-dependent kinase [Medicago truncatula]
Length=543

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            IL KP+EDIK  Y+ GKEL RG+FG+TY CTE ST + YAC+SILKRKLVSK DKEDIKR
Sbjct  83   ILEKPYEDIKKLYTFGKELSRGKFGITYFCTENSTGQNYACRSILKRKLVSKADKEDIKR  142

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQI+QH SGQPNIV   G +
Sbjct  143  EIQILQHFSGQPNIVKFKGAY  163



>ref|XP_009135461.1| PREDICTED: calcium-dependent protein kinase 15 [Brassica rapa]
Length=573

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 106/185 (57%), Gaps = 20/185 (11%)
 Frame = +3

Query  210  GCFS-KSKSRQGDVNGYRQGRGVATGYQPV-----TESHQKASSTHAQTY-----TQPER  356
            GCFS K +  Q DV      R + T            +H    +  +QT+     T+P+ 
Sbjct  2    GCFSSKHRRTQSDVVNGNVHRSIPTNQSQTHVPRDVTAHSSIPTNQSQTHVSRDVTEPQI  61

Query  357  P-------YNPQPQSYA-PVHVPA-KpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLG  509
            P       +NPQ Q  + PV+    +   V +P++P+   E   ILGKPFE IK HY+LG
Sbjct  62   PTTTQNHHHNPQEQQESKPVNQQIIEEYQVFKPLKPIALLETETILGKPFEQIKRHYTLG  121

Query  510  KELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVL  689
             E+GRGQFG+TY C E ST   YACKSILKRKL  K D++D+K+EIQIMQHLSGQ NIV 
Sbjct  122  HEIGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQDRDDVKKEIQIMQHLSGQQNIVE  181

Query  690  XAGCF  704
              G +
Sbjct  182  IRGAY  186



>ref|XP_006287505.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
 gb|EOA20403.1| hypothetical protein CARUB_v10000714mg [Capsella rubella]
Length=524

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 80/125 (64%), Gaps = 2/125 (2%)
 Frame = +3

Query  330  AQTYTQPERPYNPQPQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLG  509
            AQT+   + P   +PQ+  P   P           P+     + ILGKPFEDI+  YSLG
Sbjct  25   AQTHVVNQVPEQSKPQT--PTRKPTNQQIPTPSANPISARGLDTILGKPFEDIRKVYSLG  82

Query  510  KELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVL  689
            KELG+G F  TY+CTEIST   YACKSILK  L+S+  +ED+KREIQIMQHLSGQPNIV 
Sbjct  83   KELGQGYFATTYMCTEISTGNTYACKSILKSNLISQIYEEDVKREIQIMQHLSGQPNIVE  142

Query  690  XAGCF  704
              G +
Sbjct  143  IKGAY  147



>emb|CDX82244.1| BnaA03g35770D [Brassica napus]
Length=534

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 100/171 (58%), Gaps = 27/171 (16%)
 Frame = +3

Query  204  MGGCFSKS----KSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQ  371
            MG CF+K+    K +Q   NG  Q R V      V ++HQ            P+ P  P 
Sbjct  1    MGNCFAKNHGLMKPQQ---NG--QTRSV-----EVDQTHQDP----------PQTPEKPS  40

Query  372  PQSYAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLC  551
             ++  P   P    + P P     +    +IL   +ED+K  Y+LGKELGRGQFGVTYLC
Sbjct  41   SETNQP---PPWRMAAPAPSPKAAKSSSTSILENAYEDVKLFYTLGKELGRGQFGVTYLC  97

Query  552  TEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            TE ST + YACKSI K+KLV+K DK+D++REIQIMQHLSGQPNIV   G +
Sbjct  98   TENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSGQPNIVEFKGAY  148



>ref|XP_002874812.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51071.1| calcium-dependent protein kinase 23 [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 70/101 (69%), Gaps = 16/101 (16%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKS-------------  590
            +P  ILGKP EDI+  YSLGKELGRGQFG+TY+C EI T   YACKS             
Sbjct  52   DPATILGKPLEDIRRFYSLGKELGRGQFGITYMCKEIGTGNNYACKSILKRTLISEREDV  111

Query  591  ---ILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
               ILKRKLV+K DKE++KREIQIMQHLSGQPNIV   G +
Sbjct  112  KTEILKRKLVNKYDKENLKREIQIMQHLSGQPNIVEIKGAY  152


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +  ++GA+EDRQSVHLVMEL + GEL DRIIA
Sbjct  141  GQPNIVEIKGAYEDRQSVHLVMELCAGGELFDRIIA  176



>ref|XP_010501945.1| PREDICTED: calcium-dependent protein kinase 33-like [Camelina 
sativa]
Length=582

