BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12146

Length=802
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57290.1|  homogentisate 1,2-dioxygenase                          431   1e-146   Ipomoea nil [qian niu]
ref|XP_011082728.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    379   1e-127   
ref|XP_011082727.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    379   4e-127   
ref|XP_011082726.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    379   3e-126   Sesamum indicum [beniseed]
ref|XP_009597213.1|  PREDICTED: homogentisate 1,2-dioxygenase           378   7e-126   
ref|XP_006358956.1|  PREDICTED: LOW QUALITY PROTEIN: homogentisat...    375   2e-124   Solanum tuberosum [potatoes]
ref|XP_004251883.2|  PREDICTED: homogentisate 1,2-dioxygenase           374   3e-124   
gb|AAF73132.1|AF149017_1  homogentisate 1,2-dioxygenase                 374   3e-124   Solanum lycopersicum
gb|KJB13251.1|  hypothetical protein B456_002G065000                    364   3e-122   Gossypium raimondii
gb|KJB13255.1|  hypothetical protein B456_002G065000                    362   3e-121   Gossypium raimondii
gb|KJB13252.1|  hypothetical protein B456_002G065000                    363   6e-121   Gossypium raimondii
gb|KHG11706.1|  Homogentisate 1,2-dioxygenase -like protein             365   1e-120   Gossypium arboreum [tree cotton]
gb|KJB13249.1|  hypothetical protein B456_002G065000                    363   2e-120   Gossypium raimondii
gb|KJB13254.1|  hypothetical protein B456_002G065000                    363   6e-120   Gossypium raimondii
gb|KJB13248.1|  hypothetical protein B456_002G065000                    362   1e-119   Gossypium raimondii
ref|XP_010279197.1|  PREDICTED: homogentisate 1,2-dioxygenase           361   3e-119   Nelumbo nucifera [Indian lotus]
ref|XP_007021635.1|  Homogentisate 1,2-dioxygenase isoform 1            360   3e-119   
gb|EYU44990.1|  hypothetical protein MIMGU_mgv1a006018mg                360   1e-118   Erythranthe guttata [common monkey flower]
emb|CDP05973.1|  unnamed protein product                                360   1e-118   Coffea canephora [robusta coffee]
ref|XP_007021636.1|  Homogentisate 1,2-dioxygenase isoform 2            356   6e-118   
ref|XP_010675439.1|  PREDICTED: homogentisate 1,2-dioxygenase           357   9e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006451751.1|  hypothetical protein CICLE_v10008509mg             354   3e-117   Citrus clementina [clementine]
ref|XP_002285298.1|  PREDICTED: homogentisate 1,2-dioxygenase           355   5e-117   
ref|XP_012074208.1|  PREDICTED: homogentisate 1,2-dioxygenase           355   1e-116   Jatropha curcas
ref|XP_010108339.1|  Homogentisate 1,2-dioxygenase                      350   2e-116   
ref|XP_006494848.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      353   4e-116   Citrus sinensis [apfelsine]
ref|XP_006858313.1|  PREDICTED: homogentisate 1,2-dioxygenase           352   1e-115   Amborella trichopoda
ref|XP_010098423.1|  Homogentisate 1,2-dioxygenase                      350   4e-115   Morus notabilis
ref|XP_006401631.1|  hypothetical protein EUTSA_v100136910mg            340   3e-114   
ref|XP_010060644.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      348   4e-114   Eucalyptus grandis [rose gum]
ref|XP_009336163.1|  PREDICTED: homogentisate 1,2-dioxygenase           347   9e-114   Pyrus x bretschneideri [bai li]
ref|XP_008226447.1|  PREDICTED: homogentisate 1,2-dioxygenase           347   2e-113   Prunus mume [ume]
ref|XP_010916053.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    343   3e-113   Elaeis guineensis
ref|XP_010537038.1|  PREDICTED: homogentisate 1,2-dioxygenase           345   5e-113   Tarenaya hassleriana [spider flower]
ref|XP_007213873.1|  hypothetical protein PRUPE_ppa005219mg             345   9e-113   Prunus persica
emb|CDY41772.1|  BnaC02g13840D                                          344   1e-112   Brassica napus [oilseed rape]
ref|XP_010060646.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      344   2e-112   Eucalyptus grandis [rose gum]
ref|XP_009127119.1|  PREDICTED: homogentisate 1,2-dioxygenase           342   4e-112   Brassica rapa
ref|XP_010916052.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    343   6e-112   Elaeis guineensis
ref|XP_009419658.1|  PREDICTED: homogentisate 1,2-dioxygenase           341   2e-111   
gb|KDO58497.1|  hypothetical protein CISIN_1g011768mg                   340   1e-110   Citrus sinensis [apfelsine]
ref|XP_008784438.1|  PREDICTED: homogentisate 1,2-dioxygenase           338   2e-110   Phoenix dactylifera
ref|XP_002518387.1|  homogentisate 1,2-dioxygenase, putative            338   4e-110   Ricinus communis
ref|XP_011460752.1|  PREDICTED: homogentisate 1,2-dioxygenase           338   4e-110   Fragaria vesca subsp. vesca
gb|KFK27018.1|  hypothetical protein AALP_AA8G323800                    337   5e-110   Arabis alpina [alpine rockcress]
gb|EPS72524.1|  hypothetical protein M569_02231                         337   6e-110   Genlisea aurea
ref|XP_004137214.1|  PREDICTED: homogentisate 1,2-dioxygenase           337   8e-110   Cucumis sativus [cucumbers]
ref|XP_008451701.1|  PREDICTED: homogentisate 1,2-dioxygenase           337   2e-109   Cucumis melo [Oriental melon]
ref|XP_002864301.1|  homogentisate 1,2-dioxygenase                      335   4e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_011010298.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      335   6e-109   Populus euphratica
gb|KEH19531.1|  homogentisate 1,2-dioxygenase                           334   7e-109   Medicago truncatula
ref|XP_004510037.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      334   9e-109   Cicer arietinum [garbanzo]
ref|XP_011016626.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      334   1e-108   Populus euphratica
ref|XP_006280403.1|  hypothetical protein CARUB_v10026329mg             334   1e-108   Capsella rubella
ref|XP_003540068.1|  PREDICTED: homogentisate 1,2-dioxygenase-lik...    331   2e-107   
gb|AAM65958.1|  homogentisate 1,2-dioxygenase                           330   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482815.1|  PREDICTED: homogentisate 1,2-dioxygenase           328   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010446433.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      328   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010442982.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      328   2e-106   Camelina sativa [gold-of-pleasure]
gb|AAD00360.1|  homogentisate 1,2-dioxygenase                           327   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200219.1|  homogentisate 1,2-dioxygenase                         327   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298900.1|  hypothetical protein POPTR_0001s38310g             325   5e-105   Populus trichocarpa [western balsam poplar]
ref|XP_003527216.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      323   1e-104   Glycine max [soybeans]
gb|ABR16047.1|  unknown                                                 322   4e-104   Picea sitchensis
ref|XP_007133067.1|  hypothetical protein PHAVU_011G148800g             312   3e-100   Phaseolus vulgaris [French bean]
gb|AFW86248.2|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    305   8e-100   
ref|XP_002437662.1|  hypothetical protein SORBIDRAFT_10g000360          310   2e-99    Sorghum bicolor [broomcorn]
ref|XP_006656539.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      306   8e-98    Oryza brachyantha
gb|AFW86250.1|  homogentisate 1,2-dioxygenase                           305   2e-97    
ref|NP_001131427.2|  uncharacterized protein LOC100192757               305   2e-97    
gb|ACG28505.1|  homogentisate 1,2-dioxygenase                           305   2e-97    Zea mays [maize]
ref|XP_008658059.1|  PREDICTED: uncharacterized protein LOC100192...    305   3e-97    Zea mays [maize]
ref|XP_008658060.1|  PREDICTED: uncharacterized protein LOC100192...    305   4e-97    Zea mays [maize]
ref|XP_004964265.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      303   9e-97    
ref|NP_001056540.1|  Os06g0103300                                       291   5e-92    
gb|EEC79822.1|  hypothetical protein OsI_21275                          291   6e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_001771978.1|  predicted protein                                  290   9e-92    
ref|XP_003557280.1|  PREDICTED: homogentisate 1,2-dioxygenase           290   2e-91    Brachypodium distachyon [annual false brome]
gb|KHN36399.1|  Homogentisate 1,2-dioxygenase                           285   4e-89    Glycine soja [wild soybean]
ref|XP_009767671.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    271   8e-85    Nicotiana sylvestris
ref|XP_002976165.1|  hypothetical protein SELMODRAFT_151052             268   4e-83    
ref|XP_002968212.1|  hypothetical protein SELMODRAFT_267178             266   1e-82    Selaginella moellendorffii
gb|ACL52727.1|  unknown                                                 243   9e-74    Zea mays [maize]
gb|KFH72353.1|  homogentisate 1,2-dioxygenase                           237   3e-71    Mortierella verticillata NRRL 6337
ref|XP_005850038.1|  hypothetical protein CHLNCDRAFT_142029             235   4e-70    Chlorella variabilis
gb|EMS52126.1|  Homogentisate 1,2-dioxygenase                           233   5e-70    Triticum urartu
ref|XP_002112959.1|  hypothetical protein TRIADDRAFT_56615              223   8e-66    Trichoplax adhaerens
emb|CEG67707.1|  Putative Homogentisate 1,2-dioxygenase                 221   6e-65    Rhizopus microsporus
emb|CEI91034.1|  Putative Homogentisate 1,2-dioxygenase                 220   8e-65    Rhizopus microsporus
emb|CEI96397.1|  Putative Homogentisate 1,2-dioxygenase                 220   8e-65    Rhizopus microsporus
ref|WP_027485279.1|  homogentisate 1,2-dioxygenase                      219   1e-64    Rhodanobacter sp. OR87
ref|WP_015446760.1|  homogentisate 1,2-dioxygenase                      219   2e-64    Rhodanobacter denitrificans
ref|WP_007512560.1|  homogentisate 1,2-dioxygenase                      219   2e-64    Rhodanobacter denitrificans
ref|WP_011351095.1|  homogentisate 1,2-dioxygenase                      219   2e-64    Burkholderia lata
ref|WP_034194472.1|  homogentisate 1,2-dioxygenase                      219   4e-64    Burkholderia
ref|XP_002946381.1|  hypothetical protein VOLCADRAFT_102970             225   6e-64    Volvox carteri f. nagariensis
gb|EPB86322.1|  homogentisate 1,2-dioxygenase                           218   6e-64    Mucor circinelloides f. circinelloides 1006PhL
ref|WP_006484957.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        218   6e-64    Burkholderia cepacia complex
ref|WP_006494039.1|  homogentisate 1,2-dioxygenase                      218   7e-64    Burkholderia cenocepacia
ref|WP_036055529.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        218   7e-64    Burkholderia gladioli
ref|WP_006496705.1|  homogentisate 1,2-dioxygenase                      218   7e-64    Burkholderia cenocepacia
gb|KGY59076.1|  homogentisate 1,2-dioxygenase                           218   7e-64    
ref|WP_011544695.1|  homogentisate 1,2-dioxygenase                      218   7e-64    Burkholderia cenocepacia
ref|WP_027807440.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        218   7e-64    Burkholderia cepacia complex
ref|WP_013691209.1|  homogentisate 1,2-dioxygenase                      218   9e-64    Burkholderia gladioli
ref|WP_011883439.1|  homogentisate 1,2-dioxygenase                      218   1e-63    Burkholderia vietnamiensis
ref|WP_025097774.1|  homogentisate 1,2-dioxygenase                      218   1e-63    Burkholderia sp. A1
ref|WP_036034387.1|  homogentisate 1,2-dioxygenase                      217   1e-63    Burkholderia gladioli
ref|WP_039361235.1|  homogentisate 1,2-dioxygenase                      217   1e-63    Burkholderia
ref|WP_020423661.1|  homogentisate 1,2-dioxygenase                      217   1e-63    Cupriavidus
ref|WP_034206535.1|  homogentisate 1,2-dioxygenase                      217   2e-63    Burkholderia cepacia complex
ref|WP_043189391.1|  homogentisate 1,2-dioxygenase                      216   2e-63    Burkholderia cepacia
ref|XP_001701781.1|  predicted protein                                  216   3e-63    Chlamydomonas reinhardtii
ref|WP_017919300.1|  homogentisate 1,2-dioxygenase                      216   3e-63    Burkholderia gladioli
ref|WP_006476781.1|  homogentisate 1,2-dioxygenase                      216   3e-63    Burkholderia
ref|WP_027491633.1|  homogentisate 1,2-dioxygenase                      216   3e-63    Rhodanobacter sp. OR444
ref|WP_027783661.1|  homogentisate 1,2-dioxygenase                      216   5e-63    Burkholderia cepacia
ref|WP_014897945.1|  homogentisate 1,2-dioxygenase                      215   6e-63    Burkholderia cepacia
ref|WP_012363191.1|  homogentisate 1,2-dioxygenase                      215   6e-63    Burkholderia ambifaria
ref|WP_014722517.1|  homogentisate 1,2-dioxygenase                      215   6e-63    Burkholderia sp. KJ006
ref|WP_027489973.1|  homogentisate 1,2-dioxygenase                      215   7e-63    Rhodanobacter sp. OR92
ref|WP_027788251.1|  homogentisate 1,2-dioxygenase                      215   7e-63    Burkholderia cepacia
ref|WP_039323316.1|  homogentisate 1,2-dioxygenase                      215   8e-63    Burkholderia sp. A9
ref|WP_021157150.1|  Homogentisate 1,2-dioxygenase                      215   8e-63    Burkholderia cepacia complex
ref|WP_031399556.1|  homogentisate 1,2-dioxygenase                      215   9e-63    Burkholderia paludis
ref|WP_034197444.1|  homogentisate 1,2-dioxygenase                      214   1e-62    Burkholderia sp. MSh2
dbj|GAN08115.1|  homogentisate 1,2-dioxygenase HgmA                     214   1e-62    Mucor ambiguus
ref|WP_034187225.1|  homogentisate 1,2-dioxygenase                      214   1e-62    Burkholderia cenocepacia
ref|WP_044844108.1|  homogentisate 1,2-dioxygenase                      214   2e-62    Burkholderia
ref|WP_006406383.1|  homogentisate 1,2-dioxygenase                      214   2e-62    Burkholderia multivorans
ref|WP_007808218.1|  homogentisate 1,2-dioxygenase                      214   2e-62    Rhodanobacter spathiphylli
ref|WP_034182841.1|  homogentisate 1,2-dioxygenase                      214   2e-62    Burkholderia pyrrocinia
ref|WP_012327989.1|  homogentisate 1,2-dioxygenase                      214   2e-62    Burkholderia cenocepacia
ref|WP_036234404.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        214   2e-62    Methylibium
ref|WP_011656087.1|  homogentisate 1,2-dioxygenase                      214   3e-62    Burkholderia ambifaria
ref|WP_006752389.1|  homogentisate 1,2-dioxygenase                      214   3e-62    Burkholderia ambifaria
ref|XP_004354863.1|  homogentisate 1,2-dioxygenase                      214   3e-62    Cavenderia fasciculata
ref|XP_001023386.1|  homogentisate 1,2-dioxygenase family protein       214   3e-62    Tetrahymena thermophila SB210
gb|EPZ36041.1|  RmlC-like jelly roll fold domain-containing protein     213   4e-62    Rozella allomycis CSF55
dbj|BAI76313.1|  homogentisate 1,2-dioxygenase                          213   4e-62    Azospirillum sp. B510
gb|EXX70685.1|  hypothetical protein RirG_085220                        210   4e-62    Rhizophagus irregularis DAOM 197198w
ref|WP_006760631.1|  homogentisate 1,2-dioxygenase                      213   5e-62    Burkholderia ambifaria
ref|WP_041929920.1|  homogentisate 1,2-dioxygenase                      213   6e-62    
emb|CEP10327.1|  hypothetical protein                                   213   6e-62    Parasitella parasitica
gb|ABM93838.1|  homogentisate 1,2-dioxygenase                           213   6e-62    Methylibium petroleiphilum PM1
ref|WP_012214028.1|  homogentisate 1,2-dioxygenase                      213   6e-62    Burkholderia multivorans
ref|WP_029907288.1|  homogentisate 1,2-dioxygenase                      212   8e-62    Caulobacter sp. UNC358MFTsu5.1
ref|WP_006765055.1|  homogentisate 1,2-dioxygenase                      213   8e-62    Burkholderia
ref|WP_011486915.1|  homogentisate 1,2-dioxygenase                      213   8e-62    Paraburkholderia xenovorans
ref|XP_009824626.1|  homogentisate 1,2-dioxygenase                      213   8e-62    Aphanomyces astaci
ref|WP_006401545.1|  homogentisate 1,2-dioxygenase                      212   1e-61    Burkholderia
gb|AIO75777.1|  homogentisate 1,2-dioxygenase                           212   1e-61    Burkholderia multivorans
ref|WP_043275019.1|  homogentisate 1,2-dioxygenase                      212   1e-61    
ref|XP_638887.1|  homogentisate 1,2-dioxygenase                         212   1e-61    Dictyostelium discoideum AX4
ref|XP_001842047.1|  homogentisate 1,2-dioxygenase                      212   1e-61    Culex quinquefasciatus
ref|WP_010106006.1|  homogentisate 1,2-dioxygenase                      212   1e-61    
ref|WP_038737323.1|  homogentisate 1,2-dioxygenase                      212   1e-61    
gb|AAG17115.1|AF189237_1  homogentisate 1,2-dioxygenase                 211   1e-61    Dictyostelium discoideum
ref|WP_007179102.1|  homogentisate 1,2-dioxygenase                      212   1e-61    Burkholderia sp. Ch1-1
ref|WP_040143510.1|  homogentisate 1,2-dioxygenase                      212   1e-61    Burkholderia cenocepacia
ref|WP_006411569.1|  homogentisate 1,2-dioxygenase                      212   2e-61    Burkholderia multivorans
ref|WP_038738448.1|  homogentisate 1,2-dioxygenase                      212   2e-61    
ref|WP_042446435.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
ref|WP_004194851.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        211   2e-61    Burkholderia pseudomallei
ref|WP_004186050.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        212   2e-61    pseudomallei group
ref|WP_038780753.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
ref|WP_004550058.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        211   2e-61    
ref|WP_038767753.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
ref|WP_038792042.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
ref|WP_038772262.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
gb|EQA88204.1|  homogentisate 1,2-dioxygenase                           211   2e-61    Burkholderia pseudomallei MSHR338
ref|WP_045719850.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
ref|WP_045605144.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
gb|EEH29768.1|  homogentisate 1,2-dioxygenase                           211   2e-61    Burkholderia pseudomallei Pakistan 9
ref|WP_004552674.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
ref|WP_038794775.1|  homogentisate 1,2-dioxygenase                      211   2e-61    
dbj|GAN45692.1|  homogentisate 1,2-dioxygenase                          211   2e-61    
gb|KGV70630.1|  homogentisate 1,2-dioxygenase                           211   2e-61    Burkholderia pseudomallei MSHR4375
ref|WP_038728323.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        211   2e-61    
ref|WP_045737505.1|  homogentisate 1,2-dioxygenase                      211   2e-61    Xanthomonas sp. MUS 060
ref|WP_038753466.1|  homogentisate 1,2-dioxygenase                      211   3e-61    
ref|WP_043311744.1|  homogentisate 1,2-dioxygenase                      211   3e-61    
ref|WP_009974038.1|  homogentisate 1,2-dioxygenase                      211   3e-61    
ref|WP_015601085.1|  homogentisate 1,2-dioxygenase                      211   4e-61    
ref|WP_038759067.1|  homogentisate 1,2-dioxygenase                      210   5e-61    
gb|EIP88354.1|  homogentisate 1,2-dioxygenase                           211   5e-61    Burkholderia thailandensis MSMB43
ref|WP_010091511.1|  homogentisate 1,2-dioxygenase                      210   5e-61    Burkholderia ubonensis
ref|WP_007663799.1|  homogentisate 1,2-dioxygenase                      210   5e-61    Caulobacter sp. AP07
gb|ESA12272.1|  hypothetical protein GLOINDRAFT_65414                   211   5e-61    
ref|WP_028226625.1|  homogentisate 1,2-dioxygenase                      210   5e-61    Paraburkholderia ferrariae
ref|WP_009889415.1|  homogentisate 1,2-dioxygenase                      210   6e-61    
sp|Q2SYQ6.1|HGD_BURTA  RecName: Full=Homogentisate 1,2-dioxygenas...    210   6e-61    Burkholderia thailandensis E264
ref|NP_001271223.1|  homogentisate 1,2-dioxygenase                      210   6e-61    Xenopus tropicalis [western clawed frog]
ref|WP_038789456.1|  homogentisate 1,2-dioxygenase                      210   8e-61    
ref|XP_011193887.1|  PREDICTED: homogentisate 1,2-dioxygenase           209   8e-61    
ref|XP_008863813.1|  homogentisate 1,2-dioxygenase                      210   8e-61    Aphanomyces invadans
ref|WP_037528594.1|  homogentisate 1,2-dioxygenase                      209   8e-61    Sphingomonas wittichii
ref|WP_038794023.1|  homogentisate 1,2-dioxygenase                      210   8e-61    
ref|XP_003294282.1|  homogentisate 1,2-dioxygenase                      209   9e-61    Dictyostelium purpureum
ref|WP_040126730.1|  homogentisate 1,2-dioxygenase                      210   9e-61    Burkholderia cenocepacia
ref|WP_035480104.1|  homogentisate 1,2-dioxygenase                      210   9e-61    
ref|WP_042583258.1|  homogentisate 1,2-dioxygenase                      209   9e-61    Burkholderia
ref|WP_038752570.1|  homogentisate 1,2-dioxygenase                      209   9e-61    
ref|WP_008213525.1|  homogentisate 1,2-dioxygenase                      209   1e-60    Rhodanobacter sp. 115
ref|WP_042337350.1|  homogentisate 1,2-dioxygenase                      203   1e-60    
ref|XP_002065026.1|  GK14896                                            209   1e-60    Drosophila willistoni
ref|WP_042262350.1|  homogentisate 1,2-dioxygenase                      209   1e-60    Paraburkholderia heleia
emb|CEF66808.1|  Homogentisate 1,2-dioxygenase                          209   1e-60    Strongyloides ratti
ref|WP_038779032.1|  homogentisate 1,2-dioxygenase                      209   1e-60    
ref|XP_002430776.1|  Homogentisate 1,2-dioxygenase, putative            209   1e-60    Pediculus humanus corporis [human body lice]
ref|WP_019467035.1|  homogentisate 1,2-dioxygenase                      209   2e-60    Dyella japonica
gb|KDR25008.1|  homogentisate 1,2-dioxygenase                           207   2e-60    Caballeronia zhejiangensis
ref|WP_028198792.1|  homogentisate 1,2-dioxygenase                      209   2e-60    Paraburkholderia fungorum
ref|WP_036017507.1|  homogentisate 1,2-dioxygenase                      209   2e-60    Paraburkholderia mimosarum
emb|CDS10852.1|  hypothetical protein LRAMOSA11338                      209   2e-60    Lichtheimia ramosa
ref|WP_044455939.1|  homogentisate 1,2-dioxygenase                      209   2e-60    Pandoraea vervacti
ref|WP_035978446.1|  homogentisate 1,2-dioxygenase                      209   2e-60    
ref|XP_005182921.1|  PREDICTED: homogentisate 1,2-dioxygenase           206   2e-60    Musca domestica
ref|WP_010116835.1|  homogentisate 1,2-dioxygenase                      209   2e-60    
ref|WP_028371967.1|  homogentisate 1,2-dioxygenase                      209   2e-60    Burkholderia sp. UYPR1.413
ref|XP_008118688.1|  PREDICTED: homogentisate 1,2-dioxygenase           209   2e-60    Anolis carolinensis [Carolina anole]
ref|WP_038762374.1|  homogentisate 1,2-dioxygenase                      209   2e-60    
ref|WP_028040177.1|  homogentisate 1,2-dioxygenase                      208   2e-60    Caulobacter sp. URHA0033
ref|WP_031374102.1|  homogentisate 1,2-dioxygenase                      208   2e-60    Lysobacter antibioticus
ref|WP_045678791.1|  homogentisate 1,2-dioxygenase                      209   2e-60    Burkholderia glumae
ref|WP_011487936.1|  homogentisate 1,2-dioxygenase                      208   2e-60    Paraburkholderia xenovorans
gb|ACR32188.1|  Homogentisate 1,2-dioxygenase                           209   2e-60    Burkholderia glumae BGR1
