BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12168

Length=706
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623304.1|  PREDICTED: probable LRR receptor-like serine...  66.6    3e-09   Nicotiana tomentosiformis
ref|XP_009763329.1|  PREDICTED: probable LRR receptor-like serine...  64.3    1e-08   Nicotiana sylvestris
ref|XP_004242588.1|  PREDICTED: probable LRR receptor-like serine...  61.6    1e-07   Solanum lycopersicum
ref|XP_006343656.1|  PREDICTED: probable LRR receptor-like serine...  61.6    1e-07   Solanum tuberosum [potatoes]
ref|XP_006473994.1|  PREDICTED: probable LRR receptor-like serine...  52.4    1e-04   Citrus sinensis [apfelsine]
ref|XP_006453627.1|  hypothetical protein CICLE_v10007429mg           51.6    3e-04   Citrus clementina [clementine]
ref|XP_010047112.1|  PREDICTED: probable LRR receptor-like serine...  51.6    3e-04   Eucalyptus grandis [rose gum]
ref|XP_002271577.1|  PREDICTED: probable LRR receptor-like serine...  51.2    4e-04   Vitis vinifera



>ref|XP_009623304.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230 [Nicotiana tomentosiformis]
Length=851

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFVS  705
            MG+GILGFFLV++V FRPL+CQQPNTDGFFVS
Sbjct  1    MGIGILGFFLVLTVLFRPLLCQQPNTDGFFVS  32



>ref|XP_009763329.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230 [Nicotiana sylvestris]
Length=852

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFVS  705
            MG+GIL FFLV++V FRPLVCQQPNTDGFFVS
Sbjct  1    MGIGILVFFLVLTVLFRPLVCQQPNTDGFFVS  32



>ref|XP_004242588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230 [Solanum lycopersicum]
Length=855

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFVS  705
            MG+GILG FL+++V FRPL+CQQPNTDGFFVS
Sbjct  1    MGIGILGSFLLLTVFFRPLLCQQPNTDGFFVS  32



>ref|XP_006343656.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230-like [Solanum tuberosum]
Length=855

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFVS  705
            MG+GILG FL+++V FRPL+CQQPNTDGFFVS
Sbjct  1    MGIGILGSFLLLTVFFRPLLCQQPNTDGFFVS  32



>ref|XP_006473994.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230-like [Citrus sinensis]
Length=852

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFVS  705
            MG G  G  L++S+ F+PL+CQQPNTDGFFV+
Sbjct  1    MGFGFFGSILILSLFFKPLICQQPNTDGFFVA  32



>ref|XP_006453627.1| hypothetical protein CICLE_v10007429mg [Citrus clementina]
 gb|ESR66867.1| hypothetical protein CICLE_v10007429mg [Citrus clementina]
Length=853

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFVS  705
            MG G  G  L++++ F+PL+CQQPNTDGFFV+
Sbjct  6    MGFGFFGSILILALFFKPLICQQPNTDGFFVA  37



>ref|XP_010047112.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230 [Eucalyptus grandis]
 gb|KCW78910.1| hypothetical protein EUGRSUZ_C00351 [Eucalyptus grandis]
Length=849

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFVS  705
            MG+G+ G+ LV+++C RPL  QQPNTDG FVS
Sbjct  1    MGLGLFGYVLVLAICTRPLASQQPNTDGSFVS  32



>ref|XP_002271577.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g24230 [Vitis vinifera]
Length=853

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  610  MGVGILGFFLVVSVCFRPLVCQQPNTDGFFV  702
            MG G LGF LV+++ FRPL CQQPNTDG FV
Sbjct  1    MGFGSLGFLLVLTLFFRPLPCQQPNTDGSFV  31



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1253469667140