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
            +IL KP+ED+K  Y+L KELGRGQFGVTYLCTE ST + +ACKSI K+KLV+K DKED++
Sbjct  60   SILEKPYEDVKLLYTLSKELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKADKEDMR  119

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  120  REIQIMQHLSGQPNIVEFKGAY  141



>ref|XP_006303970.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
 gb|EOA36868.1| hypothetical protein CARUB_v10008860mg [Capsella rubella]
Length=520

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  459  NILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIK  638
            +IL KP+ED+K  Y+L +ELGRGQFGVTYLCTE ST + +ACKSI K+KLV+K DKED++
Sbjct  59   SILEKPYEDVKLLYTLSRELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKADKEDMR  118

Query  639  REIQIMQHLSGQPNIVLXAGCF  704
            REIQIMQHLSGQPNIV   G +
Sbjct  119  REIQIMQHLSGQPNIVEFKGAY  140



>ref|XP_007141507.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
 gb|ESW13501.1| hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris]
Length=521

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LGKP ED+++ YS+GKELGRGQFGVT+LCT  ST + YACK+I KRKLV+K D ED+KR
Sbjct  54   VLGKPMEDVRSTYSMGKELGRGQFGVTHLCTHKSTGKQYACKTIAKRKLVNKEDIEDVKR  113

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HLSGQPNIV     F
Sbjct  114  EVQIMHHLSGQPNIVELVNVF  134



>ref|XP_006452355.1| hypothetical protein CICLE_v10010314mg, partial [Citrus clementina]
 gb|ESR65595.1| hypothetical protein CICLE_v10010314mg, partial [Citrus clementina]
Length=494

 Score =   112 bits (280),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + ILGK +ED+K  Y++GKELGRG+FG+TYLCTE ST   +ACKSI KRKLV+   K+D+
Sbjct  21   DAILGKAYEDVKLDYTIGKELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDV  80

Query  636  KREIQIMQHLSGQPNIV  686
            +REI++MQ+LSGQPNIV
Sbjct  81   RREIEVMQYLSGQPNIV  97


 Score = 41.2 bits (95),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +   + A+ED Q VH VMEL + GEL DRI+A
Sbjct  92   GQPNIVQFKAAYEDEQFVHTVMELCAGGELFDRIVA  127



>ref|XP_006283446.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
 gb|EOA16344.1| hypothetical protein CARUB_v10004493mg [Capsella rubella]
Length=559

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            E   ILGKPFE+I+  Y+LG ELGRGQFG+TY C EI+T   YACKSILKRKL  K D++
Sbjct  82   ETETILGKPFEEIRKLYTLGNELGRGQFGITYSCKEITTGNIYACKSILKRKLTRKQDRD  141

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQHLSGQ NIV   G +
Sbjct  142  DVKREIQIMQHLSGQQNIVEIRGAY  166



>ref|XP_001782248.1| predicted protein [Physcomitrella patens]
 gb|EDQ52920.1| predicted protein [Physcomitrella patens]
Length=476

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            ILGKP  DIK HY+LG+ELGRGQFGVTYLCT+  T  +YACK+I KRKL +K+D ED+KR
Sbjct  8    ILGKPLRDIKLHYTLGRELGRGQFGVTYLCTDKETGISYACKTIAKRKLTNKDDIEDVKR  67

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HLSG PNIV     F
Sbjct  68   EVQIMHHLSGTPNIVELKDVF  88



>emb|CDY36037.1| BnaC03g41610D [Brassica napus]
Length=531

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            IL   +ED+K  Y+LGKELGRGQFGVTYLCTE ST + YACKSI K+KLV+K DK+D++R
Sbjct  66   ILENAYEDVKLFYTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDMRR  125

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            EIQIMQHLSGQPNIV   G +
Sbjct  126  EIQIMQHLSGQPNIVEFKGAY  146



>ref|XP_002869856.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46115.1| calcium-dependent protein kinase 15 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  450  EPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKE  629
            E   ILGKPFE+I+  Y+LG ELGRGQFG+TY C E ST   YACKSILKRKL  K D++
Sbjct  82   ETETILGKPFEEIRKLYTLGNELGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQDRD  141

Query  630  DIKREIQIMQHLSGQPNIVLXAGCF  704
            D+KREIQIMQHLSGQ NIV   G +
Sbjct  142  DVKREIQIMQHLSGQENIVEIKGAY  166



>ref|XP_010519814.1| PREDICTED: calcium-dependent protein kinase 34 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 89/168 (53%), Gaps = 30/168 (18%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS-  380
            MG C S  +    D +    G G      P  E+    +S HA        P +P P + 
Sbjct  1    MGNCCSHGRESPEDTDEPTPGNGATAQSNPAAETSAAPASKHA--------PPSPPPATK  52