ref|WP_017875198.1|  homogentisate 1,2-dioxygenase                      208   2e-60    Janthinobacterium sp. CG3
ref|WP_042299640.1|  homogentisate 1,2-dioxygenase                      209   2e-60    Paraburkholderia kururiensis
ref|XP_006682365.1|  hypothetical protein BATDEDRAFT_20910              209   2e-60    Batrachochytrium dendrobatidis JAM81
ref|WP_045600228.1|  homogentisate 1,2-dioxygenase                      209   2e-60    
ref|WP_043227126.1|  homogentisate 1,2-dioxygenase                      209   2e-60    
ref|WP_013338134.1|  homogentisate 1,2-dioxygenase                      209   3e-60    Burkholderia sp. CCGE1003
emb|CAQ72076.1|  Homogentisate 1,2-dioxygenase                          209   3e-60    Cupriavidus taiwanensis LMG 19424
ref|WP_030102015.1|  homogentisate 1,2-dioxygenase                      208   3e-60    Burkholderia sp. K24
gb|AAG17116.1|AF189238_1  homogentisate 1,2-dioxygenase                 207   3e-60    Danio rerio [leopard danio]
gb|EIE88763.1|  homogentisate 1,2-dioxygenase                           208   3e-60    Rhizopus delemar RA 99-880
ref|WP_013587215.1|  homogentisate 1,2-dioxygenase                      208   4e-60    Burkholderia sp. CCGE1001
ref|WP_014189341.1|  homogentisate 1,2-dioxygenase                      207   4e-60    Azospirillum lipoferum
ref|WP_026067841.1|  homogentisate 1,2-dioxygenase                      208   4e-60    Pusillimonas noertemannii
ref|WP_036115841.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        207   4e-60    Luteibacter
ref|WP_012287671.1|  homogentisate 1,2-dioxygenase                      207   4e-60    Caulobacter sp. K31
ref|WP_017333320.1|  homogentisate 1,2-dioxygenase                      208   5e-60    Burkholderia cepacia complex
ref|WP_044357680.1|  homogentisate 1,2-dioxygenase                      208   5e-60    
ref|WP_042310699.1|  homogentisate 1,2-dioxygenase                      207   5e-60    Paraburkholderia terrae
ref|WP_025772404.1|  homogentisate 1,2-dioxygenase                      207   6e-60    Sphingomonas sp. BHC-A
ref|WP_017225367.1|  homogentisate 1,2-dioxygenase                      207   6e-60    
ref|WP_038717067.1|  homogentisate 1,2-dioxygenase                      207   6e-60    
gb|EDO86086.1|  homogentisate 1,2-dioxygenase                           207   6e-60    Burkholderia pseudomallei 406e
ref|NP_694498.2|  homogentisate 1,2-dioxygenase                         207   6e-60    Danio rerio [leopard danio]
ref|WP_028361842.1|  homogentisate 1,2-dioxygenase                      207   7e-60    Burkholderia sp. JPY366
ref|WP_004426321.1|  homogentisate 1,2-dioxygenase                      200   7e-60    
ref|WP_036002991.1|  homogentisate 1,2-dioxygenase                      207   7e-60    Paraburkholderia caribensis
ref|WP_009771346.1|  homogentisate 1,2-dioxygenase                      207   7e-60    Paraburkholderia hospita
ref|WP_026164524.1|  homogentisate 1,2-dioxygenase                      207   7e-60    Cupriavidus taiwanensis
ref|WP_041386802.1|  homogentisate 1,2-dioxygenase                      207   8e-60    Sphingobium japonicum
ref|WP_035512138.1|  homogentisate 1,2-dioxygenase                      207   8e-60    Paraburkholderia nodosa
ref|WP_019185285.1|  homogentisate 1,2-dioxygenase                      207   8e-60    Stenotrophomonas
ref|WP_017772915.1|  homogentisate 1,2-dioxygenase                      207   9e-60    Paraburkholderia kururiensis
ref|WP_027777941.1|  homogentisate 1,2-dioxygenase                      207   9e-60    Paraburkholderia caledonica
ref|WP_025584928.1|  homogentisate 1,2-dioxygenase                      207   9e-60    Cupriavidus taiwanensis
dbj|BAI98521.1|  homogentisate 1,2-dioxygenase                          206   1e-59    Sphingobium japonicum UT26S
ref|WP_039398057.1|  homogentisate 1,2-dioxygenase                      207   1e-59    Pandoraea sputorum
ref|WP_008919747.1|  homogentisate 1,2-dioxygenase                      207   1e-59    
ref|WP_043099536.1|  homogentisate 1,2-dioxygenase                      206   1e-59    Oleiagrimonas soli
ref|WP_040670217.1|  homogentisate 1,2-dioxygenase                      207   1e-59    
ref|WP_038711090.1|  homogentisate 1,2-dioxygenase                      207   1e-59    Burkholderia sp. lig30
ref|WP_039015823.1|  homogentisate 1,2-dioxygenase                      206   1e-59    Cupriavidus sp. IDO
ref|XP_002168951.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      204   1e-59    
ref|WP_011688166.1|  homogentisate 1,2-dioxygenase                      206   2e-59    Candidatus Solibacter usitatus
ref|WP_042328325.1|  homogentisate 1,2-dioxygenase                      207   2e-59    Paraburkholderia ginsengisoli
ref|WP_035504530.1|  homogentisate 1,2-dioxygenase                      206   2e-59    Caballeronia jiangsuensis
ref|WP_022539005.1|  homogentisate 1,2-dioxygenase                      206   2e-59    
ref|WP_029050931.1|  homogentisate 1,2-dioxygenase                      206   2e-59    Ralstonia sp. 25mfcol4.1
ref|WP_029046963.1|  homogentisate 1,2-dioxygenase                      206   2e-59    Cupriavidus sp. amp6
emb|CDH58811.1|  homogentisate-dioxygenase                              206   2e-59    Lichtheimia corymbifera JMRC:FSU:9682
gb|KFM63935.1|  Homogentisate 1,2-dioxygenase                           199   2e-59    Stegodyphus mimosarum
gb|KFI05689.1|  homogentisate 1,2-dioxygenase                           206   2e-59    Massilia sp. BSC265
ref|WP_036252140.1|  homogentisate 1,2-dioxygenase                      206   2e-59    
ref|WP_043212232.1|  homogentisate 1,2-dioxygenase                      206   2e-59    
ref|WP_033476663.1|  homogentisate 1,2-dioxygenase                      202   2e-59    
gb|KEQ52055.1|  Homogentisate 1,2-dioxygenase                           206   3e-59    
ref|XP_001604483.1|  PREDICTED: homogentisate 1,2-dioxygenase           206   3e-59    
ref|WP_013088540.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|WP_042879129.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|XP_005649795.1|  Homogentisate 1,2-dioxygenase                      207   3e-59    
ref|WP_045728492.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|WP_006047841.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|WP_035082089.1|  homogentisate 1,2-dioxygenase                      205   3e-59    
ref|WP_020656747.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|WP_036236594.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|WP_037455383.1|  homogentisate 1,2-dioxygenase                      205   3e-59    
ref|WP_035093495.1|  homogentisate 1,2-dioxygenase                      205   3e-59    
gb|AJZ57620.1|  homogentisate 1,2-dioxygenase                           206   3e-59    
ref|WP_006156243.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|WP_020069746.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|WP_035466738.1|  homogentisate 1,2-dioxygenase                      206   3e-59    
ref|XP_004344298.1|  homogentisate 1,2-dioxygenase HgmA                 206   3e-59    
ref|WP_008437888.1|  homogentisate 1,2-dioxygenase                      205   4e-59    
ref|XP_003394121.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      205   4e-59    
ref|XP_003487562.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      205   4e-59    
ref|WP_043692380.1|  homogentisate 1,2-dioxygenase                      205   4e-59    
gb|EYR65476.1|  homogentisate 1,2-dioxygenase                           206   4e-59    
ref|WP_045236798.1|  homogentisate 1,2-dioxygenase                      205   4e-59    
ref|WP_035862755.1|  homogentisate 1,2-dioxygenase                      205   5e-59    
ref|WP_029970398.1|  homogentisate 1,2-dioxygenase                      205   5e-59    
ref|WP_033466467.1|  homogentisate 1,2-dioxygenase                      205   5e-59    
dbj|GAM20578.1|  hypothetical protein SAMD00019534_037530               205   5e-59    
ref|WP_015064481.1|  homogentisate 1,2-dioxygenase                      205   5e-59    
ref|WP_028930329.1|  homogentisate 1,2-dioxygenase                      205   5e-59    
ref|XP_009545110.1|  homogentisate 1,2-dioxygenase A1                   206   5e-59    
ref|WP_012401813.1|  homogentisate 1,2-dioxygenase                      205   6e-59    
ref|WP_018431846.1|  homogentisate 1,2-dioxygenase                      205   6e-59    
ref|WP_034221874.1|  homogentisate 1,2-dioxygenase                      204   6e-59    
ref|WP_021223622.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        204   7e-59    
ref|WP_043355726.1|  homogentisate 1,2-dioxygenase                      205   7e-59    
ref|WP_017232236.1|  homogentisate 1,2-dioxygenase                      204   8e-59    
ref|XP_004337143.1|  homogentisate 1,2dioxygenase                       204   9e-59    
gb|EIL91589.1|  homogentisate 1,2-dioxygenase                           208   9e-59    
ref|WP_027196793.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_018419522.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_010810174.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_011617392.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|NP_001087504.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_043805011.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|XP_006615574.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      204   1e-58    
ref|WP_016344458.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_034755820.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_041680146.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_035826372.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_003808481.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_043283587.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|WP_018315116.1|  homogentisate 1,2-dioxygenase                      204   1e-58    
ref|XP_004030031.1|  hypothetical protein IMG5_168310                   204   1e-58    
ref|WP_010925976.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        204   1e-58    
ref|XP_007424229.1|  PREDICTED: homogentisate 1,2-dioxygenase           204   1e-58    
gb|AEI80620.1|  homogentisate 1,2-dioxygenase HmgA                      205   2e-58    
ref|WP_018971594.1|  homogentisate 1,2-dioxygenase                      203   2e-58    
ref|WP_039365908.1|  homogentisate 1,2-dioxygenase                      204   2e-58    
ref|XP_001663831.1|  AAEL013637-PA                                      203   2e-58    
gb|EPR14962.1|  homogentisate 1,2-dioxygenase                           203   2e-58    
ref|WP_034472986.1|  homogentisate 1,2-dioxygenase                      204   2e-58    
gb|AAZ63280.1|  homogentisate 1,2-dioxygenase                           204   2e-58    
ref|WP_026250985.1|  homogentisate 1,2-dioxygenase                      203   2e-58    
ref|WP_039785945.1|  homogentisate 1,2-dioxygenase                      204   2e-58    
ref|WP_036045417.1|  homogentisate 1,2-dioxygenase                      204   2e-58    
ref|WP_035323602.1|  homogentisate 1,2-dioxygenase                      203   2e-58    
ref|WP_015001691.1|  homogentisate 1,2-dioxygenase                      203   2e-58    
gb|EFA82917.1|  homogentisate 1,2-dioxygenase                           203   2e-58    
ref|XP_008305794.1|  PREDICTED: homogentisate 1,2-dioxygenase           203   2e-58    
ref|XP_009865809.1|  PREDICTED: homogentisate 1,2-dioxygenase           203   3e-58    
ref|WP_035527028.1|  homogentisate 1,2-dioxygenase                      204   3e-58    
ref|WP_033841746.1|  homogentisate 1,2-dioxygenase                      203   3e-58    
ref|WP_026816985.1|  homogentisate 1,2-dioxygenase                      203   3e-58    
ref|WP_017354856.1|  homogentisate 1,2-dioxygenase                      203   3e-58    
ref|WP_033464574.1|  homogentisate 1,2-dioxygenase                      203   3e-58    
ref|XP_009904828.1|  PREDICTED: homogentisate 1,2-dioxygenase           203   3e-58    
ref|WP_003818930.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        203   3e-58    
ref|WP_039334650.1|  homogentisate 1,2-dioxygenase                      203   3e-58    
ref|WP_008351241.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        203   3e-58    
ref|WP_045766299.1|  homogentisate 1,2-dioxygenase                      202   3e-58    
ref|WP_034332113.1|  homogentisate 1,2-dioxygenase                      203   3e-58    
ref|XP_009490478.1|  PREDICTED: homogentisate 1,2-dioxygenase           202   3e-58    
ref|WP_025549488.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        203   3e-58    
ref|WP_036115496.1|  homogentisate 1,2-dioxygenase                      202   3e-58    
ref|XP_002487286.1|  homogentisate 1,2-dioxygenase, putative            204   4e-58    
ref|WP_035235834.1|  hypothetical protein                               202   4e-58    
ref|WP_045767936.1|  homogentisate 1,2-dioxygenase                      202   4e-58    
ref|WP_045758425.1|  homogentisate 1,2-dioxygenase                      202   4e-58    
ref|WP_041758748.1|  homogentisate 1,2-dioxygenase                      202   4e-58    
gb|AJF01228.1|  homogentisate 1,2-dioxygenase                           202   4e-58    
ref|WP_028854237.1|  homogentisate 1,2-dioxygenase                      203   4e-58    
ref|XP_001638799.1|  predicted protein                                  202   4e-58    
ref|WP_025601503.1|  homogentisate 1,2-dioxygenase                      202   4e-58    
ref|WP_016726969.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|WP_029578313.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|WP_034214838.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|WP_036023843.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|XP_001961769.1|  GF14763                                            202   5e-58    
ref|WP_036166391.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|XP_002015129.1|  GL19546                                            202   5e-58    
ref|WP_017514872.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        202   5e-58    
ref|WP_035044621.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|WP_011003989.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|XP_004519423.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      202   5e-58    
ref|WP_011518857.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
ref|WP_042614262.1|  homogentisate 1,2-dioxygenase                      202   5e-58    
gb|KFB39547.1|  AGAP009609-PA-like protein                              202   5e-58    
ref|WP_007736209.1|  homogentisate 1,2-dioxygenase                      203   6e-58    
emb|CBA17214.1|  probable homogentisate 1,2-dioxygenase protein         202   6e-58    
ref|WP_035497862.1|  homogentisate 1,2-dioxygenase                      202   6e-58    
gb|KFN41914.1|  homogentisate 1,2-dioxygenase                           202   6e-58    
ref|WP_042116169.1|  homogentisate 1,2-dioxygenase                      202   6e-58    
ref|WP_041228670.1|  homogentisate 1,2-dioxygenase                      202   6e-58    
gb|ACD15203.1|  homogentisate 1,2-dioxygenase                           202   6e-58    
ref|XP_007867330.1|  Homogentisate 1,2-dioxygenase                      204   6e-58    
ref|WP_017907924.1|  homogentisate 1,2-dioxygenase                      202   6e-58    
ref|XP_002003884.1|  GI20619                                            202   6e-58    
ref|WP_015039046.1|  homogentisate 1,2-dioxygenase                      202   6e-58    
ref|XP_011554857.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    202   8e-58    
ref|XP_003708206.2|  PREDICTED: homogentisate 1,2-dioxygenase iso...    202   8e-58    
ref|WP_035518742.1|  homogentisate 1,2-dioxygenase                      202   8e-58    
ref|WP_035552879.1|  homogentisate 1,2-dioxygenase                      202   8e-58    
gb|EIF32038.1|  homogentisate 1,2-dioxygenase                           202   9e-58    
ref|NP_001187808.1|  homogentisate 1,2-dioxygenase                      202   9e-58    
ref|XP_007875726.1|  hypothetical protein PFL1_00038                    202   9e-58    
ref|WP_043421923.1|  homogentisate 1,2-dioxygenase                      196   9e-58    
emb|CBN81879.1|  Homogentisate 1,2-dioxygenase                          202   9e-58    
ref|WP_028352644.1|  homogentisate 1,2-dioxygenase                      201   9e-58    
ref|WP_037039897.1|  homogentisate 1,2-dioxygenase                      202   9e-58    
ref|WP_014631242.1|  Homogentisate 1,2-dioxygenase                      202   1e-57    
ref|XP_002145266.1|  homogentisate 1,2-dioxygenase, putative            203   1e-57    
ref|XP_011554858.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    201   1e-57    
ref|NP_523544.2|  homogentisate 1,2-dioxygenase                         201   1e-57    
gb|EHJ71950.1|  homogentisate 1,2-dioxygenase                           201   1e-57    
ref|WP_017912037.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
ref|WP_039411426.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
ref|WP_035819294.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
ref|WP_041391410.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
ref|WP_026230288.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
gb|KFW79830.1|  Homogentisate 1,2-dioxygenase                           201   1e-57    
ref|XP_008920782.1|  PREDICTED: homogentisate 1,2-dioxygenase           201   1e-57    
ref|XP_011863378.1|  PREDICTED: homogentisate 1,2-dioxygenase           202   1e-57    
emb|CCA87859.1|  Homogentisate 1,2-dioxygenase                          201   1e-57    
ref|WP_004568445.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
ref|WP_011522807.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
ref|WP_045770594.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
gb|KFV72006.1|  Homogentisate 1,2-dioxygenase                           201   1e-57    
gb|AEG51299.1|  Homogentisate 1,2-dioxygenase                           201   1e-57    
ref|XP_011159903.1|  PREDICTED: homogentisate 1,2-dioxygenase           201   1e-57    
gb|KFP86982.1|  Homogentisate 1,2-dioxygenase                           201   1e-57    
ref|WP_019937961.1|  homogentisate 1,2-dioxygenase                      201   1e-57    
ref|WP_045764742.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
ref|WP_045583754.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
ref|XP_007062167.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   2e-57    
ref|XP_006132966.1|  PREDICTED: homogentisate 1,2-dioxygenase iso...    201   2e-57    
ref|XP_002079089.1|  GD23768                                            201   2e-57    
ref|XP_002036647.1|  GM18940                                            201   2e-57    
ref|WP_008652287.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        201   2e-57    
ref|WP_006463805.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
ref|XP_004927453.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      201   2e-57    
gb|KKB64797.1|  homogentisate 1,2-dioxygenase                           201   2e-57    
ref|XP_003747579.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      201   2e-57    
ref|WP_036009857.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
ref|WP_028770287.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
ref|WP_045206498.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
gb|AIT25144.1|  homogentisate 1,2-dioxygenase                           199   2e-57    
ref|WP_023264125.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
ref|WP_043182485.1|  homogentisate 1,2-dioxygenase                      200   2e-57    
ref|WP_018420245.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
ref|WP_033472633.1|  homogentisate 1,2-dioxygenase                      201   2e-57    
gb|ETN61605.1|  homogentisate 1,2-dioxygenase                           201   2e-57    
ref|XP_007331223.1|  hypothetical protein AGABI1DRAFT_60983             201   2e-57    
gb|ACD99845.1|  homogentisate 1,2-dioxygenase                           201   2e-57    
ref|WP_036135820.1|  homogentisate 1,2-dioxygenase                      200   2e-57    
ref|WP_026143697.1|  homogentisate 1,2-dioxygenase                      200   3e-57    
ref|WP_034278879.1|  homogentisate 1,2-dioxygenase                      200   3e-57    
ref|WP_033267229.1|  homogentisate 1,2-dioxygenase                      201   3e-57    
ref|WP_017460586.1|  homogentisate 1,2-dioxygenase                      200   3e-57    
ref|XP_007252347.1|  PREDICTED: homogentisate 1,2-dioxygenase           201   3e-57    
ref|WP_045218429.1|  homogentisate 1,2-dioxygenase                      201   3e-57    
ref|WP_027071189.1|  homogentisate 1,2-dioxygenase                      200   3e-57    
dbj|GAM34732.1|  hypothetical protein TCE0_015f02494                    202   3e-57    
ref|XP_005231148.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   3e-57    
ref|XP_005433381.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   3e-57    
ref|XP_009272906.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   3e-57    
ref|WP_005015435.1|  homogentisate 1,2-dioxygenase                      200   3e-57    
ref|WP_033176791.1|  homogentisate 1,2-dioxygenase                      200   3e-57    
gb|KFM00750.1|  Homogentisate 1,2-dioxygenase                           200   3e-57    
ref|XP_009100840.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   4e-57    
gb|ADO28372.1|  homogentisate 12-dioxygenase                            200   4e-57    
ref|WP_027680119.1|  homogentisate 1,2-dioxygenase                      200   4e-57    
ref|XP_005486160.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   4e-57    
ref|WP_043034280.1|  homogentisate 1,2-dioxygenase                      200   4e-57    
ref|WP_040778095.1|  homogentisate 1,2-dioxygenase                      200   4e-57    
ref|XP_005038556.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   4e-57    
ref|WP_032127150.1|  homogentisate 1,2-dioxygenase                      200   4e-57    
gb|KFP55803.1|  Homogentisate 1,2-dioxygenase                           196   4e-57    
ref|XP_001356795.2|  GA18425                                            200   4e-57    
ref|XP_008496850.1|  PREDICTED: homogentisate 1,2-dioxygenase           200   4e-57    
ref|WP_012250905.1|  homogentisate 1,2-dioxygenase                      199   5e-57    
ref|WP_027795743.1|  homogentisate 1,2-dioxygenase                      200   5e-57    
ref|WP_021202658.1|  homogentisate 1,2-dioxygenase                      199   5e-57    
ref|WP_010808011.1|  homogentisate 1,2-dioxygenase                      200   5e-57    
ref|WP_045761030.1|  homogentisate 1,2-dioxygenase                      199   5e-57    
gb|EKU79926.1|  homogentisate 1,2-dioxygenase                           199   5e-57    
ref|WP_024974109.1|  homogentisate 1,2-dioxygenase                      200   6e-57    
ref|WP_042296991.1|  homogentisate 1,2-dioxygenase                      200   6e-57    
ref|WP_024542559.1|  MULTISPECIES: homogentisate 1,2-dioxygenase        200   6e-57    
ref|WP_021193903.1|  homogentisate 1,2-dioxygenase                      200   6e-57    
ref|XP_002120159.1|  PREDICTED: homogentisate 1,2-dioxygenase-like      200   6e-57    
ref|XP_008545920.1|  PREDICTED: homogentisate 1,2-dioxygenase           199   6e-57    
gb|KFW09167.1|  Homogentisate 1,2-dioxygenase                           199   6e-57    
ref|WP_004634864.1|  homogentisate 1,2-dioxygenase                      200   6e-57    
ref|XP_007331521.1|  hypothetical protein AGABI1DRAFT_76664             200   6e-57    
gb|EFX73278.1|  hypothetical protein DAPPUDRAFT_307928                  199   6e-57    
ref|XP_009878193.1|  PREDICTED: homogentisate 1,2-dioxygenase           199   7e-57    
ref|WP_039008201.1|  homogentisate 1,2-dioxygenase                      199   7e-57    
gb|KFO11632.1|  Homogentisate 1,2-dioxygenase                           199   7e-57    
ref|WP_043398194.1|  homogentisate 1,2-dioxygenase                      199   7e-57    



>dbj|BAO57290.1| homogentisate 1,2-dioxygenase [Ipomoea nil]
Length=464

 Score =   431 bits (1109),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%), Gaps = 0/207 (0%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS
Sbjct  1    MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  60

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE
Sbjct  61   FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  120

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT
Sbjct  121  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  180

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECGRLQVNPGEIVVIPQGFRFAVDLPD
Sbjct  181  ECGRLQVNPGEIVVIPQGFRFAVDLPD  207



>ref|XP_011082728.1| PREDICTED: homogentisate 1,2-dioxygenase isoform X3 [Sesamum 
indicum]
Length=368

 Score =   379 bits (973),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 2/207 (1%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            MESK  +    P FPA+LEYQSGFGNHFSSEAIAGA+PRGQNSPLVCP GLYAEQISGTS
Sbjct  1    MESK--SAAARPAFPAELEYQSGFGNHFSSEAIAGAVPRGQNSPLVCPYGLYAEQISGTS  58

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FTSPRK NQ SW YRVKPSVTHEPF+PRVP+H +LVSEFN+SNSSATPTQLRWKPV +PE
Sbjct  59   FTSPRKFNQRSWLYRVKPSVTHEPFRPRVPSHGKLVSEFNESNSSATPTQLRWKPVKVPE  118

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            +PTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMD+CAFC+ADGDFLIVPQ+GRLWITT
Sbjct  119  SPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDDCAFCSADGDFLIVPQEGRLWITT  178

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECGRLQV+PGEIVV+PQGFRF VDLPD
Sbjct  179  ECGRLQVSPGEIVVLPQGFRFVVDLPD  205



>ref|XP_011082727.1| PREDICTED: homogentisate 1,2-dioxygenase isoform X2 [Sesamum 
indicum]
Length=392

 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 2/207 (1%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            MESK  +    P FPA+LEYQSGFGNHFSSEAIAGA+PRGQNSPLVCP GLYAEQISGTS
Sbjct  1    MESK--SAAARPAFPAELEYQSGFGNHFSSEAIAGAVPRGQNSPLVCPYGLYAEQISGTS  58

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FTSPRK NQ SW YRVKPSVTHEPF+PRVP+H +LVSEFN+SNSSATPTQLRWKPV +PE
Sbjct  59   FTSPRKFNQRSWLYRVKPSVTHEPFRPRVPSHGKLVSEFNESNSSATPTQLRWKPVKVPE  118

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            +PTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMD+CAFC+ADGDFLIVPQ+GRLWITT
Sbjct  119  SPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDDCAFCSADGDFLIVPQEGRLWITT  178

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECGRLQV+PGEIVV+PQGFRF VDLPD
Sbjct  179  ECGRLQVSPGEIVVLPQGFRFVVDLPD  205



>ref|XP_011082726.1| PREDICTED: homogentisate 1,2-dioxygenase isoform X1 [Sesamum 
indicum]
Length=465

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 2/207 (1%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            MESK  +    P FPA+LEYQSGFGNHFSSEAIAGA+PRGQNSPLVCP GLYAEQISGTS
Sbjct  1    MESK--SAAARPAFPAELEYQSGFGNHFSSEAIAGAVPRGQNSPLVCPYGLYAEQISGTS  58

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FTSPRK NQ SW YRVKPSVTHEPF+PRVP+H +LVSEFN+SNSSATPTQLRWKPV +PE
Sbjct  59   FTSPRKFNQRSWLYRVKPSVTHEPFRPRVPSHGKLVSEFNESNSSATPTQLRWKPVKVPE  118

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            +PTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMD+CAFC+ADGDFLIVPQ+GRLWITT
Sbjct  119  SPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDDCAFCSADGDFLIVPQEGRLWITT  178

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECGRLQV+PGEIVV+PQGFRF VDLPD
Sbjct  179  ECGRLQVSPGEIVVLPQGFRFVVDLPD  205



>ref|XP_009597213.1| PREDICTED: homogentisate 1,2-dioxygenase [Nicotiana tomentosiformis]
Length=469

 Score =   378 bits (971),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 194/209 (93%), Gaps = 2/209 (1%)
 Frame = +3

Query  180  MESKDDNVTG--SPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISG  353
            ME KD  +T     KFP+DLEYQSGFGNHFSSEAI GALP+GQNSPL+CP GLYAEQISG
Sbjct  1    MECKDSTITSHCCNKFPSDLEYQSGFGNHFSSEAIVGALPQGQNSPLICPFGLYAEQISG  60

Query  354  TSFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDI  533
            TSFTSPRKLNQ SW YR+KPSVTHEPF+ R+P HE+LVSEF+QSNS+ATPTQLRWKPV+I
Sbjct  61   TSFTSPRKLNQRSWLYRIKPSVTHEPFRRRLPRHEKLVSEFDQSNSAATPTQLRWKPVEI  120

Query  534  PETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWI  713
            PETP DFIDGLYT+CGAGSSYLRHGFAIHMYTANKSM+NCAFCNADGDFLIVPQ+GRLWI
Sbjct  121  PETPKDFIDGLYTICGAGSSYLRHGFAIHMYTANKSMENCAFCNADGDFLIVPQQGRLWI  180

Query  714  TTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            TTECGRLQV+PGEIV++PQGFRF+VDLPD
Sbjct  181  TTECGRLQVSPGEIVILPQGFRFSVDLPD  209



>ref|XP_006358956.1| PREDICTED: LOW QUALITY PROTEIN: homogentisate 1,2-dioxygenase-like 
[Solanum tuberosum]
Length=492

 Score =   375 bits (964),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = +3

Query  210  SPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQL  389
            S  FP+DLEYQ+GFGNHFSSEAI GALP+GQNSPL+CP GLYAEQISGTSFTSPRKLNQ 
Sbjct  7    SSNFPSDLEYQTGFGNHFSSEAIVGALPQGQNSPLICPFGLYAEQISGTSFTSPRKLNQR  66

Query  390  SWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLY  569
            SW YR+KPSVTHEPF+PR+P HE+LVSEFNQSNSSATPTQLRWKPV+IPETPTDFIDGLY
Sbjct  67   SWLYRIKPSVTHEPFRPRMPRHEKLVSEFNQSNSSATPTQLRWKPVEIPETPTDFIDGLY  126

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+CGAGSSYLRHGFAIHMYTANKSM+N AFCNADGDFLIVPQKGRLWITTECGRLQV PG
Sbjct  127  TICGAGSSYLRHGFAIHMYTANKSMENSAFCNADGDFLIVPQKGRLWITTECGRLQVCPG  186

Query  750  EIVVIPQGFRFAVDLPD  800
            EIV++PQG+RFAVDLPD
Sbjct  187  EIVILPQGYRFAVDLPD  203



>ref|XP_004251883.2| PREDICTED: homogentisate 1,2-dioxygenase [Solanum lycopersicum]
Length=463

 Score =   374 bits (960),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +3

Query  216  KFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSW  395
             FP+DLEYQ+GFGNHFSSEAI GALP+GQNSPL+CP GLYAEQISGTSFTSPRKLNQ SW
Sbjct  9    NFPSDLEYQTGFGNHFSSEAIVGALPQGQNSPLICPFGLYAEQISGTSFTSPRKLNQRSW  68

Query  396  FYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTV  575
             YR+KPSVTHEPF+PR+P HE+LVSEFNQSNSSATPTQLRWKPV+IPETPTDFIDGLYT+
Sbjct  69   LYRIKPSVTHEPFRPRMPRHEKLVSEFNQSNSSATPTQLRWKPVEIPETPTDFIDGLYTI  128

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
            CGAGSSYLRHGFAIHMYTANKSM+N AFCNADGDFLIVPQKGRLWITTECGRLQV PGEI
Sbjct  129  CGAGSSYLRHGFAIHMYTANKSMENSAFCNADGDFLIVPQKGRLWITTECGRLQVCPGEI  188

Query  756  VVIPQGFRFAVDLPD  800
            V++PQG+RFAVDLPD
Sbjct  189  VILPQGYRFAVDLPD  203



>gb|AAF73132.1|AF149017_1 homogentisate 1,2-dioxygenase [Solanum lycopersicum]
Length=477

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 187/195 (96%), Gaps = 0/195 (0%)
 Frame = +3

Query  216  KFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSW  395
             FP+DLEYQ+GFGNHFSSEAI GALP+GQNSPL+CP GLYAEQISGTSFTSPRKLNQ SW
Sbjct  6    NFPSDLEYQTGFGNHFSSEAIVGALPQGQNSPLICPFGLYAEQISGTSFTSPRKLNQRSW  65

Query  396  FYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTV  575
             YR+KPSVTHEPF+PR+P HE+LVSEFNQSNSSATPTQLRWKPV+IPETPTDFIDGLYT+
Sbjct  66   LYRIKPSVTHEPFRPRMPRHEKLVSEFNQSNSSATPTQLRWKPVEIPETPTDFIDGLYTI  125

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
            CGAGSSYLRHGFAIHMYTANKSM+N AFCNADGDFLIVPQKGRLWITTECGRLQV PGEI
Sbjct  126  CGAGSSYLRHGFAIHMYTANKSMENSAFCNADGDFLIVPQKGRLWITTECGRLQVCPGEI  185

Query  756  VVIPQGFRFAVDLPD  800
            V++PQG+RFAVDLPD
Sbjct  186  VILPQGYRFAVDLPD  200



>gb|KJB13251.1| hypothetical protein B456_002G065000 [Gossypium raimondii]
Length=326

 Score =   364 bits (934),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G  +FP DLEY SGFGNHF SEAIAG+LPRGQNSPL+CP GLYAEQISGTSFTSPRKL+Q
Sbjct  13   GWGRFPDDLEYHSGFGNHFESEAIAGSLPRGQNSPLICPFGLYAEQISGTSFTSPRKLSQ  72

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SWFYR+KPSVTHEPF PR P+H++LVSEF+ SN+ A PTQLRWKPVDIP++PTDFIDGL
Sbjct  73   RSWFYRIKPSVTHEPFWPREPSHKKLVSEFDGSNTVANPTQLRWKPVDIPDSPTDFIDGL  132

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
            YT+CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+P
Sbjct  133  YTICGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSP  192

Query  747  GEIVVIPQGFRFAVDLPD  800
            GEIVV+PQGFRF VDLPD
Sbjct  193  GEIVVLPQGFRFVVDLPD  210



>gb|KJB13255.1| hypothetical protein B456_002G065000 [Gossypium raimondii]
Length=340

 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G  +FP DLEY SGFGNHF SEAIAG+LPRGQNSPL+CP GLYAEQISGTSFTSPRKL+Q
Sbjct  13   GWGRFPDDLEYHSGFGNHFESEAIAGSLPRGQNSPLICPFGLYAEQISGTSFTSPRKLSQ  72

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SWFYR+KPSVTHEPF PR P+H++LVSEF+ SN+ A PTQLRWKPVDIP++PTDFIDGL
Sbjct  73   RSWFYRIKPSVTHEPFWPREPSHKKLVSEFDGSNTVANPTQLRWKPVDIPDSPTDFIDGL  132

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
            YT+CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+P
Sbjct  133  YTICGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSP  192

Query  747  GEIVVIPQGFRFAVDLPD  800
            GEIVV+PQGFRF VDLPD
Sbjct  193  GEIVVLPQGFRFVVDLPD  210



>gb|KJB13252.1| hypothetical protein B456_002G065000 [Gossypium raimondii]
Length=394

 Score =   363 bits (932),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G  +FP DLEY SGFGNHF SEAIAG+LPRGQNSPL+CP GLYAEQISGTSFTSPRKL+Q
Sbjct  13   GWGRFPDDLEYHSGFGNHFESEAIAGSLPRGQNSPLICPFGLYAEQISGTSFTSPRKLSQ  72

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SWFYR+KPSVTHEPF PR P+H++LVSEF+ SN+ A PTQLRWKPVDIP++PTDFIDGL
Sbjct  73   RSWFYRIKPSVTHEPFWPREPSHKKLVSEFDGSNTVANPTQLRWKPVDIPDSPTDFIDGL  132

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
            YT+CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+P
Sbjct  133  YTICGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSP  192

Query  747  GEIVVIPQGFRFAVDLPD  800
            GEIVV+PQGFRF VDLPD
Sbjct  193  GEIVVLPQGFRFVVDLPD  210



>gb|KHG11706.1| Homogentisate 1,2-dioxygenase -like protein [Gossypium arboreum]
Length=473

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G  +FP DLEY SGFGNHF SEAIAGALPRGQNSPL+CP GLYAEQISGTSFTSPRKLNQ
Sbjct  13   GWGRFPDDLEYHSGFGNHFESEAIAGALPRGQNSPLICPFGLYAEQISGTSFTSPRKLNQ  72

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SWFYR+KPSVTHEPF PR P+H++LVSEF+ SN+ A PTQLRWKPVDIP++PTDFIDGL
Sbjct  73   RSWFYRIKPSVTHEPFWPREPSHKKLVSEFDGSNTVANPTQLRWKPVDIPDSPTDFIDGL  132

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
            YT+CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+P
Sbjct  133  YTLCGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSP  192

Query  747  GEIVVIPQGFRFAVDLPD  800
            GEIVV+PQGFRF VDLPD
Sbjct  193  GEIVVLPQGFRFVVDLPD  210



>gb|KJB13249.1| hypothetical protein B456_002G065000 [Gossypium raimondii]
Length=419

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G  +FP DLEY SGFGNHF SEAIAG+LPRGQNSPL+CP GLYAEQISGTSFTSPRKL+Q
Sbjct  13   GWGRFPDDLEYHSGFGNHFESEAIAGSLPRGQNSPLICPFGLYAEQISGTSFTSPRKLSQ  72

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SWFYR+KPSVTHEPF PR P+H++LVSEF+ SN+ A PTQLRWKPVDIP++PTDFIDGL
Sbjct  73   RSWFYRIKPSVTHEPFWPREPSHKKLVSEFDGSNTVANPTQLRWKPVDIPDSPTDFIDGL  132

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
            YT+CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+P
Sbjct  133  YTICGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSP  192

Query  747  GEIVVIPQGFRFAVDLPD  800
            GEIVV+PQGFRF VDLPD
Sbjct  193  GEIVVLPQGFRFVVDLPD  210



>gb|KJB13254.1| hypothetical protein B456_002G065000 [Gossypium raimondii]
Length=457

 Score =   363 bits (931),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G  +FP DLEY SGFGNHF SEAIAG+LPRGQNSPL+CP GLYAEQISGTSFTSPRKL+Q
Sbjct  13   GWGRFPDDLEYHSGFGNHFESEAIAGSLPRGQNSPLICPFGLYAEQISGTSFTSPRKLSQ  72

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SWFYR+KPSVTHEPF PR P+H++LVSEF+ SN+ A PTQLRWKPVDIP++PTDFIDGL
Sbjct  73   RSWFYRIKPSVTHEPFWPREPSHKKLVSEFDGSNTVANPTQLRWKPVDIPDSPTDFIDGL  132

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
            YT+CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+P
Sbjct  133  YTICGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSP  192

Query  747  GEIVVIPQGFRFAVDLPD  800
            GEIVV+PQGFRF VDLPD
Sbjct  193  GEIVVLPQGFRFVVDLPD  210



>gb|KJB13248.1| hypothetical protein B456_002G065000 [Gossypium raimondii]
 gb|KJB13250.1| hypothetical protein B456_002G065000 [Gossypium raimondii]
Length=469

 Score =   362 bits (930),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G  +FP DLEY SGFGNHF SEAIAG+LPRGQNSPL+CP GLYAEQISGTSFTSPRKL+Q
Sbjct  13   GWGRFPDDLEYHSGFGNHFESEAIAGSLPRGQNSPLICPFGLYAEQISGTSFTSPRKLSQ  72

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SWFYR+KPSVTHEPF PR P+H++LVSEF+ SN+ A PTQLRWKPVDIP++PTDFIDGL
Sbjct  73   RSWFYRIKPSVTHEPFWPREPSHKKLVSEFDGSNTVANPTQLRWKPVDIPDSPTDFIDGL  132

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
            YT+CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+P
Sbjct  133  YTICGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSP  192

Query  747  GEIVVIPQGFRFAVDLPD  800
            GEIVV+PQGFRF VDLPD
Sbjct  193  GEIVVLPQGFRFVVDLPD  210



>ref|XP_010279197.1| PREDICTED: homogentisate 1,2-dioxygenase [Nelumbo nucifera]
Length=467