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
              P+                       +LG+P ED+KA YSLGKELGRGQFGVT+LCT  
Sbjct  53   QGPI---------------------GPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTHK  91

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            +T   +ACK+I KRKLV+K D ED++RE+QIM HL+GQPNIV   G +
Sbjct  92   ATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAY  139



>gb|AAL59948.1| putative calcium-dependent protein kinase [Arabidopsis thaliana]
Length=528

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+KA YSLGKELGRGQFGVT+LCT+ ST   +ACK+I KRKLV+K D ED++R
Sbjct  61   VLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKSTGHQFACKTIAKRKLVNKEDIEDVRR  120

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HL+GQPNIV   G +
Sbjct  121  EVQIMHHLTGQPNIVELKGAY  141



>ref|XP_006452347.1| hypothetical protein CICLE_v10008020mg [Citrus clementina]
 gb|ESR65587.1| hypothetical protein CICLE_v10008020mg [Citrus clementina]
 gb|KDO62706.1| hypothetical protein CISIN_1g010164mg [Citrus sinensis]
Length=516

 Score =   111 bits (278),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + IL K +ED+K HY+LG+ELGRG+FG+TYLCTE ST   +ACKSI KRKLV+   K+D+
Sbjct  36   DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDV  95

Query  636  KREIQIMQHLSGQPNIV  686
            +RE+++MQ+LSGQPNIV
Sbjct  96   RREVEVMQYLSGQPNIV  112


 Score = 40.4 bits (93),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +   + A+ED Q VH+VMEL   GEL DRI+A
Sbjct  107  GQPNIVQFKAAYEDDQFVHIVMELCVGGELFDRIVA  142



>ref|XP_006475143.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis]
Length=476

 Score =   111 bits (278),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  456  NNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDI  635
            + IL K +ED+K HY+LG+ELGRG+FG+TYLCTE ST   +ACKSI KRKLV+   K+D+
Sbjct  36   DAILCKAYEDVKLHYTLGRELGRGEFGITYLCTENSTGLEFACKSIPKRKLVNDYYKDDV  95

Query  636  KREIQIMQHLSGQPNIV  686
            +RE+++MQ+LSGQPNIV
Sbjct  96   RREVEVMQYLSGQPNIV  112


 Score = 40.0 bits (92),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +1

Query  670  GSRTLCXLQGAFEDRQSVHLVMELRSDGELLDRIIA  777
            G   +   + A+ED Q VH+VMEL   GEL DRI+A
Sbjct  107  GQPNIVQFKAAYEDDQFVHIVMELCVGGELFDRIVA  142



>ref|XP_003617233.1| Calcium dependent protein kinase [Medicago truncatula]
 gb|AET00192.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=523

 Score =   120 bits (302),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+KA YS+GKELGRGQFGVT+LCT  +T + YACK+I KRKL +K D ED++R
Sbjct  56   VLGRPMEDVKATYSMGKELGRGQFGVTHLCTHKTTGKQYACKTIAKRKLANKEDIEDVRR  115

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HL+GQPNIV   G F
Sbjct  116  EVQIMHHLTGQPNIVELIGAF  136



>ref|XP_001767768.1| cpk1 calcium-dependent protein kinase [Physcomitrella patens]
 gb|ABV22549.1| calcium-dependent protein kinase [Physcomitrella patens]
 gb|EDQ67519.1| cpk1 calcium-dependent protein kinase [Physcomitrella patens]
Length=549

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LGKP  DI+  Y LG+ELGRGQFGVTYLCT+  T  AYACKSI KRKL SK D ED+KR
Sbjct  81   VLGKPLSDIRQSYILGRELGRGQFGVTYLCTDKMTNEAYACKSIAKRKLTSKEDIEDVKR  140

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HLSG PNIV+    F
Sbjct  141  EVQIMHHLSGTPNIVVLKDVF  161



>ref|XP_011034967.1| PREDICTED: calcium-dependent protein kinase 29 [Populus euphratica]
Length=539

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 92/172 (53%), Gaps = 19/172 (11%)
 Frame = +3

Query  204  MGGCFSK---SKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQP  374
            MG CFS+   SK R  D+  +        GYQP      K     AQ +      YNP P
Sbjct  1    MGICFSRLGFSKFRSHDI--HISSTSEEDGYQP------KPPKRRAQEH------YNPPP  46

Query  375  QSYAPVHVPAKpssvpqpvrpvqrpEPNN--ILGKPFEDIKAHYSLGKELGRGQFGVTYL  548
               A    P   +              N   ILGKPF DI   Y L +ELGRGQFG+TYL
Sbjct  47   SQAATKPAPPSETFGKSQTALTPSSTSNIGPILGKPFVDITKIYDLHRELGRGQFGITYL  106