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 189/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  180  MESKDDNVT-GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGT  356
            ME+K  +   G   FPA+LEYQSGFGNHFSSEAI GALP+GQNSPL+CP GLYAEQISGT
Sbjct  1    MENKQPSSEFGDSGFPAELEYQSGFGNHFSSEAIPGALPQGQNSPLMCPYGLYAEQISGT  60

Query  357  SFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP  536
            SFTSPRK+NQ SW YR+KPSVTHEPFKPR+P+H++LVSEFNQSNSSA PTQLRWKP ++ 
Sbjct  61   SFTSPRKVNQRSWLYRIKPSVTHEPFKPRIPSHKKLVSEFNQSNSSANPTQLRWKPTEVA  120

Query  537  ETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWIT  716
            ++P DFIDGLYTVCGAGSS+LRHG+AIHMYTANKSMDNCA CNADGD LIVPQKGRLWI 
Sbjct  121  DSPIDFIDGLYTVCGAGSSFLRHGYAIHMYTANKSMDNCALCNADGDLLIVPQKGRLWIA  180

Query  717  TECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            TECGRLQ++PGEI+VIPQGFRFAV+LPD
Sbjct  181  TECGRLQISPGEIIVIPQGFRFAVNLPD  208



>ref|XP_007021635.1| Homogentisate 1,2-dioxygenase isoform 1 [Theobroma cacao]
 gb|EOY13160.1| Homogentisate 1,2-dioxygenase isoform 1 [Theobroma cacao]
Length=451

 Score =   360 bits (925),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +3

Query  219  FPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            FP DLEYQSGFGNHFSSEAIAGALPRGQNSPL+CP GLYAEQISGTSFTSPRKLNQ SW 
Sbjct  17   FPEDLEYQSGFGNHFSSEAIAGALPRGQNSPLICPFGLYAEQISGTSFTSPRKLNQRSWL  76

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVC  578
            YR+KPSVTHEPF PR  +H++LVSEF+ SN+ A PTQLRWKPVDIP+TPTDFIDGL+T+C
Sbjct  77   YRIKPSVTHEPFWPRDSSHKKLVSEFDGSNTVANPTQLRWKPVDIPDTPTDFIDGLFTIC  136

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGSS+LRHG+AIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+PGEI 
Sbjct  137  GAGSSFLRHGYAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSPGEIA  196

Query  759  VIPQGFRFAVDLPD  800
            V+PQGFRF VDLPD
Sbjct  197  VLPQGFRFVVDLPD  210



>gb|EYU44990.1| hypothetical protein MIMGU_mgv1a006018mg [Erythranthe guttata]
Length=461

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            MESK  +    P FPA L+YQSGFGN FS+EAI GALPRGQNSPLVCP GLYAEQISGTS
Sbjct  1    MESK--STAAQPAFPAVLDYQSGFGNDFSTEAIPGALPRGQNSPLVCPYGLYAEQISGTS  58

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FTSPRK NQ SW YRVKPSVTHEPF+PR+P H +LVSEFNQSNS+ATPTQLRW+P +IPE
Sbjct  59   FTSPRKHNQRSWLYRVKPSVTHEPFRPRIPNHVKLVSEFNQSNSAATPTQLRWRPAEIPE  118

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            TPTDF+DGLYTVCGAGSSYLRHGFAIHMY+ANKSM +CAFC+ADGDFLIVPQ+GRL ITT
Sbjct  119  TPTDFVDGLYTVCGAGSSYLRHGFAIHMYSANKSMKDCAFCSADGDFLIVPQEGRLRITT  178

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECGRL+V+PGEIVVIPQG RFAVDLPD
Sbjct  179  ECGRLEVSPGEIVVIPQGLRFAVDLPD  205



>emb|CDP05973.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 187/209 (89%), Gaps = 3/209 (1%)
 Frame = +3

Query  180  MESKD--DNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISG  353
            MESK    N   +  F  +LEY SGFGNH SSEAIAGALP+GQNSPL+CP GLYAEQISG
Sbjct  1    MESKKATTNAGAAADF-ENLEYVSGFGNHVSSEAIAGALPQGQNSPLICPYGLYAEQISG  59

Query  354  TSFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDI  533
            TSFT+PRKLN  SW YR+KPSVTHEPFKP+VPTH + VSEFNQSNSSATPTQLRW+PV+I
Sbjct  60   TSFTAPRKLNLRSWLYRIKPSVTHEPFKPKVPTHGKFVSEFNQSNSSATPTQLRWRPVEI  119

Query  534  PETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWI  713
            PE PTDFIDGL+TVCGAGSSYLRHG+AIHMYTANKSM+NCAFC+ADGDFLIVPQKG+LWI
Sbjct  120  PEAPTDFIDGLFTVCGAGSSYLRHGYAIHMYTANKSMENCAFCSADGDFLIVPQKGKLWI  179

Query  714  TTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            TTECGRLQV PGEIVVIPQGFRF VDLPD
Sbjct  180  TTECGRLQVVPGEIVVIPQGFRFVVDLPD  208



>ref|XP_007021636.1| Homogentisate 1,2-dioxygenase isoform 2, partial [Theobroma cacao]
 gb|EOY13161.1| Homogentisate 1,2-dioxygenase isoform 2, partial [Theobroma cacao]
Length=421

 Score =   356 bits (914),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DLEYQSGFGNHFSSEAIAGALPRGQNSPL+CP GLYAEQISGTSFTSPRKLNQ SW YR+
Sbjct  2    DLEYQSGFGNHFSSEAIAGALPRGQNSPLICPFGLYAEQISGTSFTSPRKLNQRSWLYRI  61

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPF PR  +H++LVSEF+ SN+ A PTQLRWKPVDIP+TPTDFIDGL+T+CGAG
Sbjct  62   KPSVTHEPFWPRDSSHKKLVSEFDGSNTVANPTQLRWKPVDIPDTPTDFIDGLFTICGAG  121

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHG+AIHMYTANKSMDNCAFCNADGDFL+VPQ+GRLWITTECGRLQV+PGEI V+P
Sbjct  122  SSFLRHGYAIHMYTANKSMDNCAFCNADGDFLVVPQQGRLWITTECGRLQVSPGEIAVLP  181

Query  768  QGFRFAVDLPD  800
            QGFRF VDLPD
Sbjct  182  QGFRFVVDLPD  192



>ref|XP_010675439.1| PREDICTED: homogentisate 1,2-dioxygenase [Beta vulgaris subsp. 
vulgaris]
Length=457

 Score =   357 bits (916),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 180/195 (92%), Gaps = 0/195 (0%)
 Frame = +3

Query  216  KFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSW  395
             FP DL Y SGFGNH SSEA+AGALP+GQN+PL+CP GLYAEQISGTSFT+PRKLN  SW
Sbjct  6    NFPEDLNYLSGFGNHLSSEAVAGALPQGQNNPLLCPFGLYAEQISGTSFTAPRKLNNRSW  65

Query  396  FYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTV  575
            FYR+KPSVTHEPFKPRVP +++L++EFNQSNSSA PTQLRWKPVDIPE PTDFIDGL T+
Sbjct  66   FYRIKPSVTHEPFKPRVPGNDKLIAEFNQSNSSANPTQLRWKPVDIPEDPTDFIDGLQTI  125

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
            CGAGSSYLRHG+A+HMYTANKSMDNCAFCNADGDFL VPQKGRLWITTECGRLQV+PGE+
Sbjct  126  CGAGSSYLRHGYAVHMYTANKSMDNCAFCNADGDFLFVPQKGRLWITTECGRLQVSPGEV  185

Query  756  VVIPQGFRFAVDLPD  800
             V+PQGFRFAV LPD
Sbjct  186  AVVPQGFRFAVSLPD  200



>ref|XP_006451751.1| hypothetical protein CICLE_v10008509mg [Citrus clementina]
 gb|ESR64991.1| hypothetical protein CICLE_v10008509mg [Citrus clementina]
Length=401

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            +DL Y+SGFGN FSSEAI GALPRGQNSPLVCP GLYAEQISGTSFTSPRKLNQ SW YR
Sbjct  22   SDLNYESGFGNSFSSEAIDGALPRGQNSPLVCPFGLYAEQISGTSFTSPRKLNQRSWLYR  81

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPS THEPFKPRVP H +LVSEF++SNS  TPTQLRWKPVDIP++PTDFIDGLYT+CGA
Sbjct  82   IKPSATHEPFKPRVPAHGKLVSEFDKSNSYTTPTQLRWKPVDIPDSPTDFIDGLYTICGA  141

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMYTANKSMDNCAFCNADGDFL+VPQKGRLWI TECG+L+V+PGEI V+
Sbjct  142  GSSFLRHGYAIHMYTANKSMDNCAFCNADGDFLVVPQKGRLWIATECGKLEVSPGEIAVL  201

Query  765  PQGFRFAVDLPD  800
            PQGFRFAV LPD
Sbjct  202  PQGFRFAVSLPD  213



>ref|XP_002285298.1| PREDICTED: homogentisate 1,2-dioxygenase [Vitis vinifera]
 emb|CBI20228.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            M+ +  + T     P+DL+YQ GFGNH SSEAIAGALPRGQN+PL CP GLYAEQISGT 
Sbjct  1    MDGQSVSKTNDSDPPSDLQYQFGFGNHLSSEAIAGALPRGQNNPLTCPFGLYAEQISGTP  60

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FT+PRK NQ SW YR+KPSVTHEPFKPRVP+H +LVSEFNQSNSS  PTQLRWKPV+IP+
Sbjct  61   FTAPRKQNQFSWLYRIKPSVTHEPFKPRVPSHGKLVSEFNQSNSSTNPTQLRWKPVEIPD  120

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            +PTDFIDGLYTVCGAGSS+LRHG+AIHMYTANKSMDNCAFCNADGDFLIVPQKGRL ITT
Sbjct  121  SPTDFIDGLYTVCGAGSSFLRHGYAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLSITT  180

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECG+LQV+PGEIVV+P GFRF VDLPD
Sbjct  181  ECGKLQVSPGEIVVLPHGFRFVVDLPD  207



>ref|XP_012074208.1| PREDICTED: homogentisate 1,2-dioxygenase [Jatropha curcas]
 gb|KDP36265.1| hypothetical protein JCGZ_09830 [Jatropha curcas]
Length=476

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 185/195 (95%), Gaps = 1/195 (1%)
 Frame = +3

Query  219  FPADL-EYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSW  395
            FP+D  +YQSGFGN F SEAI+GALPRGQNSPL+CP GLYAEQ+SG+SFTSPRKLNQ SW
Sbjct  31   FPSDDGDYQSGFGNSFESEAISGALPRGQNSPLLCPYGLYAEQLSGSSFTSPRKLNQRSW  90

Query  396  FYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTV  575
            FYR+KPSVTHEPFKPR+P++E+L SEF+++NS  TPTQLRWKP++IP++PTDF+DGLYTV
Sbjct  91   FYRIKPSVTHEPFKPRIPSNEKLASEFDKTNSRTTPTQLRWKPMEIPDSPTDFVDGLYTV  150

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
            CGAGSS+LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECG+LQV PGEI
Sbjct  151  CGAGSSFLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGKLQVTPGEI  210

Query  756  VVIPQGFRFAVDLPD  800
            VV+PQGFRFAVDLPD
Sbjct  211  VVLPQGFRFAVDLPD  225



>ref|XP_010108339.1| Homogentisate 1,2-dioxygenase [Morus notabilis]
 gb|EXC55248.1| Homogentisate 1,2-dioxygenase [Morus notabilis]
Length=359

 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            +L YQSG+GN FSSEA+AGALP GQNSPL+CP  LYAEQISGTSFTSPRKLN  SW YR+
Sbjct  9    ELSYQSGYGNSFSSEALAGALPHGQNSPLLCPYSLYAEQISGTSFTSPRKLNLRSWLYRI  68

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPFKPRVP+H +L+SEF++SNSSATPTQLRWKPV+IP++PTDF+DGL+TVCGAG
Sbjct  69   KPSVTHEPFKPRVPSHGKLLSEFDRSNSSATPTQLRWKPVEIPDSPTDFVDGLFTVCGAG  128

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFA+HMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECG+LQV+PGE+ ++P
Sbjct  129  SSFLRHGFAVHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGKLQVSPGEVAILP  188

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  189  QGFRFAVDLPD  199



>ref|XP_006494848.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Citrus sinensis]
 gb|KDO58498.1| hypothetical protein CISIN_1g011768mg [Citrus sinensis]
Length=478

 Score =   353 bits (907),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            +DL Y+SGFGN FSSEAI GALPRGQNSPLVCP GLYAEQISGTSFTSPRKLNQ SW YR
Sbjct  22   SDLNYESGFGNSFSSEAIDGALPRGQNSPLVCPFGLYAEQISGTSFTSPRKLNQRSWLYR  81

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPS THEPFKPRVP H +LVSEF++SNS  TPTQLRWKPVDIP++PTDFIDGLYT+CGA
Sbjct  82   IKPSATHEPFKPRVPAHGKLVSEFDKSNSYTTPTQLRWKPVDIPDSPTDFIDGLYTICGA  141

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMYTANKSMDNCAFCNADGDFL+VPQKGRLWI TECG+L+V+PGEI V+
Sbjct  142  GSSFLRHGYAIHMYTANKSMDNCAFCNADGDFLVVPQKGRLWIATECGKLEVSPGEIAVL  201

Query  765  PQGFRFAVDLPD  800
            PQGFRFAV LPD
Sbjct  202  PQGFRFAVSLPD  213



>ref|XP_006858313.1| PREDICTED: homogentisate 1,2-dioxygenase [Amborella trichopoda]
 gb|ERN19780.1| hypothetical protein AMTR_s00064p00100410 [Amborella trichopoda]
Length=471

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 6/207 (3%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            M S D+N   S      LEYQSGFGN FSSEA+ GALPR QNSPL+CP GLYAEQISGT+
Sbjct  1    MGSSDENGFSS------LEYQSGFGNVFSSEAMGGALPRDQNSPLLCPFGLYAEQISGTA  54

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FT+PRKLNQ SW YR+KPSVTHEPF PRVPTH  LVSEFNQS+SSATPTQLRWKP D+PE
Sbjct  55   FTAPRKLNQRSWLYRIKPSVTHEPFHPRVPTHAHLVSEFNQSSSSATPTQLRWKPADVPE  114

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            +PTDFIDGLYT+CGAGSS+LRHG+A+HMY ANKSMD+CAFC+ADGDFLIVPQKGRLW+TT
Sbjct  115  SPTDFIDGLYTICGAGSSFLRHGYAVHMYAANKSMDSCAFCSADGDFLIVPQKGRLWLTT  174

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECGRLQ+ PGEIVV+PQGFRF+VDLPD
Sbjct  175  ECGRLQICPGEIVVLPQGFRFSVDLPD  201



>ref|XP_010098423.1| Homogentisate 1,2-dioxygenase [Morus notabilis]
 gb|EXB75014.1| Homogentisate 1,2-dioxygenase [Morus notabilis]
Length=460

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            +L YQSG+GN FSSEA+AGALP GQNSPL+CP  LYAEQISGTSFTSPRKLN  SW YR+
Sbjct  9    ELSYQSGYGNSFSSEALAGALPHGQNSPLLCPYSLYAEQISGTSFTSPRKLNLRSWLYRI  68

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPFKPRVP+H +L+SEF++SNSSATPTQLRWKPV+IP++PTDF+DGL+TVCGAG
Sbjct  69   KPSVTHEPFKPRVPSHGKLLSEFDRSNSSATPTQLRWKPVEIPDSPTDFVDGLFTVCGAG  128

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFA+HMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECG+LQV+PGE+ ++P
Sbjct  129  SSFLRHGFAVHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGKLQVSPGEVAILP  188

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  189  QGFRFAVDLPD  199



>ref|XP_006401631.1| hypothetical protein EUTSA_v100136910mg, partial [Eutrema salsugineum]
 gb|ESQ43084.1| hypothetical protein EUTSA_v100136910mg, partial [Eutrema salsugineum]
Length=230

 Score =   340 bits (871),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A+LEYQSGFGNHFSSEAIAGALP  QNSPLVCP GLYAEQISGTSFTSPRKLNQ SW YR
Sbjct  6    AELEYQSGFGNHFSSEAIAGALPPDQNSPLVCPYGLYAEQISGTSFTSPRKLNQRSWLYR  65

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPFKPRVP H +LVSEF+ SNS   PTQLRW+P DIP++PTDF+DGLYT+CGA
Sbjct  66   IKPSVTHEPFKPRVPAHTKLVSEFDASNSRTNPTQLRWRPEDIPDSPTDFVDGLYTICGA  125

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHGFAIHMYTANK M + AFCNADGDFL+VPQ GRLWI TECGRL V+PGEI VI
Sbjct  126  GSSFLRHGFAIHMYTANKGMKDSAFCNADGDFLLVPQAGRLWIETECGRLLVSPGEIAVI  185

Query  765  PQGFRFAVDLPD  800
            PQGFRF++D+ D
Sbjct  186  PQGFRFSIDILD  197



>ref|XP_010060644.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Eucalyptus grandis]
 gb|KCW67428.1| hypothetical protein EUGRSUZ_F01184 [Eucalyptus grandis]
Length=471

 Score =   348 bits (893),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  210  SPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQL  389
            +P   A +EY +G GNHFSSEAIAGALP GQ SPLVCP GLYAEQISGTSFTSPRKLNQ 
Sbjct  18   APASAAGVEYLTGLGNHFSSEAIAGALPAGQKSPLVCPYGLYAEQISGTSFTSPRKLNQR  77

Query  390  SWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLY  569
            SW YR+KPSVTHEPFKPRVP HE+L+SEF+QSNSSATPTQLRW+P++IP+ PTDF+DGL 
Sbjct  78   SWLYRIKPSVTHEPFKPRVPAHEKLLSEFDQSNSSATPTQLRWRPLEIPDAPTDFVDGLL  137

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+CGAGSS+LRHGFA+HMYTANKSMDNCAFCNADGDFLIVPQ+GRLWITTECG+L V+PG
Sbjct  138  TMCGAGSSFLRHGFAVHMYTANKSMDNCAFCNADGDFLIVPQQGRLWITTECGKLLVSPG  197

Query  750  EIVVIPQGFRFAVDLPD  800
            E  V+PQGFRF+VDLPD
Sbjct  198  EAAVLPQGFRFSVDLPD  214



>ref|XP_009336163.1| PREDICTED: homogentisate 1,2-dioxygenase [Pyrus x bretschneideri]
Length=472

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL+YQSGF NHFSSEA+ GALP GQ+SPL+CP GLYAEQISGTSFTSPRKLN  SW YRV
Sbjct  23   DLQYQSGFHNHFSSEALPGALPHGQSSPLLCPYGLYAEQISGTSFTSPRKLNLRSWLYRV  82

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPF+P  P+H +LVSEF Q+NSS TPTQLRWKPVD+PE+PTDF++GL+TVCGAG
Sbjct  83   KPSVTHEPFRPLEPSHRKLVSEFTQANSSTTPTQLRWKPVDVPESPTDFVEGLFTVCGAG  142

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQ GRLWITTECG+LQ++PGEI V+P
Sbjct  143  SSFLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQTGRLWITTECGKLQISPGEIAVLP  202

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  203  QGFRFAVDLPD  213



>ref|XP_008226447.1| PREDICTED: homogentisate 1,2-dioxygenase [Prunus mume]
Length=472

 Score =   347 bits (889),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL+YQSGF NHFSSEA+ GALP GQ+SPL+CP GLYAEQISGTSFTSPRKLN  +W YRV
Sbjct  23   DLQYQSGFHNHFSSEALPGALPHGQSSPLLCPYGLYAEQISGTSFTSPRKLNHRTWLYRV  82

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPFKP   +H +LVSEF  SNSS TPTQLRWKPVDIPETPTDF++GLYTVCGAG
Sbjct  83   KPSVTHEPFKPLESSHRKLVSEFTDSNSSTTPTQLRWKPVDIPETPTDFVEGLYTVCGAG  142

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQ GRLWITTECG+LQ++PGEI V+P
Sbjct  143  SSFLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQTGRLWITTECGKLQISPGEIAVLP  202

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  203  QGFRFAVDLPD  213



>ref|XP_010916053.1| PREDICTED: homogentisate 1,2-dioxygenase isoform X2 [Elaeis guineensis]
Length=396

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A+LEYQSGFGNHFSSEA+ GALP GQN+PL+CP GLYAEQISGT+FT+PRK NQ SW YR
Sbjct  13   AELEYQSGFGNHFSSEALPGALPTGQNNPLLCPYGLYAEQISGTAFTAPRKQNQRSWLYR  72

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPF PR+P H+ LVSEFNQ  SS TPTQLRWKP D+P+ PTDFIDGLYT+CGA
Sbjct  73   IKPSVTHEPFHPRIPGHKHLVSEFNQLTSSVTPTQLRWKPADVPDAPTDFIDGLYTICGA  132

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMY ANKSMD CAFCNADGDFLIVPQKGRL ITTECG+LQV+PGE+VV+
Sbjct  133  GSSFLRHGYAIHMYAANKSMDGCAFCNADGDFLIVPQKGRLLITTECGKLQVSPGEMVVL  192

Query  765  PQGFRFAVDLPD  800
            PQGFRFA+DLPD
Sbjct  193  PQGFRFAIDLPD  204



>ref|XP_010537038.1| PREDICTED: homogentisate 1,2-dioxygenase [Tarenaya hassleriana]
Length=458

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            +LEYQSGFGNHFSSEAIAGALP GQNSPLVCP GLYAEQISGTSFTSPRKLNQ SW YR+
Sbjct  7    ELEYQSGFGNHFSSEAIAGALPHGQNSPLVCPYGLYAEQISGTSFTSPRKLNQRSWLYRI  66

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPFKPRVP HE+LVSEF+ SNS   PTQLRW+PVDIP++PTDF+DGL+T+CGAG
Sbjct  67   KPSVTHEPFKPRVPAHEKLVSEFDGSNSRTNPTQLRWRPVDIPDSPTDFVDGLFTICGAG  126

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFAIHMY ANK M++CA CNADGDFL+VPQ GRLWI TECGRL V+PGEI VIP
Sbjct  127  SSFLRHGFAIHMYAANKGMEDCALCNADGDFLLVPQSGRLWIETECGRLLVSPGEIAVIP  186

Query  768  QGFRFAVDLPD  800
            QGFRF++ LPD
Sbjct  187  QGFRFSIGLPD  197



>ref|XP_007213873.1| hypothetical protein PRUPE_ppa005219mg [Prunus persica]
 gb|EMJ15072.1| hypothetical protein PRUPE_ppa005219mg [Prunus persica]
Length=472

 Score =   345 bits (884),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL+YQSGF NHFSSEA+ G LP GQ+SPL+CP GLYAEQISGTSFTSPRKLN  +W YRV
Sbjct  23   DLQYQSGFHNHFSSEALPGTLPHGQSSPLLCPYGLYAEQISGTSFTSPRKLNHRTWLYRV  82

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPFKP   +H +LVSEF  SNSS TPTQLRWKPVDIPETPTDF++GLYTVCGAG
Sbjct  83   KPSVTHEPFKPLESSHRKLVSEFTDSNSSTTPTQLRWKPVDIPETPTDFVEGLYTVCGAG  142

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQ GRLWITTECG+LQ++PGEI V+P
Sbjct  143  SSFLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQTGRLWITTECGKLQISPGEIAVLP  202

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  203  QGFRFAVDLPD  213



>emb|CDY41772.1| BnaC02g13840D [Brassica napus]
Length=458

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            ADLEYQ GFGNHFSSEAIAGALPR QNSPLVCP GLYAEQISGTSFTSPRKLNQ SW YR
Sbjct  6    ADLEYQPGFGNHFSSEAIAGALPRDQNSPLVCPHGLYAEQISGTSFTSPRKLNQRSWLYR  65

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPFKPRVP H RLVSEF+ SNS   PTQLRW+P D+P++PTDF+DGLYTVCGA
Sbjct  66   IKPSVTHEPFKPRVPAHTRLVSEFDASNSRTNPTQLRWRPEDVPDSPTDFVDGLYTVCGA  125

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHGFAIHMYTANK M + AFCNADGDFL VPQ GR+WI TECGRL V+PGEI VI
Sbjct  126  GSSFLRHGFAIHMYTANKGMKDSAFCNADGDFLFVPQAGRVWIETECGRLLVSPGEIAVI  185

Query  765  PQGFRFAVDLPD  800
            PQGFRF++DLPD
Sbjct  186  PQGFRFSIDLPD  197



>ref|XP_010060646.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Eucalyptus grandis]
 gb|KCW67429.1| hypothetical protein EUGRSUZ_F01185 [Eucalyptus grandis]
Length=471

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +3

Query  210  SPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQL  389
            +P   A +EY +G GNHFSSEAIAGALP GQNSPLVCP GLYAEQISGTSFTSPR LNQ 
Sbjct  18   APAGAAGVEYLTGLGNHFSSEAIAGALPVGQNSPLVCPYGLYAEQISGTSFTSPRNLNQR  77

Query  390  SWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLY  569
            SW YR+KPSVTHEPFKPRVP HE+L+SEF++SNSSATPTQLRWKP++IP+ PTDF+ GL 
Sbjct  78   SWLYRIKPSVTHEPFKPRVPAHEKLLSEFDRSNSSATPTQLRWKPLEIPDAPTDFVAGLL  137

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+CGAGSS+LRHGFA+HMYTANKSMDNCAFCNADGDFLIVPQ+GRLWITTECG+L V+PG
Sbjct  138  TMCGAGSSFLRHGFAVHMYTANKSMDNCAFCNADGDFLIVPQQGRLWITTECGKLLVSPG  197

Query  750  EIVVIPQGFRFAVDLPD  800
            E  V+PQGFRF+VDLPD
Sbjct  198  EAAVLPQGFRFSVDLPD  214



>ref|XP_009127119.1| PREDICTED: homogentisate 1,2-dioxygenase [Brassica rapa]
 emb|CDY28797.1| BnaA02g09890D [Brassica napus]
Length=452

 Score =   342 bits (878),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            ADL+YQ GFGNHFSSEAI GALPR QNSPLVCPLGLYAEQISGTSFTSPRKLNQ SW YR
Sbjct  6    ADLQYQPGFGNHFSSEAIPGALPRDQNSPLVCPLGLYAEQISGTSFTSPRKLNQRSWLYR  65

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPFKPRVP H RLVSEF+ SNS   PTQLRW+P D+P++PTDF+DGLYTVCGA
Sbjct  66   IKPSVTHEPFKPRVPAHTRLVSEFDASNSRTNPTQLRWRPEDVPDSPTDFVDGLYTVCGA  125

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHGFAIHMYTANK M + AFCNADGDFL VPQ GR+WI TECGRL V+PGEI VI
Sbjct  126  GSSFLRHGFAIHMYTANKGMKDSAFCNADGDFLFVPQAGRVWIETECGRLLVSPGEIAVI  185

Query  765  PQGFRFAVDLPD  800
            PQGFRF++DLPD
Sbjct  186  PQGFRFSIDLPD  197



>ref|XP_010916052.1| PREDICTED: homogentisate 1,2-dioxygenase isoform X1 [Elaeis guineensis]
Length=471

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A+LEYQSGFGNHFSSEA+ GALP GQN+PL+CP GLYAEQISGT+FT+PRK NQ SW YR
Sbjct  13   AELEYQSGFGNHFSSEALPGALPTGQNNPLLCPYGLYAEQISGTAFTAPRKQNQRSWLYR  72

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPF PR+P H+ LVSEFNQ  SS TPTQLRWKP D+P+ PTDFIDGLYT+CGA
Sbjct  73   IKPSVTHEPFHPRIPGHKHLVSEFNQLTSSVTPTQLRWKPADVPDAPTDFIDGLYTICGA  132

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMY ANKSMD CAFCNADGDFLIVPQKGRL ITTECG+LQV+PGE+VV+
Sbjct  133  GSSFLRHGYAIHMYAANKSMDGCAFCNADGDFLIVPQKGRLLITTECGKLQVSPGEMVVL  192

Query  765  PQGFRFAVDLPD  800
            PQGFRFA+DLPD
Sbjct  193  PQGFRFAIDLPD  204



>ref|XP_009419658.1| PREDICTED: homogentisate 1,2-dioxygenase [Musa acuminata subsp. 
malaccensis]
Length=464

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = +3

Query  234  EYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKP  413
            EY SGFGNHFSSEA+ GALPR QNSPL CP GLYAEQISGTSFT+PRKLNQ SW YR+KP
Sbjct  9    EYLSGFGNHFSSEAVKGALPRDQNSPLGCPCGLYAEQISGTSFTTPRKLNQRSWLYRIKP  68

Query  414  SVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSS  593
            SVTH+PF PRVP HERLVSEFN+S SSATPTQLRWKPVDIPE+PTDFIDGLYT+CGAGSS
Sbjct  69   SVTHKPFHPRVPRHERLVSEFNESTSSATPTQLRWKPVDIPESPTDFIDGLYTICGAGSS  128

Query  594  YLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQG  773
            ++RHG+AIHMY ANKSM  CAFCNADGDFL+VPQKGRL ITTECG+L V+PGEIV++PQG
Sbjct  129  FIRHGYAIHMYAANKSMSGCAFCNADGDFLVVPQKGRLSITTECGKLVVSPGEIVILPQG  188

Query  774  FRFAVDLPD  800
            FRF++DLPD
Sbjct  189  FRFSIDLPD  197



>gb|KDO58497.1| hypothetical protein CISIN_1g011768mg [Citrus sinensis]
Length=474

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 175/192 (91%), Gaps = 4/192 (2%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            +DL Y+SGFGN FSSEAI GALPRGQNSPLVCP GLYAEQISGTSFTSPRKLNQ     R
Sbjct  22   SDLNYESGFGNSFSSEAIDGALPRGQNSPLVCPFGLYAEQISGTSFTSPRKLNQR----R  77

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPS THEPFKPRVP H +LVSEF++SNS  TPTQLRWKPVDIP++PTDFIDGLYT+CGA
Sbjct  78   IKPSATHEPFKPRVPAHGKLVSEFDKSNSYTTPTQLRWKPVDIPDSPTDFIDGLYTICGA  137

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMYTANKSMDNCAFCNADGDFL+VPQKGRLWI TECG+L+V+PGEI V+
Sbjct  138  GSSFLRHGYAIHMYTANKSMDNCAFCNADGDFLVVPQKGRLWIATECGKLEVSPGEIAVL  197

Query  765  PQGFRFAVDLPD  800
            PQGFRFAV LPD
Sbjct  198  PQGFRFAVSLPD  209



>ref|XP_008784438.1| PREDICTED: homogentisate 1,2-dioxygenase [Phoenix dactylifera]
Length=464

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A+LEYQSGFGNHFSSEA+ GALP  QN+PL+CP GLYAEQISGT+FT+PRK NQ SW YR
Sbjct  13   AELEYQSGFGNHFSSEALPGALPTEQNNPLLCPYGLYAEQISGTAFTAPRKQNQRSWLYR  72

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPF PRVP H+ LVSEFNQ  SSATPTQLRWKP D+P+ PTDFIDGLYT+CGA
Sbjct  73   IKPSVTHEPFHPRVPGHKHLVSEFNQLTSSATPTQLRWKPADVPDAPTDFIDGLYTICGA  132

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMY ANKSM+ CAFCNADGDFLIVPQKGRL ITTECG+LQV+PGE+VV+
Sbjct  133  GSSFLRHGYAIHMYAANKSMEGCAFCNADGDFLIVPQKGRLLITTECGKLQVSPGEMVVL  192

Query  765  PQGFRFAVDLPD  800
            PQGFRFA++LPD
Sbjct  193  PQGFRFAINLPD  204



>ref|XP_002518387.1| homogentisate 1,2-dioxygenase, putative [Ricinus communis]
 gb|EEF44023.1| homogentisate 1,2-dioxygenase, putative [Ricinus communis]
Length=457

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 182/196 (93%), Gaps = 2/196 (1%)
 Frame = +3

Query  219  FPAD-LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSW  395
            FP+D  +Y SGFGN F SEAI GALPRGQNSPL+CP GLYAEQISG+SFTSPRKL+Q SW
Sbjct  11   FPSDDHDYLSGFGNTFESEAIHGALPRGQNSPLICPYGLYAEQISGSSFTSPRKLSQRSW  70

Query  396  FYRVKPSVTHEPFKPRVPTHERLVSEFNQSNS-SATPTQLRWKPVDIPETPTDFIDGLYT  572
             YR+KPSVTHEPFKPRVP+H ++VSEF++++S + TPTQLRWKPVDIP++PTDFIDGL+T
Sbjct  71   LYRIKPSVTHEPFKPRVPSHGKIVSEFDKTDSCTTTPTQLRWKPVDIPDSPTDFIDGLFT  130

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            +CGAGSS+LRHGFAIHMYTANKSM NCA CNADGDFL+VPQ+GRLWITTECG+LQV+PGE
Sbjct  131  ICGAGSSFLRHGFAIHMYTANKSMGNCALCNADGDFLVVPQEGRLWITTECGKLQVSPGE  190

Query  753  IVVIPQGFRFAVDLPD  800
            +VV+PQGFRFAVDLPD
Sbjct  191  VVVLPQGFRFAVDLPD  206



>ref|XP_011460752.1| PREDICTED: homogentisate 1,2-dioxygenase [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL YQSGF NHFSSEA+ GALP GQ+SPL+CP GLYAEQISGTSFTSPRKLN  SW YR+
Sbjct  21   DLPYQSGFHNHFSSEALPGALPSGQSSPLLCPYGLYAEQISGTSFTSPRKLNLRSWLYRI  80

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPFKP  P+H RLVSEFN SNS  TPTQLRWKPVD+PETPTDF+ GLYTVCGAG
Sbjct  81   KPSVTHEPFKPLRPSHGRLVSEFNDSNSFTTPTQLRWKPVDVPETPTDFVQGLYTVCGAG  140

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFAIHMYTANKSMD+ AFCNADGDFLIVPQ GRLWITTECG+L V+PGE+ V+P
Sbjct  141  SSFLRHGFAIHMYTANKSMDDRAFCNADGDFLIVPQLGRLWITTECGKLNVSPGEVAVLP  200

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  201  QGFRFAVDLPD  211



>gb|KFK27018.1| hypothetical protein AALP_AA8G323800 [Arabis alpina]
Length=462

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
            L+YQSGFGNHFSSEAIAGALPR QNSPL+CP GLYAEQISGTSFTSPRKLNQ SW YR+K
Sbjct  12   LQYQSGFGNHFSSEAIAGALPRDQNSPLLCPYGLYAEQISGTSFTSPRKLNQRSWLYRIK  71

Query  411  PSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGS  590
            PSVTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+P DIP++PTDF+DGL+T+CGAGS
Sbjct  72   PSVTHEPFKPRVPAHKKLVSEFDGSNSRTNPTQLRWRPEDIPDSPTDFVDGLFTICGAGS  131

Query  591  SYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQ  770
            S+LRHGFAIHMYTAN+ M + AFCNADGDFL+VPQ GRLWI TECGRL V+PGEIVVIPQ
Sbjct  132  SFLRHGFAIHMYTANQGMKDSAFCNADGDFLLVPQAGRLWIETECGRLLVSPGEIVVIPQ  191

Query  771  GFRFAVDLPD  800
            GFRF+VDL D
Sbjct  192  GFRFSVDLLD  201



>gb|EPS72524.1| hypothetical protein M569_02231, partial [Genlisea aurea]
Length=446

 Score =   337 bits (863),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA+ EYQSGFGN FSSE+I GALPRGQNSPL CP GLYAEQISGTSFTSPRK NQ +W Y
Sbjct  13   PAEFEYQSGFGNDFSSESIDGALPRGQNSPLKCPYGLYAEQISGTSFTSPRKSNQRTWLY  72

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCG  581
            RVKPSVTHEPF PRVP HE+LVSEF+ +NS+ATPTQLRWKP +IP++P DFIDGL+TVCG
Sbjct  73   RVKPSVTHEPFTPRVPAHEKLVSEFDGTNSAATPTQLRWKPTEIPDSPADFIDGLFTVCG  132

Query  582  AGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVV  761
            AGSSYLRHGFAIH Y ANKSM+NCAFCNADGDFLIVPQ G L ITTECGRL V PGEIVV
Sbjct  133  AGSSYLRHGFAIHEYAANKSMENCAFCNADGDFLIVPQLGGLLITTECGRLLVLPGEIVV  192

Query  762  IPQGFRFAVDLPD  800
            IPQGFRF+VDLPD
Sbjct  193  IPQGFRFSVDLPD  205



>ref|XP_004137214.1| PREDICTED: homogentisate 1,2-dioxygenase [Cucumis sativus]
 gb|KGN53602.1| hypothetical protein Csa_4G088750 [Cucumis sativus]
Length=471

 Score =   337 bits (865),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            M ++    T    FP+DL Y SGF NHFSSEAI GALP+ QNSPL+CP GLYAEQISGTS
Sbjct  1    MAAQSVGETDGTDFPSDLPYLSGFNNHFSSEAIPGALPQSQNSPLICPFGLYAEQISGTS  60

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FTSPRK N  SW YR+KPSVTHEPF+ R+P +E+L+SEFN SN S+TPTQLRWKP D P+
Sbjct  61   FTSPRKANLCSWLYRIKPSVTHEPFRQRLPKNEKLISEFNASNCSSTPTQLRWKPADFPD  120

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
            +P DF+DGLYTVCGAGSS+LRHGFAIHMYTANKSM+NCAFCNADGDFLIVPQ G+LWI T
Sbjct  121  SPVDFVDGLYTVCGAGSSFLRHGFAIHMYTANKSMENCAFCNADGDFLIVPQSGKLWIIT  180

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            ECGRL+V+PGE+VV+PQGFRF V LPD
Sbjct  181  ECGRLEVSPGEVVVLPQGFRFVVYLPD  207



>ref|XP_008451701.1| PREDICTED: homogentisate 1,2-dioxygenase [Cucumis melo]
Length=492

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = +3

Query  174  TDMESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISG  353
            + M ++    T    FP+DL Y SGF NHFSSEAI GALP+ QNSPL CP GLYAEQISG
Sbjct  20   SSMAAQSVGETEGRDFPSDLPYLSGFNNHFSSEAIPGALPQSQNSPLNCPFGLYAEQISG  79

Query  354  TSFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDI  533
            TSFTSPRK N  SW YR+KPSVTHEPF+ R+P +E+L+SEFN SN S+TPTQLRWKP D 
Sbjct  80   TSFTSPRKANLCSWLYRIKPSVTHEPFRQRLPKNEKLISEFNASNCSSTPTQLRWKPADF  139

Query  534  PETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWI  713
            P++P DF+DGL+TVCGAGSS+LRHGFAIHMYTANKSM+NCAFCNADGDFLIVPQ GRLWI
Sbjct  140  PDSPVDFVDGLHTVCGAGSSFLRHGFAIHMYTANKSMENCAFCNADGDFLIVPQTGRLWI  199

Query  714  TTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            TTECGRL+V+PGEIVV+PQGFRF V LPD
Sbjct  200  TTECGRLEVSPGEIVVLPQGFRFVVYLPD  228



>ref|XP_002864301.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40560.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata]
Length=461

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP GLYAEQISGTSFTSPRKLNQ SW YR+KPS
Sbjct  13   YQSGFGNHFSSEAIAGALPLDQNSPLLCPYGLYAEQISGTSFTSPRKLNQRSWLYRIKPS  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+P DIPE+ TDF+DGLYT+CGAGSS+
Sbjct  73   VTHEPFKPRVPAHKKLVSEFDASNSRTNPTQLRWRPEDIPESETDFVDGLYTICGAGSSF  132

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY ANK M N AFCNADGDFL+VPQ GRLWI TECGRL V PGEI VIPQGF
Sbjct  133  LRHGFAIHMYVANKGMKNSAFCNADGDFLLVPQTGRLWIETECGRLLVTPGEIAVIPQGF  192

Query  777  RFAVDLPD  800
            RF+VDLPD
Sbjct  193  RFSVDLPD  200



>ref|XP_011010298.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Populus euphratica]
Length=464

 Score =   335 bits (858),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 182/212 (86%), Gaps = 5/212 (2%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPAD-LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGT  356
            ME +   +T +  FP+D  +Y SGFGN F SE+I G+LPRGQNSPL+CP GLYAEQISGT
Sbjct  1    MEQEQQQITITNDFPSDDHDYLSGFGNTFESESIPGSLPRGQNSPLLCPYGLYAEQISGT  60

Query  357  SFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKP--VD  530
            SFTSP KLNQ SW YR+KPSVTHEPF+ R P H++LVSEF++SNS  TPTQLRWKP  VD
Sbjct  61   SFTSPHKLNQRSWLYRIKPSVTHEPFQARFPRHDKLVSEFDKSNSYTTPTQLRWKPKLVD  120

Query  531  IPE--TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGR  704
              E   P DF++GLYTVCGAGSS+LRHGFAIHMYTANKSMD+CAFCNADGDFLIVPQKGR
Sbjct  121  TVEESAPIDFVEGLYTVCGAGSSFLRHGFAIHMYTANKSMDDCAFCNADGDFLIVPQKGR  180

Query  705  LWITTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            LWITTECG+LQV+PGEIVVIPQGFRFAVDLPD
Sbjct  181  LWITTECGKLQVSPGEIVVIPQGFRFAVDLPD  212



>gb|KEH19531.1| homogentisate 1,2-dioxygenase [Medicago truncatula]
Length=451

 Score =   334 bits (857),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 179/203 (88%), Gaps = 5/203 (2%)
 Frame = +3

Query  192  DDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSP  371
            D++++G      D  YQSGFGNHFSSEAI GALP  QNSPL+CP GLYAEQISGTSFT+P
Sbjct  2    DNSISGD-----DFNYQSGFGNHFSSEAITGALPVEQNSPLICPFGLYAEQISGTSFTTP  56

Query  372  RKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTD  551
            R LN  SW YR+KPSVTHEPFK RVP++++++SEFN SNSS  PTQLRWKP DIP++PTD
Sbjct  57   RSLNLFSWLYRIKPSVTHEPFKARVPSNKKILSEFNDSNSSTNPTQLRWKPTDIPDSPTD  116

Query  552  FIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGR  731
            FIDGL+TVCG+GSS++RHG+AIHMYTANKSMDNCAFCNADGDFLIVPQ+GRL+ITTECGR
Sbjct  117  FIDGLFTVCGSGSSFMRHGYAIHMYTANKSMDNCAFCNADGDFLIVPQQGRLFITTECGR  176