Query  549  CTEISTRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            CTE +T+R YACKSI + KLV+K D ED+K+EI IMQHLSGQPNIV   G +
Sbjct  107  CTEKATQRKYACKSISRGKLVTKKDIEDVKKEILIMQHLSGQPNIVEFRGAY  158



>ref|XP_010519813.1| PREDICTED: calcium-dependent protein kinase 34 isoform X1 [Tarenaya 
hassleriana]
Length=562

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 89/168 (53%), Gaps = 30/168 (18%)
 Frame = +3

Query  204  MGGCFSKSKSRQGDVNGYRQGRGVATGYQPVTESHQKASSTHAQTYTQPERPYNPQPQS-  380
            MG C S  +    D +    G G      P  E+    +S HA        P +P P + 
Sbjct  1    MGNCCSHGRESPEDTDEPTPGNGATAQSNPAAETSAAPASKHA--------PPSPPPATK  52

Query  381  YAPVHVPAKpssvpqpvrpvqrpEPNNILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEI  560
              P+                       +LG+P ED+KA YSLGKELGRGQFGVT+LCT  
Sbjct  53   QGPI---------------------GPVLGRPMEDVKASYSLGKELGRGQFGVTHLCTHK  91

Query  561  STRRAYACKSILKRKLVSKNDKEDIKREIQIMQHLSGQPNIVLXAGCF  704
            +T   +ACK+I KRKLV+K D ED++RE+QIM HL+GQPNIV   G +
Sbjct  92   ATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAY  139



>emb|CDY13993.1| BnaC09g38330D [Brassica napus]
Length=517

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+K+ YSLGKELGRGQFGVTYLCT+ +T   +ACK+I KRKLV+K D ED++R
Sbjct  48   VLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIEDVRR  107

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HL+GQPNIV   G +
Sbjct  108  EVQIMHHLTGQPNIVELKGAY  128



>ref|XP_009120894.1| PREDICTED: calcium-dependent protein kinase 34 [Brassica rapa]
 emb|CDX92536.1| BnaA10g15750D [Brassica napus]
Length=517

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+K+ YSLGKELGRGQFGVTYLCT+ +T   +ACK+I KRKLV+K D ED++R
Sbjct  48   VLGRPMEDVKSSYSLGKELGRGQFGVTYLCTQKATGLQFACKTIAKRKLVNKEDIEDVRR  107

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HL+GQPNIV   G +
Sbjct  108  EVQIMHHLTGQPNIVELKGAY  128



>ref|XP_006399734.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
 gb|ESQ41187.1| hypothetical protein EUTSA_v10013236mg [Eutrema salsugineum]
Length=528

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+KA YSLGKELGRGQFGVT+LCT+ +T + +ACK+I KRKLV+K D ED++R
Sbjct  61   VLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIEDVRR  120

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HL+GQPNIV   G +
Sbjct  121  EVQIMHHLTGQPNIVELKGAY  141



>ref|NP_196779.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
 sp|Q9FMP5.1|CDPKH_ARATH RecName: Full=Calcium-dependent protein kinase 17 [Arabidopsis 
thaliana]
 dbj|BAB10036.1| calcium-dependent protein kinase [Arabidopsis thaliana]
 gb|AAU95457.1| At5g12180 [Arabidopsis thaliana]
 gb|AED91771.1| calcium-dependent protein kinase 17 [Arabidopsis thaliana]
Length=528

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+KA YSLGKELGRGQFGVT+LCT+ +T   +ACK+I KRKLV+K D ED++R
Sbjct  61   VLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIEDVRR  120

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM HL+GQPNIV   G +
Sbjct  121  EVQIMHHLTGQPNIVELKGAY  141



>ref|XP_009131258.1| PREDICTED: calcium-dependent protein kinase 17-like [Brassica 
rapa]
Length=523

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+KA YSLGKELGRGQFGVT+LCT+ +T + +ACK+I KRKLV+K D ED++R
Sbjct  56   VLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIEDVRR  115

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM H++GQPNIV   G +
Sbjct  116  EVQIMHHMTGQPNIVELKGAY  136



>emb|CDX78468.1| BnaA03g03800D [Brassica napus]
Length=523

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  462  ILGKPFEDIKAHYSLGKELGRGQFGVTYLCTEISTRRAYACKSILKRKLVSKNDKEDIKR  641
            +LG+P ED+KA YSLGKELGRGQFGVT+LCT+ +T + +ACK+I KRKLV+K D ED++R
Sbjct  56   VLGRPMEDVKASYSLGKELGRGQFGVTHLCTQKATGQQFACKTIAKRKLVNKEDIEDVRR  115

Query  642  EIQIMQHLSGQPNIVLXAGCF  704
            E+QIM H++GQPNIV   G +
Sbjct  116  EVQIMHHMTGQPNIVELKGAY  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566421839775