Query  732  LQVNPGEIVVIPQGFRFAVDLPD  800
            L V+PG++ +IPQGFRF V+LPD
Sbjct  177  LNVSPGDVAIIPQGFRFNVNLPD  199



>ref|XP_004510037.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Cicer arietinum]
Length=455

 Score =   334 bits (856),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D  Y SGFGNHFSSEAIAGALP GQNSPL+CP GLYAEQISGTSFT+PR LN  SW YR+
Sbjct  9    DFNYLSGFGNHFSSEAIAGALPVGQNSPLICPFGLYAEQISGTSFTTPRTLNLFSWLYRI  68

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSVTHEPFK RVP++ +++SEFN SNSSA PTQLRWKP DIP++PTDFIDGL TVCG+G
Sbjct  69   KPSVTHEPFKARVPSNGKILSEFNDSNSSANPTQLRWKPEDIPDSPTDFIDGLSTVCGSG  128

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS++RHG+AIHMYTANKSMDNCAFCNADGDFLIVPQ+GRL ITTECGRL+V+PG+I +IP
Sbjct  129  SSFMRHGYAIHMYTANKSMDNCAFCNADGDFLIVPQQGRLLITTECGRLKVSPGDIAIIP  188

Query  768  QGFRFAVDLPD  800
            QGFRF V+LPD
Sbjct  189  QGFRFNVNLPD  199



>ref|XP_011016626.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Populus euphratica]
Length=464

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 182/212 (86%), Gaps = 5/212 (2%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPAD-LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGT  356
            ME +   +T +  FP+D  +Y SGFGN F SE+I G+LPRGQNSPL+CP GLYAEQISGT
Sbjct  1    MEQEQQQITITNDFPSDDHDYLSGFGNTFESESIPGSLPRGQNSPLLCPYGLYAEQISGT  60

Query  357  SFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKP--VD  530
            SFTSP KLNQ SW YR+KPSVTHEPF+ R P H++LVSEF++SNS  TPTQLRWKP  VD
Sbjct  61   SFTSPHKLNQRSWLYRIKPSVTHEPFQARFPRHDKLVSEFDKSNSYTTPTQLRWKPKLVD  120

Query  531  IPE--TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGR  704
              E   P DF++GLYTVCGAGSS+LRHGFAIHMYTANKSMD+CAFCNADGDFLIVPQKGR
Sbjct  121  TVEESAPIDFVEGLYTVCGAGSSFLRHGFAIHMYTANKSMDDCAFCNADGDFLIVPQKGR  180

Query  705  LWITTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            LWITTECG+LQV+PGEIVVIPQGFRFAVDLPD
Sbjct  181  LWITTECGKLQVSPGEIVVIPQGFRFAVDLPD  212



>ref|XP_006280403.1| hypothetical protein CARUB_v10026329mg [Capsella rubella]
 gb|EOA13301.1| hypothetical protein CARUB_v10026329mg [Capsella rubella]
Length=476

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP GLYAEQISGTSFTSPRKLNQ SW YR+KPS
Sbjct  28   YQSGFGNHFSSEAIAGALPLDQNSPLICPYGLYAEQISGTSFTSPRKLNQRSWLYRIKPS  87

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+P DIPE+ TDF+DGLYT+CGAGSS+
Sbjct  88   VTHEPFKPRVPAHKKLVSEFDASNSRTNPTQLRWRPEDIPESATDFVDGLYTICGAGSSF  147

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY ANK M + AFCNADGDFL+VPQ GRLWI TECGRL V+PGEI VIPQGF
Sbjct  148  LRHGFAIHMYVANKGMKDSAFCNADGDFLLVPQAGRLWIETECGRLLVSPGEIAVIPQGF  207

Query  777  RFAVDLPD  800
            RF++DLPD
Sbjct  208  RFSIDLPD  215



>ref|XP_003540068.1| PREDICTED: homogentisate 1,2-dioxygenase-like isoform X1 [Glycine 
max]
 ref|XP_006592560.1| PREDICTED: homogentisate 1,2-dioxygenase-like isoform X2 [Glycine 
max]
Length=455

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
             +  Y SGFGNHFSSEA+AGALP  QNSPLVCP GLYAEQISGTSFTSPR  N  SWFYR
Sbjct  8    GEFVYLSGFGNHFSSEALAGALPVAQNSPLVCPYGLYAEQISGTSFTSPRNRNLFSWFYR  67

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPFKPRVP + R++SEFN SNSSA PTQLRWKP+D P++PTDFIDGL TVCG+
Sbjct  68   IKPSVTHEPFKPRVPGNGRILSEFNNSNSSANPTQLRWKPLDAPDSPTDFIDGLSTVCGS  127

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS++RHG+AIHMYTANKSMDNCAFCNADGDFLIVPQ+GRL +TTECGRL+V+PGEI ++
Sbjct  128  GSSFMRHGYAIHMYTANKSMDNCAFCNADGDFLIVPQQGRLLVTTECGRLKVSPGEIAIL  187

Query  765  PQGFRFAVDLPD  800
            PQGFRF+V+LPD
Sbjct  188  PQGFRFSVNLPD  199



>gb|AAM65958.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
Length=461

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP GLYAEQISGTSFTSPRKLNQ SW YR+KPS
Sbjct  13   YQSGFGNHFSSEAIAGALPLDQNSPLLCPYGLYAEQISGTSFTSPRKLNQRSWLYRIKPS  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+P DIP++ TDF+DGL+T+CGAGSS+
Sbjct  73   VTHEPFKPRVPAHKKLVSEFDASNSRTNPTQLRWRPEDIPDSETDFVDGLFTICGAGSSF  132

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY ANK M + AFCNADGDFL+VPQ GRLWI TECGRL V+PGEI VIPQGF
Sbjct  133  LRHGFAIHMYVANKGMKDSAFCNADGDFLLVPQTGRLWIETECGRLLVSPGEIAVIPQGF  192

Query  777  RFAVDLPD  800
            RF++DLPD
Sbjct  193  RFSIDLPD  200



>ref|XP_010482815.1| PREDICTED: homogentisate 1,2-dioxygenase [Camelina sativa]
Length=462

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP  LYAEQISGTSFTSPRKLNQ SW YR+KPS
Sbjct  14   YQSGFGNHFSSEAIAGALPLDQNSPLICPYCLYAEQISGTSFTSPRKLNQRSWLYRIKPS  73

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+  DIPE+ TDF+DGLYT+CGAGSS+
Sbjct  74   VTHEPFKPRVPAHKKLVSEFDSSNSRTNPTQLRWRAEDIPESATDFVDGLYTICGAGSSF  133

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY ANK M + AFCNADGDFL+VPQ GRLWI TECGRL V+PGEI VIPQGF
Sbjct  134  LRHGFAIHMYVANKGMKDSAFCNADGDFLLVPQVGRLWIDTECGRLLVSPGEIAVIPQGF  193

Query  777  RFAVDLPD  800
            RF+VDLPD
Sbjct  194  RFSVDLPD  201



>ref|XP_010446433.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Camelina sativa]
Length=461

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP  LYAEQISGTSFTSPRKLNQ SW YR+KPS
Sbjct  13   YQSGFGNHFSSEAIAGALPLDQNSPLICPYCLYAEQISGTSFTSPRKLNQRSWLYRIKPS  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+  DIPE+ TDF+DGLYT+CGAGSS+
Sbjct  73   VTHEPFKPRVPAHKKLVSEFDSSNSRTNPTQLRWRAEDIPESATDFVDGLYTICGAGSSF  132

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY ANK M + AFCNADGDFL+VPQ GRLWI TECGRL V+PGEI VIPQGF
Sbjct  133  LRHGFAIHMYVANKGMKDSAFCNADGDFLLVPQVGRLWIDTECGRLLVSPGEIAVIPQGF  192

Query  777  RFAVDLPD  800
            RF+VDLPD
Sbjct  193  RFSVDLPD  200



>ref|XP_010442982.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Camelina sativa]
Length=461

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP  LYAEQISGTSFTSPRKLNQ SW YR+KPS
Sbjct  13   YQSGFGNHFSSEAIAGALPLDQNSPLICPYCLYAEQISGTSFTSPRKLNQRSWLYRIKPS  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+  DIPE+ TDF+DGLYT+CGAGSS+
Sbjct  73   VTHEPFKPRVPAHKKLVSEFDSSNSRTNPTQLRWRAEDIPESATDFVDGLYTICGAGSSF  132

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY ANK M + AFCNADGDFL+VPQ GRLWI TECGRL V+PGEI VIPQGF
Sbjct  133  LRHGFAIHMYVANKGMKDSAFCNADGDFLLVPQVGRLWIDTECGRLLVSPGEIAVIPQGF  192

Query  777  RFAVDLPD  800
            RF+VDLPD
Sbjct  193  RFSVDLPD  200



>gb|AAD00360.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
Length=461

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP GLYAEQISGTSFTSPRKLNQ SW YRVKPS
Sbjct  13   YQSGFGNHFSSEAIAGALPLDQNSPLLCPYGLYAEQISGTSFTSPRKLNQRSWLYRVKPS  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+P DIP++  DF+DGL+T+CGAGSS+
Sbjct  73   VTHEPFKPRVPAHKKLVSEFDASNSRTNPTQLRWRPEDIPDSEIDFVDGLFTICGAGSSF  132

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY AN  M + AFCNADGDFL+VPQ GRLWI TECGRL V PGEI VIPQGF
Sbjct  133  LRHGFAIHMYVANTGMKDSAFCNADGDFLLVPQTGRLWIETECGRLLVTPGEIAVIPQGF  192

Query  777  RFAVDLPD  800
            RF++DLPD
Sbjct  193  RFSIDLPD  200



>ref|NP_200219.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
 ref|NP_851187.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
 sp|Q9ZRA2.2|HGD_ARATH RecName: Full=Homogentisate 1,2-dioxygenase; AltName: Full=Homogentisate 
oxygenase; AltName: Full=Homogentisic acid oxidase; 
AltName: Full=Homogentisicase [Arabidopsis thaliana]
 gb|AAF36499.1|AF130845_1 homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
 dbj|BAA97130.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
 gb|AAM98216.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
 gb|AAQ55280.1| At5g54080 [Arabidopsis thaliana]
 gb|AED96447.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
 gb|AED96448.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana]
Length=461

 Score =   327 bits (838),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGNHFSSEAIAGALP  QNSPL+CP GLYAEQISGTSFTSPRKLNQ SW YRVKPS
Sbjct  13   YQSGFGNHFSSEAIAGALPLDQNSPLLCPYGLYAEQISGTSFTSPRKLNQRSWLYRVKPS  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            VTHEPFKPRVP H++LVSEF+ SNS   PTQLRW+P DIP++  DF+DGL+T+CGAGSS+
Sbjct  73   VTHEPFKPRVPAHKKLVSEFDASNSRTNPTQLRWRPEDIPDSEIDFVDGLFTICGAGSSF  132

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            LRHGFAIHMY AN  M + AFCNADGDFL+VPQ GRLWI TECGRL V PGEI VIPQGF
Sbjct  133  LRHGFAIHMYVANTGMKDSAFCNADGDFLLVPQTGRLWIETECGRLLVTPGEIAVIPQGF  192

Query  777  RFAVDLPD  800
            RF++DLPD
Sbjct  193  RFSIDLPD  200



>ref|XP_002298900.1| hypothetical protein POPTR_0001s38310g [Populus trichocarpa]
 gb|EEE83705.1| hypothetical protein POPTR_0001s38310g [Populus trichocarpa]
Length=464

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 179/212 (84%), Gaps = 5/212 (2%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPAD-LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGT  356
            ME +   +T +  FP+D  +Y SGFGN F SE+I G+LPR QNSPL+CP GLYAEQISGT
Sbjct  1    MEQEQQQITITNDFPSDDHDYLSGFGNTFESESIPGSLPRRQNSPLLCPYGLYAEQISGT  60

Query  357  SFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKP--VD  530
            SFTSP KLNQ SW YR+KPSVTHEPF+ R P H++LVSEF++SNS  TPTQLRWKP  VD
Sbjct  61   SFTSPHKLNQRSWLYRIKPSVTHEPFQARFPRHDKLVSEFDKSNSYTTPTQLRWKPKPVD  120

Query  531  IPE--TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGR  704
              E   P DF++GLYTVCGAGSS+LRHGFAIHMYTANKSMD+ AFCNADGDFLIVPQKGR
Sbjct  121  TVEESAPIDFVEGLYTVCGAGSSFLRHGFAIHMYTANKSMDDRAFCNADGDFLIVPQKGR  180

Query  705  LWITTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            LWI TECG+LQV+PGEIVVIPQGFRFAVDLPD
Sbjct  181  LWIATECGKLQVSPGEIVVIPQGFRFAVDLPD  212



>ref|XP_003527216.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Glycine max]
Length=455

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
             + E  SGFGNHFSSEA+AGALP  QNSPLVCP GLYAEQISGTSFTSPR  N  SWFYR
Sbjct  8    GEFECLSGFGNHFSSEALAGALPAAQNSPLVCPYGLYAEQISGTSFTSPRNRNLFSWFYR  67

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPFKPRVP + R++SEFN S+SSA PTQLRWKP+D P++P DFIDGL T+CG+
Sbjct  68   IKPSVTHEPFKPRVPGNGRILSEFNNSSSSANPTQLRWKPMDAPDSPMDFIDGLSTMCGS  127

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS++RHG+AIHMY ANKSMDNCAFCNADGDFLIVPQ+GRL ITTECGRL+V+PGEI +I
Sbjct  128  GSSFMRHGYAIHMYNANKSMDNCAFCNADGDFLIVPQQGRLLITTECGRLKVSPGEIAII  187

Query  765  PQGFRFAVDLPD  800
            P GFRF+V+LPD
Sbjct  188  PHGFRFSVNLPD  199



>gb|ABR16047.1| unknown [Picea sitchensis]
Length=463

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            + L YQSGFGNHFSSEA  GALP GQN+PL CP GLYAEQ+SGT+FT PRKLNQ SW YR
Sbjct  19   SHLGYQSGFGNHFSSEAKPGALPVGQNNPLKCPYGLYAEQVSGTAFTVPRKLNQRSWLYR  78

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +KPSVTHEPF PRVP+H+ L+SEFNQS+SSATPTQLRW P  IP+T T+FIDGL+T+CGA
Sbjct  79   IKPSVTHEPFHPRVPSHDYLISEFNQSSSSATPTQLRWSPFGIPDTKTNFIDGLFTICGA  138

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHGFA+HMY AN SM+ CAF NADGDFLIVPQ+GRLWITTE GRLQV+PGEIVV+
Sbjct  139  GSSFLRHGFAVHMYAANASMEGCAFANADGDFLIVPQQGRLWITTELGRLQVSPGEIVVL  198

Query  765  PQGFRFAVDLPD  800
             QGFR+++DLPD
Sbjct  199  QQGFRYSIDLPD  210



>ref|XP_007133067.1| hypothetical protein PHAVU_011G148800g [Phaseolus vulgaris]
 gb|ESW05061.1| hypothetical protein PHAVU_011G148800g [Phaseolus vulgaris]
Length=458

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = +3

Query  198  NVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRK  377
            ++  +P    D  Y SGFGNH SSEA+ GALP GQNSPL+CP GLYAEQISGTSFTSPR 
Sbjct  5    SIMDNPIAAQDFTYLSGFGNHLSSEALPGALPEGQNSPLICPFGLYAEQISGTSFTSPRN  64

Query  378  LNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFI  557
             N+ SWFYR+KPSVTHEPFKPRVP++ ++ SEFN SNSSA PTQLRWKP+D P++PTDFI
Sbjct  65   RNRCSWFYRIKPSVTHEPFKPRVPSNWKIFSEFNSSNSSANPTQLRWKPMDAPDSPTDFI  124

Query  558  DGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQ  737
            DGL T+CG+GSS++RHG+AIHMY ANKSMDNCAFCNADGDFLIVPQ+GRL ITTECGRL+
Sbjct  125  DGLSTICGSGSSFMRHGYAIHMYAANKSMDNCAFCNADGDFLIVPQQGRLLITTECGRLK  184

Query  738  VNPGEIVVIPQGFRFAVDLPD  800
            V+PGEI ++PQGFRF+V+LPD
Sbjct  185  VSPGEIAILPQGFRFSVNLPD  205



>gb|AFW86248.2| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_295914, partial 
[Zea mays]
Length=283

 Score =   305 bits (781),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +L Y SG GN F+SEA+ G+LP GQN+PLVCPLGLYAEQ+SGTSFT+PR  N  +W Y
Sbjct  9    PPELRYLSGLGNTFTSEAVPGSLPVGQNNPLVCPLGLYAEQLSGTSFTTPRARNLRTWLY  68

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETP-TDFIDGLYTVC  578
            R+KPSVTHEPF PR PT+ERLV EF+++ + ATPTQLRW+P D+P  P  DFIDGLYTVC
Sbjct  69   RIKPSVTHEPFYPRNPTNERLVGEFDRTTTVATPTQLRWRPADVPLHPGLDFIDGLYTVC  128

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGSS LRHG+AIHMY ANK MD C+ CNADGDFLIVPQ+GRL+ITTECGRL V+PGEIV
Sbjct  129  GAGSSCLRHGYAIHMYAANKPMDGCSLCNADGDFLIVPQQGRLFITTECGRLLVSPGEIV  188

Query  759  VIPQGFRFAVDLPD  800
            VIPQG RFAVDLPD
Sbjct  189  VIPQGLRFAVDLPD  202



>ref|XP_002437662.1| hypothetical protein SORBIDRAFT_10g000360 [Sorghum bicolor]
 gb|EER89029.1| hypothetical protein SORBIDRAFT_10g000360 [Sorghum bicolor]
Length=469

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            +L Y SG GN FSSEA+ G+LP GQNSPLVCPLGLYAEQ+SGTSFT+PR  N  +W YR+
Sbjct  18   ELRYLSGLGNSFSSEAVPGSLPVGQNSPLVCPLGLYAEQLSGTSFTTPRARNLRTWLYRI  77

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETP-TDFIDGLYTVCGA  584
            KPSVTHEPF PR PT+ERLV EF+++ + ATPTQLRW+P D+P  P  DFIDGLYTVCGA
Sbjct  78   KPSVTHEPFYPRNPTNERLVGEFHRATTVATPTQLRWRPADVPLHPDLDFIDGLYTVCGA  137

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS LRHG+AIHMY ANKSMD CAFCNADGDFLIVPQ+GRL ITTECG+L V+PGEIVVI
Sbjct  138  GSSCLRHGYAIHMYAANKSMDGCAFCNADGDFLIVPQQGRLLITTECGKLLVSPGEIVVI  197

Query  765  PQGFRFAVDLPD  800
            PQGFRFAVDLPD
Sbjct  198  PQGFRFAVDLPD  209



>ref|XP_006656539.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Oryza brachyantha]
Length=462

 Score =   306 bits (784),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
              Y SG GN FSSEA+AG+LPRGQNSPL+CPLGLYAEQ+SGT FT+PR  N  +W YR K
Sbjct  17   FRYLSGLGNSFSSEAVAGSLPRGQNSPLLCPLGLYAEQLSGTPFTAPRARNLRTWLYRTK  76

Query  411  PSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP-ETPTDFIDGLYTVCGAG  587
            PSVTHEPF PR P H RL+ +F+++ + ATPTQLRW+P D+P + P DFIDGLYT+CGAG
Sbjct  77   PSVTHEPFHPRRPAHRRLIGDFDRTTTVATPTQLRWRPADVPHDPPLDFIDGLYTICGAG  136

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHG+AIHMY A KSMD CAFCNADGDFLIVPQ+G+L ITTECG+L V PGEIV+IP
Sbjct  137  SSFLRHGYAIHMYAATKSMDGCAFCNADGDFLIVPQQGKLLITTECGKLLVPPGEIVIIP  196

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  197  QGFRFAVDLPD  207



>gb|AFW86250.1| homogentisate 1,2-dioxygenase [Zea mays]
Length=454

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +L Y SG GN F+SEA+ G+LP GQN+PLVCPLGLYAEQ+SGTSFT+PR  N  +W Y
Sbjct  9    PPELRYLSGLGNTFTSEAVPGSLPVGQNNPLVCPLGLYAEQLSGTSFTTPRARNLRTWLY  68

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETP-TDFIDGLYTVC  578
            R+KPSVTHEPF PR PT+ERLV EF+++ + ATPTQLRW+P D+P  P  DFIDGLYTVC
Sbjct  69   RIKPSVTHEPFYPRNPTNERLVGEFDRTTTVATPTQLRWRPADVPLHPGLDFIDGLYTVC  128

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGSS LRHG+AIHMY ANK MD C+ CNADGDFLIVPQ+GRL+ITTECGRL V+PGEIV
Sbjct  129  GAGSSCLRHGYAIHMYAANKPMDGCSLCNADGDFLIVPQQGRLFITTECGRLLVSPGEIV  188

Query  759  VIPQGFRFAVDLPD  800
            VIPQG RFAVDLPD
Sbjct  189  VIPQGLRFAVDLPD  202



>ref|NP_001131427.2| uncharacterized protein LOC100192757 [Zea mays]
 gb|ACF79828.2| unknown [Zea mays]
Length=454

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +L Y SG GN F+SEA+ G+LP GQN+PLVCPLGLYAEQ+SGTSFT+PR  N  +W Y
Sbjct  9    PPELRYLSGLGNTFTSEAVPGSLPVGQNNPLVCPLGLYAEQLSGTSFTTPRARNLRTWLY  68

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETP-TDFIDGLYTVC  578
            R+KPSVTHEPF PR PT+ERLV EF+++ + ATPTQLRW+P D+P  P  DFIDGLYTVC
Sbjct  69   RIKPSVTHEPFYPRNPTNERLVGEFDRTTTVATPTQLRWRPADVPLHPGLDFIDGLYTVC  128

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGSS LRHG+AIHMY ANK MD C+ CNADGDFLIVPQ+GRL+ITTECGRL V+PGEIV
Sbjct  129  GAGSSCLRHGYAIHMYAANKPMDGCSLCNADGDFLIVPQQGRLFITTECGRLLVSPGEIV  188

Query  759  VIPQGFRFAVDLPD  800
            VIPQG RFAVDLPD
Sbjct  189  VIPQGLRFAVDLPD  202



>gb|ACG28505.1| homogentisate 1,2-dioxygenase [Zea mays]
Length=455

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +L Y SG GN F+SEA+ G+LP GQN+PLVCPLGLYAEQ+SGTSFT+PR  N  +W Y
Sbjct  9    PPELRYLSGLGNTFTSEAVPGSLPVGQNNPLVCPLGLYAEQLSGTSFTTPRARNLRTWLY  68

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETP-TDFIDGLYTVC  578
            R+KPSVTHEPF PR PT+ERLV EF+++ + ATPTQLRW+P D+P  P  DFIDGLYTVC
Sbjct  69   RIKPSVTHEPFYPRNPTNERLVGEFDRTTTVATPTQLRWRPADVPLHPGLDFIDGLYTVC  128

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGSS LRHG+AIHMY ANK MD C+ CNADGDFLIVPQ+GRL+ITTECGRL V+PGEIV
Sbjct  129  GAGSSCLRHGYAIHMYAANKPMDGCSLCNADGDFLIVPQQGRLFITTECGRLLVSPGEIV  188

Query  759  VIPQGFRFAVDLPD  800
            VIPQG RFAVDLPD
Sbjct  189  VIPQGLRFAVDLPD  202



>ref|XP_008658059.1| PREDICTED: uncharacterized protein LOC100192757 isoform X1 [Zea 
mays]
Length=488

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +L Y SG GN F+SEA+ G+LP GQN+PLVCPLGLYAEQ+SGTSFT+PR  N  +W Y
Sbjct  9    PPELRYLSGLGNTFTSEAVPGSLPVGQNNPLVCPLGLYAEQLSGTSFTTPRARNLRTWLY  68

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETP-TDFIDGLYTVC  578
            R+KPSVTHEPF PR PT+ERLV EF+++ + ATPTQLRW+P D+P  P  DFIDGLYTVC
Sbjct  69   RIKPSVTHEPFYPRNPTNERLVGEFDRTTTVATPTQLRWRPADVPLHPGLDFIDGLYTVC  128

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGSS LRHG+AIHMY ANK MD C+ CNADGDFLIVPQ+GRL+ITTECGRL V+PGEIV
Sbjct  129  GAGSSCLRHGYAIHMYAANKPMDGCSLCNADGDFLIVPQQGRLFITTECGRLLVSPGEIV  188

Query  759  VIPQGFRFAVDLPD  800
            VIPQG RFAVDLPD
Sbjct  189  VIPQGLRFAVDLPD  202



>ref|XP_008658060.1| PREDICTED: uncharacterized protein LOC100192757 isoform X2 [Zea 
mays]
 gb|AFW86249.1| hypothetical protein ZEAMMB73_295914 [Zea mays]
Length=467

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +L Y SG GN F+SEA+ G+LP GQN+PLVCPLGLYAEQ+SGTSFT+PR  N  +W Y
Sbjct  9    PPELRYLSGLGNTFTSEAVPGSLPVGQNNPLVCPLGLYAEQLSGTSFTTPRARNLRTWLY  68

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETP-TDFIDGLYTVC  578
            R+KPSVTHEPF PR PT+ERLV EF+++ + ATPTQLRW+P D+P  P  DFIDGLYTVC
Sbjct  69   RIKPSVTHEPFYPRNPTNERLVGEFDRTTTVATPTQLRWRPADVPLHPGLDFIDGLYTVC  128

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGSS LRHG+AIHMY ANK MD C+ CNADGDFLIVPQ+GRL+ITTECGRL V+PGEIV
Sbjct  129  GAGSSCLRHGYAIHMYAANKPMDGCSLCNADGDFLIVPQQGRLFITTECGRLLVSPGEIV  188

Query  759  VIPQGFRFAVDLPD  800
            VIPQG RFAVDLPD
Sbjct  189  VIPQGLRFAVDLPD  202



>ref|XP_004964265.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Setaria italica]
Length=454

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 165/191 (86%), Gaps = 2/191 (1%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
            L Y SG GN FSSEA+AG+LP GQNSPLVCPLGLYAEQ+SGTSFT+PR  N  +W YR+K
Sbjct  12   LRYLSGLGNSFSSEAVAGSLPVGQNSPLVCPLGLYAEQLSGTSFTTPRASNLRTWLYRIK  71

Query  411  PSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP-ETPTDFIDGLYTVCGAG  587
            PSVTHEPF PR     RLV EF+++ + ATPTQLRW+P ++P + P DFIDGLYTVCGAG
Sbjct  72   PSVTHEPFHPR-EDKGRLVGEFDRATTVATPTQLRWRPTEVPLDRPLDFIDGLYTVCGAG  130

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            S++LRHG+AIHMY ANKSMD CAFCNADGDFLIVPQ+GRL+ITTECG++ V+PGEIVVIP
Sbjct  131  SAFLRHGYAIHMYAANKSMDGCAFCNADGDFLIVPQQGRLFITTECGKMLVSPGEIVVIP  190

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  191  QGFRFAVDLPD  201



>ref|NP_001056540.1| Os06g0103300 [Oryza sativa Japonica Group]
 sp|Q5VRH4.1|HGD_ORYSJ RecName: Full=Homogentisate 1,2-dioxygenase; AltName: Full=Homogentisate 
oxygenase; AltName: Full=Homogentisic acid oxidase; 
AltName: Full=Homogentisicase [Oryza sativa Japonica Group]
 dbj|BAD67951.1| putative homogentisate 1,2-dioxygenase [Oryza sativa Japonica 
Group]
 dbj|BAF18454.1| Os06g0103300 [Oryza sativa Japonica Group]
 gb|EEE64940.1| hypothetical protein OsJ_19811 [Oryza sativa Japonica Group]
Length=470

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 158/192 (82%), Gaps = 4/192 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y SG GN  SSEA+AG LPRGQNSPLVCPLGLYAEQ+SGT FT+PR  N  +W YR+KPS
Sbjct  24   YLSGLGNSLSSEAVAGTLPRGQNSPLVCPLGLYAEQLSGTPFTAPRARNLRTWLYRIKPS  83

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPT--QLRWKPVDIP--ETPTDFIDGLYTVCGA  584
            VTHEPF PR P H RL+ +F+++ +    T  QLRW+P D+P    P DFIDGLYTVCGA
Sbjct  84   VTHEPFHPRRPAHPRLIGDFDRTTTDTVATPTQLRWRPADVPPHHPPLDFIDGLYTVCGA  143

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMY ANKSMD CAFCNADGDFLIVPQ+G+L ITTECG+L V PGEIVVI
Sbjct  144  GSSFLRHGYAIHMYAANKSMDGCAFCNADGDFLIVPQQGKLLITTECGKLLVPPGEIVVI  203

Query  765  PQGFRFAVDLPD  800
            PQGFRFAVDLPD
Sbjct  204  PQGFRFAVDLPD  215



>gb|EEC79822.1| hypothetical protein OsI_21275 [Oryza sativa Indica Group]
Length=470

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 158/192 (82%), Gaps = 4/192 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y SG GN  SSEA+AG LPRGQNSPLVCPLGLYAEQ+SGT FT+PR  N  +W YR+KPS
Sbjct  24   YLSGLGNSLSSEAVAGTLPRGQNSPLVCPLGLYAEQLSGTPFTAPRARNLRTWLYRIKPS  83

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPT--QLRWKPVDIP--ETPTDFIDGLYTVCGA  584
            VTHEPF PR P H RL+ +F+++ +    T  QLRW+P D+P    P DFIDGLYTVCGA
Sbjct  84   VTHEPFHPRRPAHPRLIGDFDRTTTDTVATPTQLRWRPADVPPHHPPLDFIDGLYTVCGA  143

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GSS+LRHG+AIHMY ANKSMD CAFCNADGDFLIVPQ+G+L ITTECG+L V PGEIVVI
Sbjct  144  GSSFLRHGYAIHMYAANKSMDGCAFCNADGDFLIVPQQGKLLITTECGKLLVPPGEIVVI  203

Query  765  PQGFRFAVDLPD  800
            PQGFRFAVDLPD
Sbjct  204  PQGFRFAVDLPD  215



>ref|XP_001771978.1| predicted protein [Physcomitrella patens]
 gb|EDQ63239.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            +L+YQ GF NHFS+E + GALP GQNSPL CP GLYAEQISGT+FT PR  NQ SW YRV
Sbjct  6    ELDYQRGFCNHFSTEVLKGALPVGQNSPLKCPYGLYAEQISGTAFTVPRNHNQRSWLYRV  65

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQ-SNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            KPSVTHEPF PR PT+ERLVS+F+  S +S TPTQLRWKP  +PE  T+FIDGLYT+CG+
Sbjct  66   KPSVTHEPFHPREPTNERLVSDFSSTSAASVTPTQLRWKPPHVPEAETNFIDGLYTICGS  125

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GS +LRHG+++HMYTAN SM+ CAF NADGD LIVPQ GRLWI TE GR+QV PGEIVV+
Sbjct  126  GSPFLRHGYSVHMYTANTSMEGCAFANADGDLLIVPQLGRLWIKTEMGRIQVKPGEIVVV  185

Query  765  PQGFRFAVDLPD  800
              G RFAV+LPD
Sbjct  186  QLGIRFAVELPD  197



>ref|XP_003557280.1| PREDICTED: homogentisate 1,2-dioxygenase [Brachypodium distachyon]
Length=480

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y SG GN FSSEA+ G+LP  QNSPL+CPLGLYAEQ+SGTSFT+PR  N  +W YR+KPS
Sbjct  31   YLSGLGNTFSSEAVPGSLPASQNSPLLCPLGLYAEQLSGTSFTTPRHRNLRTWMYRIKPS  90

Query  417  VTHEPFKPRVPTHERLVSEFN-QSNSSATPTQLRWKPVDIPETPT--DFIDGLYTVCGAG  587
            VTHEPF PR P + RLV +F+ ++ + ATPTQLRW P ++P  P   DF+DGLYTVCGAG
Sbjct  91   VTHEPFHPRDPANRRLVGDFDDRATTVATPTQLRWSPPEVPPAPMQLDFVDGLYTVCGAG  150

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            SS+LRHGFAIHMY ANKSMD  AFCNADGDFLIVPQ+G+L ITTECG+L V PGEIVVIP
Sbjct  151  SSFLRHGFAIHMYAANKSMDGSAFCNADGDFLIVPQQGKLLITTECGKLLVPPGEIVVIP  210

Query  768  QGFRFAVDLPD  800
            QGFRFAVDLPD
Sbjct  211  QGFRFAVDLPD  221



>gb|KHN36399.1| Homogentisate 1,2-dioxygenase [Glycine soja]
Length=487

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +3

Query  315  VCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSS  494
            V PLGLYAEQISGTSFTSPR  N  SWFYR+KPSVTHEPFKPRVP + R++SEFN SNSS
Sbjct  70   VRPLGLYAEQISGTSFTSPRNRNLFSWFYRIKPSVTHEPFKPRVPGNGRILSEFNNSNSS  129

Query  495  ATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADG  674
            A PTQLRWKP+D P++PTDFIDGL TVCG+GSS++RHG+AIHMYTANKSMDNCAFCNADG
Sbjct  130  ANPTQLRWKPLDAPDSPTDFIDGLSTVCGSGSSFMRHGYAIHMYTANKSMDNCAFCNADG  189

Query  675  DFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            DFLIVPQ+GRL +TTECGRL+V+PGEI ++PQGFRF+V+LPD
Sbjct  190  DFLIVPQQGRLLVTTECGRLKVSPGEIAILPQGFRFSVNLPD  231



>ref|XP_009767671.1| PREDICTED: homogentisate 1,2-dioxygenase isoform X1 [Nicotiana 
sylvestris]
Length=404

 Score =   271 bits (693),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +3

Query  390  SWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLY  569
            SW YR+KPSVTHEPF+PR+P HE+LVSEF+QSNSSATPTQLRWKPV+IPETPTDFIDGLY
Sbjct  8    SWLYRIKPSVTHEPFRPRLPRHEKLVSEFDQSNSSATPTQLRWKPVEIPETPTDFIDGLY  67

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+CGAGSSYLRHG+AIHMYTANKSM+NCAFCNADGDFLIVPQ+GRLWITTECGRLQV+PG
Sbjct  68   TICGAGSSYLRHGYAIHMYTANKSMENCAFCNADGDFLIVPQQGRLWITTECGRLQVSPG  127

Query  750  EIVVIPQGFRFAVDLPD  800
            EIV++PQGFRF+VDLPD
Sbjct  128  EIVILPQGFRFSVDLPD  144



>ref|XP_002976165.1| hypothetical protein SELMODRAFT_151052 [Selaginella moellendorffii]
 gb|EFJ23070.1| hypothetical protein SELMODRAFT_151052 [Selaginella moellendorffii]
Length=445

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            +LEYQ GFGNHF SEA+ GALP GQNSPL CP GLYAEQ+SGT+FT+PRK N  SW YR+
Sbjct  10   NLEYQRGFGNHFRSEALQGALPNGQNSPLHCPYGLYAEQLSGTAFTTPRKQNFRSWLYRI  69

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSV HEPF+             ++     TPTQLRWKP++ PE P DF+ GL+TVCGAG
Sbjct  70   KPSVGHEPFQLYSSPSLNFAGVIDKDRFLTTPTQLRWKPLECPEHPRDFVHGLFTVCGAG  129

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            S +LRHG+ IH+Y ANKSM++CA  NADGDFLIVPQ+GRLWI TE G+LQV PGEIVV+ 
Sbjct  130  SPFLRHGYMIHIYVANKSMEDCALANADGDFLIVPQQGRLWIKTEFGKLQVCPGEIVVLQ  189

Query  768  QGFRFAVDLPD  800
             G RFA++LPD
Sbjct  190  LGMRFAIELPD  200



>ref|XP_002968212.1| hypothetical protein SELMODRAFT_267178 [Selaginella moellendorffii]
 gb|EFJ30466.1| hypothetical protein SELMODRAFT_267178 [Selaginella moellendorffii]
Length=445

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 147/191 (77%), Gaps = 0/191 (0%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            +LEYQ GFGNHF SEA+ GALP GQNSPL CP GLYAEQ+SGT+FT+PRK N  SW YR+
Sbjct  10   NLEYQRGFGNHFRSEALQGALPNGQNSPLHCPYGLYAEQLSGTAFTTPRKQNFRSWLYRI  69

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            KPSV HEPF+             ++     TPTQLRWKP++ PE P DF+ GL+T+CGAG
Sbjct  70   KPSVGHEPFQLYSSPSLNFAGVIDKDRFLTTPTQLRWKPLECPEHPRDFVHGLFTMCGAG  129

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
            S +LRHG+ IH+Y ANKSM++CA  NADGDFLIVPQ+GRLWI TE G+LQV PGEIVV+ 
Sbjct  130  SPFLRHGYMIHIYVANKSMEDCALANADGDFLIVPQQGRLWIKTEFGKLQVCPGEIVVLQ  189

Query  768  QGFRFAVDLPD  800
             G RFA++LPD
Sbjct  190  LGMRFAIELPD  200



>gb|ACL52727.1| unknown [Zea mays]
 gb|AFW86247.1| hypothetical protein ZEAMMB73_295914 [Zea mays]
Length=422

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = +3

Query  333  YAEQISGTSFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQL  512
            Y   +  TSFT+PR  N  +W YR+KPSVTHEPF PR PT+ERLV EF+++ + ATPTQL
Sbjct  14   YLSGLGNTSFTTPRARNLRTWLYRIKPSVTHEPFYPRNPTNERLVGEFDRTTTVATPTQL  73

Query  513  RWKPVDIPETP-TDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIV  689
            RW+P D+P  P  DFIDGLYTVCGAGSS LRHG+AIHMY ANK MD C+ CNADGDFLIV
Sbjct  74   RWRPADVPLHPGLDFIDGLYTVCGAGSSCLRHGYAIHMYAANKPMDGCSLCNADGDFLIV  133

Query  690  PQKGRLWITTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            PQ+GRL+ITTECGRL V+PGEIVVIPQG RFAVDLPD
Sbjct  134  PQQGRLFITTECGRLLVSPGEIVVIPQGLRFAVDLPD  170



>gb|KFH72353.1| homogentisate 1,2-dioxygenase [Mortierella verticillata NRRL 
6337]
Length=446

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 145/192 (76%), Gaps = 2/192 (1%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D +YQ GFGNHFSSEA+  ALP+GQN+P +CP GLYAEQ+SGT+FT  RK N+ +WFYR+
Sbjct  7    DYKYQPGFGNHFSSEALPDALPKGQNTPQLCPYGLYAEQLSGTAFTVDRKHNERTWFYRI  66

Query  408  KPSVTHEPFKPRVPTHERLVSEF-NQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +PSV H PF+   PT  RLVS + + +N S TP QLRW P DIP  PTDF+ GL ++ GA
Sbjct  67   RPSVCHTPFE-AYPTKTRLVSNYSDTANVSVTPNQLRWSPFDIPTEPTDFVQGLTSIAGA  125

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G   ++HG ++ +Y ANKSM + AF N+DGDFLIVPQ+GRL ITTE G++ V+P EI VI
Sbjct  126  GDVGVKHGMSVLIYAANKSMVDTAFYNSDGDFLIVPQQGRLDITTEFGKILVHPNEICVI  185

Query  765  PQGFRFAVDLPD  800
             +G RF+V LPD
Sbjct  186  QRGIRFSVALPD  197



>ref|XP_005850038.1| hypothetical protein CHLNCDRAFT_142029 [Chlorella variabilis]
 gb|EFN57936.1| hypothetical protein CHLNCDRAFT_142029 [Chlorella variabilis]
Length=475

 Score =   235 bits (599),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = +3

Query  201  VTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKL  380
             +G  + P  L Y SGFGN  +SEA+ GALP GQN+P +CP GLYAEQ+SGT+FT+PR  
Sbjct  3    TSGLEEAPEALRYLSGFGNEATSEALPGALPVGQNNPRICPYGLYAEQLSGTAFTAPRAQ  62

Query  381  NQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFID  560
            N+ SW YR++PSVTHEPF P     E L ++F  S    TP QLRW+P  IPE   DF+ 
Sbjct  63   NRRSWLYRIRPSVTHEPFHPLNFPAETLTADF--SRGVVTPNQLRWRPFAIPEDKVDFVT  120

Query  561  GLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQV  740
            GL+T+CG+GS+  + GFAIHMYT + SM +    NADGDFLIVPQ G L+ITTE GR+ V
Sbjct  121  GLFTICGSGSATCKDGFAIHMYTCSASMGDSCLANADGDFLIVPQLGGLFITTEFGRMHV  180

Query  741  NPGEIVVIPQGFRFAVDLPD  800
             PGEI VI +G RF+V LPD
Sbjct  181  APGEICVIQRGMRFSVALPD  200



>gb|EMS52126.1| Homogentisate 1,2-dioxygenase [Triticum urartu]
Length=420

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 132/161 (82%), Gaps = 6/161 (4%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALP-RGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKP  413
            Y SG GN F+SEA+ GALP  G NSPL+CPLGLYAEQ+SGTSFT+PR  N  +W YR+KP
Sbjct  18   YLSGLGNSFASEAVPGALPANGHNSPLLCPLGLYAEQLSGTSFTTPRHRNLRTWMYRIKP  77

Query  414  SVTHEPFKPRVPTHERLVSEFNQSNSS-ATPTQLRWKPVDIP----ETPTDFIDGLYTVC  578
            SVTH+PF PR P + RL+++F+  N++ ATPTQLRW+P D+P    +   DF+DGLYTVC
Sbjct  78   SVTHDPFHPRTPPNPRLLADFHDPNAAVATPTQLRWRPADLPPRDADADLDFVDGLYTVC  137

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKG  701
            GAGSS+LRHGFA+HMY ANKSMD CAFCNADGDFLIVPQ+G
Sbjct  138  GAGSSFLRHGFAVHMYAANKSMDGCAFCNADGDFLIVPQQG  178



>ref|XP_002112959.1| hypothetical protein TRIADDRAFT_56615 [Trichoplax adhaerens]
 gb|EDV25069.1| hypothetical protein TRIADDRAFT_56615 [Trichoplax adhaerens]
Length=436

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 133/192 (69%), Gaps = 6/192 (3%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            +++EY SGFGN FSSEA+  ALP+GQNSP  CP GLYAEQISGT+FT PR+ NQ SW YR
Sbjct  2    SEMEYLSGFGNEFSSEALPDALPKGQNSPQKCPYGLYAEQISGTAFTCPRETNQRSWLYR  61

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP--ETPTDFIDGLYTVC  578
            + PSV HEPFK      ER     +       P QLRWKP D+P  +   DF+ GL TVC
Sbjct  62   IHPSVQHEPFK----AMERGNLSHDWDEQHPNPNQLRWKPFDLPSNDQEIDFVQGLATVC  117

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAGS   R+G AIH+Y  NKSM N  F N+DGDFLIVPQKG+L ITTE G+L VNP EI 
Sbjct  118  GAGSPRERNGTAIHIYACNKSMTNRCFYNSDGDFLIVPQKGKLRITTEFGKLDVNPNEIC  177

Query  759  VIPQGFRFAVDL  794
            VI  G RF+V +
Sbjct  178  VIQHGIRFSVAI  189



>emb|CEG67707.1| Putative Homogentisate 1,2-dioxygenase [Rhizopus microsporus]
Length=455

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 135/196 (69%), Gaps = 9/196 (5%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D EY SGFGNHFSSEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ SW YR+
Sbjct  3    DYEYLSGFGNHFSSEALPDALPKGQNTPQKCPYNLYAEQLSGTAFTVPRTHNQRSWLYRI  62

Query  408  KPSVTHEPFKPRVPTHER---LVSEFNQSNSSATPTQLRWKPVDIP--ETPTDFIDGLYT  572
            +PSV H+PFKP    HE    LVS++   +   TPTQ+RW P D+P      +F+ GL +
Sbjct  63   RPSVVHQPFKP----HEEPTLLVSKYGGDDVLITPTQIRWSPFDLPADNEKINFVQGLKS  118

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + GAG    R G A+H+YTAN  M   AF NADGDFLIVPQ+G L I TE G+++  P E
Sbjct  119  LAGAGDPACRSGLAVHVYTANTDMGKSAFYNADGDFLIVPQQGTLDIYTEFGKIKAEPNE  178

Query  753  IVVIPQGFRFAVDLPD  800
            IVVI +G RF+V LPD
Sbjct  179  IVVIQRGIRFSVSLPD  194



>emb|CEI91034.1| Putative Homogentisate 1,2-dioxygenase [Rhizopus microsporus]
Length=439

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 135/196 (69%), Gaps = 9/196 (5%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D EY SGFGNHFSSEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ SW YR+
Sbjct  3    DYEYLSGFGNHFSSEALPDALPKGQNTPQKCPYNLYAEQLSGTAFTVPRTHNQRSWLYRI  62

Query  408  KPSVTHEPFKPRVPTHER---LVSEFNQSNSSATPTQLRWKPVDIP--ETPTDFIDGLYT  572
            +PSV H+PFKP    HE    LVS++   +   TPTQ+RW P D+P      +F+ GL +
Sbjct  63   RPSVVHQPFKP----HEEPTLLVSKYGGDDVLITPTQIRWSPFDLPADNEKINFVQGLKS  118

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + GAG    R G A+H+YTAN  M   AF NADGDFLIVPQ+G L I TE G+++  P E
Sbjct  119  LAGAGDPACRSGLAVHVYTANTDMGKSAFYNADGDFLIVPQQGTLDIYTEFGKIKAEPNE  178

Query  753  IVVIPQGFRFAVDLPD  800
            IVVI +G RF+V LPD
Sbjct  179  IVVIQRGIRFSVSLPD  194



>emb|CEI96397.1| Putative Homogentisate 1,2-dioxygenase [Rhizopus microsporus]
Length=439

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 135/196 (69%), Gaps = 9/196 (5%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D EY SGFGNHFSSEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ SW YR+
Sbjct  3    DYEYLSGFGNHFSSEALPDALPKGQNTPQKCPYNLYAEQLSGTAFTVPRTHNQRSWLYRI  62

Query  408  KPSVTHEPFKPRVPTHER---LVSEFNQSNSSATPTQLRWKPVDIP--ETPTDFIDGLYT  572
            +PSV H+PFKP    HE    LVS++   +   TPTQ+RW P D+P      +F+ GL +
Sbjct  63   RPSVVHQPFKP----HEEPTLLVSKYGGDDVLITPTQIRWSPFDLPADNEKINFVQGLKS  118

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + GAG    R G A+H+YTAN  M   AF NADGDFLIVPQ+G L I TE G+++  P E
Sbjct  119  LAGAGDPACRSGLAVHVYTANTDMGKSAFYNADGDFLIVPQQGTLDIYTEFGKIKAEPNE  178

Query  753  IVVIPQGFRFAVDLPD  800
            IVVI +G RF+V LPD
Sbjct  179  IVVIQRGIRFSVSLPD  194



>ref|WP_027485279.1| homogentisate 1,2-dioxygenase [Rhodanobacter sp. OR87]
Length=432

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F+SEAI G LP GQNSP     GLYAEQ+SGT+FT+PR LN+ SW YR++P+
Sbjct  9    YQSGFGNEFASEAIPGVLPVGQNSPQRVAHGLYAEQLSGTAFTAPRHLNRRSWLYRIRPA  68

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              HEPF P    HER  + F+++   ATP QLRW P+ +PE PTDF+DGL T+ G G + 
Sbjct  69   AVHEPFAPLA--HERFHNRFDEA--PATPNQLRWDPLPLPEQPTDFVDGLVTIAGNGGAA  124

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+SM    F +ADG+ LIVPQ+GRL + TE G +++ P EI VIP+G 
Sbjct  125  EQGGIGIHLYAANRSMQGRFFYDADGELLIVPQQGRLQLATELGVIELEPQEIAVIPRGV  184

Query  777  RFAVDLPD  800
            RF V+LPD
Sbjct  185  RFRVELPD  192



>ref|WP_015446760.1| homogentisate 1,2-dioxygenase [Rhodanobacter denitrificans]
 gb|AGG87706.1| homogentisate 1,2-dioxygenase [Rhodanobacter denitrificans]
Length=432

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F+SEAI G LP GQNSP     GLYAEQ+SGT+FT+PR LN+ SW YR++P+
Sbjct  9    YQSGFGNEFASEAIPGVLPVGQNSPQRVTHGLYAEQLSGTAFTAPRHLNRRSWLYRIRPA  68

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              HEPF P    HER  + F+++   ATP QLRW P+ +PE PTDF+DGL T+ G G + 
Sbjct  69   AVHEPFAPLA--HERFHNRFDEA--PATPNQLRWDPLPLPEQPTDFVDGLVTIAGNGGAA  124

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+SM    F +ADG+ LIVPQ+GRL + TE G +++ P EI VIP+G 
Sbjct  125  EQGGIGIHLYAANRSMQGRFFYDADGELLIVPQQGRLQLATELGVIELEPQEIAVIPRGV  184

Query  777  RFAVDLPD  800
            RF V+LPD
Sbjct  185  RFRVELPD  192



>ref|WP_007512560.1| homogentisate 1,2-dioxygenase [Rhodanobacter denitrificans]
 gb|EIM00649.1| homogentisate 1,2-dioxygenase [Rhodanobacter denitrificans]
Length=432

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F+SEAI G LP GQNSP     GLYAEQ+SGT+FT+PR LN+ SW YR++P+
Sbjct  9    YQSGFGNEFASEAIPGVLPVGQNSPQRVAHGLYAEQLSGTAFTAPRHLNRRSWLYRIRPA  68

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF+P    H    + F+++   ATP QLRW P+ +PE PTDF+DGL T+ G G + 
Sbjct  69   AVHQPFQPLA--HATFHNRFDEA--PATPNQLRWDPLPLPEQPTDFLDGLVTIAGNGGAA  124

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+SM    FCNADG+ LIVPQ+GRL + TE G +++ P EI VIP+G 
Sbjct  125  EQGGIGIHLYVANRSMQGRFFCNADGELLIVPQQGRLQLATELGVIELEPQEIAVIPRGV  184

Query  777  RFAVDLPD  800
            RF V+LPD
Sbjct  185  RFRVELPD  192



>ref|WP_011351095.1| homogentisate 1,2-dioxygenase [Burkholderia lata]
 sp|Q39J54.1|HGD_BURS3 RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
lata]
 gb|ABB07512.1| homogentisate 1,2-dioxygenase [Burkholderia lata]
Length=444

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 139/195 (71%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA+  YQSGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PANAGYQSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFGDSADVPPTPPDQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GR++V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRVEVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVTLPD  201



>ref|WP_034194472.1| homogentisate 1,2-dioxygenase [Burkholderia sp. WP42]
Length=444

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGFGN F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFGNEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLV+EF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FTGRQRLVAEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPAEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|XP_002946381.1| hypothetical protein VOLCADRAFT_102970 [Volvox carteri f. nagariensis]
 gb|EFJ52308.1| hypothetical protein VOLCADRAFT_102970 [Volvox carteri f. nagariensis]
Length=874

 Score =   225 bits (574),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
            LEYQ GFGN   SEA+ GALP GQN+P  CP GLYAEQ+SGT FT+PR  N+ SW YR++
Sbjct  9    LEYQPGFGNELCSEALPGALPHGQNNPKACPYGLYAEQLSGTHFTAPRAANRRSWLYRIR  68

Query  411  PSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGS  590
            PSVTHEPF P    +E L ++F  S  + TP QLRW+P  +P  P D++ GL+T+CG+G 
Sbjct  69   PSVTHEPFHPINFPNESLTADF--SAGAVTPNQLRWRPFPVPSEPVDWVRGLFTLCGSGR  126

Query  591  SYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQ  770
            +  + GFAIHMY A +SM   +  NADGD L+VP++G L + TE G L V PGEI V+P+
Sbjct  127  ASSKEGFAIHMYVATESMTTSSLTNADGDMLLVPEQGALRLKTEFGLLDVAPGEIAVLPR  186

Query  771  GFRFAVDL  794
            G RFAV+L
Sbjct  187  GVRFAVEL  194



>gb|EPB86322.1| homogentisate 1,2-dioxygenase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=442

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 132/193 (68%), Gaps = 2/193 (1%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D EYQ GFGNHFSSEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ SW YR+
Sbjct  6    DYEYQEGFGNHFSSEALKDALPKGQNTPQKCPYNLYAEQLSGTAFTVPRTHNQRSWLYRI  65

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPET--PTDFIDGLYTVCG  581
            +PSV H PF      ++ LVS+F   +   TPTQ+RW P D+P +    +F+ GL ++ G
Sbjct  66   RPSVVHTPFARNKSVNDLLVSKFGGEDILITPTQIRWSPFDLPASGEKVNFVQGLKSLAG  125

Query  582  AGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVV  761
            AG    R G  IH+Y+AN  M   AF N+DGDFLIVPQ+G L I TE G+++V P EI V
Sbjct  126  AGDPACRSGLGIHIYSANTDMGKTAFYNSDGDFLIVPQQGTLDIFTEFGKMKVAPNEIAV  185

Query  762  IPQGFRFAVDLPD  800
            I +G R++V LPD
Sbjct  186  IQRGVRYSVSLPD  198



>ref|WP_006484957.1| MULTISPECIES: homogentisate 1,2-dioxygenase [Burkholderia cepacia 
complex]
 sp|B4ECX5.1|HGD_BURCJ RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
cenocepacia J2315]
 emb|CAR53507.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia J2315]
 gb|ERI26841.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia BC7]
 gb|KIS49296.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
Length=444

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_006494039.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 gb|EPZ85660.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia K56-2Valvano]
Length=444

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_036055529.1| MULTISPECIES: homogentisate 1,2-dioxygenase [Burkholderia]
 gb|KGC13029.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AJW95562.1| homogentisate 1,2-dioxygenase [Burkholderia gladioli]
Length=445

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 4/196 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQ GF NHF+SEA+ GALP  QNSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGETAYQPGFANHFASEALPGALPAAQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPT---QLRWKPVDIPETPTDFIDGLYT  572
            R++P+  H PF+P +P    LV+EF   ++   PT   QLRW P+ IP  PTDF+DG  T
Sbjct  68   RIRPAAVHRPFEP-LPRPLALVAEFGAESAEVPPTPPNQLRWDPLPIPTEPTDFVDGWVT  126

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + G GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P +
Sbjct  127  MAGNGSAAAMNGCAIHLYAANRSMRERFFYSADGELLIVPQQGRLFIATELGRLDVEPQQ  186

Query  753  IVVIPQGFRFAVDLPD  800
            I VIP+G RF V LPD
Sbjct  187  IAVIPRGVRFTVALPD  202



>ref|WP_006496705.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 emb|CCE49994.1| Homogentisate 1,2-dioxygenase [Burkholderia cenocepacia H111]
 emb|CDN59196.1| Homogentisate 1,2-dioxygenase [Burkholderia cenocepacia H111]
Length=444

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>gb|KGY59076.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
Length=444

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_011544695.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 sp|Q1BYQ6.1|HGD_BURCA RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
cenocepacia AU 1054]
 sp|A0K4Z6.1|HGD_BURCH RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
cenocepacia HI2424]
 gb|ABF75249.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia AU 1054]
 gb|ABK07573.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia HI2424]
Length=444

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_027807440.1| MULTISPECIES: homogentisate 1,2-dioxygenase [Burkholderia cepacia 
complex]
 gb|AIO48701.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
 gb|KGB97056.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
Length=444

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_013691209.1| homogentisate 1,2-dioxygenase [Burkholderia gladioli]
 gb|AEA64883.1| homogentisate 1,2-dioxygenase [Burkholderia gladioli BSR3]
Length=445

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 4/196 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQ GF NHF+SEA+ GALP  QNSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGETGYQPGFANHFASEALPGALPAAQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPT---QLRWKPVDIPETPTDFIDGLYT  572
            R++P+  H PF+P +P    LV+EF   ++   PT   QLRW P+ IP  PTDF+DG  T
Sbjct  68   RIRPAAVHRPFEP-LPRPLALVAEFGAESAEVPPTPPNQLRWDPLPIPAEPTDFVDGWVT  126

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + G GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P +
Sbjct  127  MAGNGSAAAMNGCAIHLYAANRSMRERFFYSADGELLIVPQQGRLFIATELGRLDVEPQQ  186

Query  753  IVVIPQGFRFAVDLPD  800
            I VIP+G RF V LPD
Sbjct  187  IAVIPRGVRFTVALPD  202



>ref|WP_011883439.1| homogentisate 1,2-dioxygenase [Burkholderia vietnamiensis]
 sp|A4JBW6.1|HGD_BURVG RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
vietnamiensis G4]
 gb|ABO53769.1| homogentisate 1,2-dioxygenase [Burkholderia vietnamiensis G4]
 gb|AJY06374.1| homogentisate 1,2-dioxygenase [Burkholderia vietnamiensis LMG 
10929]
Length=444

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGFGN F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ +W Y
Sbjct  8    PATAGYLSGFGNEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRAWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLV+EF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FTGRQRLVAEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPAEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_025097774.1| homogentisate 1,2-dioxygenase [Burkholderia sp. A1]
Length=445

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 4/196 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQ GF NHF+SEA+ GALP  QNSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGETGYQPGFANHFASEALPGALPAAQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPT---QLRWKPVDIPETPTDFIDGLYT  572
            R++P+  H PF+P +P    LV+EF   ++   PT   QLRW P+ IP  PTDF+DG  T
Sbjct  68   RIRPAAVHRPFEP-LPRPLALVAEFGAESAEVPPTPPNQLRWDPLPIPAEPTDFVDGWVT  126

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + G GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P +
Sbjct  127  MAGNGSAAAMNGCAIHLYAANRSMRERFFYSADGELLIVPQQGRLFIATELGRLDVEPQQ  186

Query  753  IVVIPQGFRFAVDLPD  800
            I VIP+G RF V LPD
Sbjct  187  IAVIPRGVRFTVALPD  202



>ref|WP_036034387.1| homogentisate 1,2-dioxygenase [Burkholderia gladioli]
 gb|KGE09323.1| homogentisate 1,2-dioxygenase [Burkholderia gladioli]
Length=445

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 4/196 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQ GF NHF+SEA+ GALP  QNSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGETGYQPGFANHFASEALPGALPAAQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPT---QLRWKPVDIPETPTDFIDGLYT  572
            R++P+  H PF+P +P    LV+EF   ++   PT   QLRW P+ IP  PTDF+DG  T
Sbjct  68   RIRPAAVHRPFEP-LPRPLALVAEFGAESAEVPPTPPNQLRWDPLPIPTEPTDFVDGWVT  126

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + G GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P +
Sbjct  127  MAGNGSAAAMNGCAIHLYAANRSMRERFFYSADGELLIVPQQGRLFIATELGRLDVEPQQ  186

Query  753  IVVIPQGFRFAVDLPD  800
            I VIP+G RF V LPD
Sbjct  187  IAVIPRGVRFTVALPD  202



>ref|WP_039361235.1| homogentisate 1,2-dioxygenase [Mumia flava]
 gb|KHL11365.1| homogentisate 1,2-dioxygenase [Mumia flava]
Length=444

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   YQSGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PAPAGYQSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GR+ V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRVDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVTLPD  201



>ref|WP_020423661.1| homogentisate 1,2-dioxygenase [Cupriavidus sp. WS]
Length=446

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 135/207 (65%), Gaps = 4/207 (2%)
 Frame = +3

Query  180  MESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTS  359
            M     NV   P   A L YQSGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+
Sbjct  1    MTQTQLNVAARPHEAAALAYQSGFANEFATEALPGALPEGRNSPQRAPYGLYAEQLSGTA  60

Query  360  FTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE  539
            FT+PR  N+ SW YR++P+  HEPF P   T  R+VS F+    S  P Q+RW P  +P 
Sbjct  61   FTAPRAHNRRSWCYRIRPAAMHEPFTPLAQT--RIVSRFDAVPPS--PNQMRWSPPPMPS  116

Query  540  TPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITT  719
             PTDFIDG+ T+ G G      G  IH+Y ANKSMD   F NADG+ LIVPQ+GRL + T
Sbjct  117  APTDFIDGIVTMAGNGGPEAMSGCGIHLYLANKSMDGRFFYNADGEMLIVPQQGRLRLAT  176

Query  720  ECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            E G L+V P EIVV+P+G RF V LPD
Sbjct  177  EMGVLEVEPQEIVVVPRGVRFRVALPD  203



>ref|WP_034206535.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
 gb|KGB98872.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
Length=444

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ +W Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRAWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_043189391.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
 gb|KER67186.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
Length=444

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S      +P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFGDSVDVPPTSPNQLRWDPLPMPVDPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|XP_001701781.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06756.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=438

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 132/188 (70%), Gaps = 1/188 (1%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
            L+YQSGFGN FSSEA+ GALP+ QN+P  CP GLYAEQ+SGT FT+PR LN+ SW YR++
Sbjct  9    LQYQSGFGNEFSSEALPGALPQTQNNPKTCPYGLYAEQLSGTHFTAPRVLNRRSWLYRIR  68

Query  411  PSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGS  590
            PS T    +  +P     V   + +  + TP QLRW+P  +P  P D++ GL+T+CG G 
Sbjct  69   PSHTSVRMEEHLPASSATVRRVD-TPCTVTPNQLRWRPFPVPSEPVDWVRGLFTLCGTGK  127

Query  591  SYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQ  770
            +  + GFAIH+YT N+SMD  A  NADGDFLIVPQ+G L + TE G L V PGEI V+P+
Sbjct  128  AATKEGFAIHVYTCNQSMDTSALANADGDFLIVPQQGALRLKTELGLLDVAPGEIAVVPR  187

Query  771  GFRFAVDL  794
            G RF+V L
Sbjct  188  GVRFSVVL  195



>ref|WP_017919300.1| homogentisate 1,2-dioxygenase [Burkholderia gladioli]
Length=445

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 4/196 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQ GF NHF+SEA+ GALP  QNSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGETGYQPGFANHFASEALPGALPAAQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPT---QLRWKPVDIPETPTDFIDGLYT  572
            R++P+  H PF+P +P    LV+EF   ++   PT   QLRW P+ IP  PTDF+DG  T
Sbjct  68   RIRPAAVHRPFEP-LPRPLALVAEFGAESAEVPPTPPNQLRWDPLPIPTEPTDFVDGWVT  126

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            + G GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P +
Sbjct  127  MAGNGSAAAMNGCAIHLYAANRSMRVRFFYSADGELLIVPQQGRLFIATELGRLDVEPQQ  186

Query  753  IVVIPQGFRFAVDLPD  800
            I VIP+G RF V LPD
Sbjct  187  IAVIPRGVRFTVALPD  202



>ref|WP_006476781.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 gb|EAY62695.1| Homogentisate 1,2-dioxygenase [Burkholderia cenocepacia PC184]
Length=444

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_027491633.1| homogentisate 1,2-dioxygenase [Rhodanobacter sp. OR444]
Length=449

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 132/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F+SEAI G LP GQNSP     GLYAEQ+SGT+FT+PR LN+ SW YR++P+
Sbjct  9    YQSGFGNEFASEAIPGVLPVGQNSPQRVAHGLYAEQLSGTAFTAPRHLNRRSWLYRIRPA  68

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              HEPF P    H    + F+++   ATP QLRW P   PE PTDF+DGL T+ G G + 
Sbjct  69   AVHEPFVPL--AHATFHNRFDEA--PATPNQLRWDPWPSPERPTDFLDGLVTIAGNGGAA  124

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+SM    FCNADG+ LIVPQ+GRL +TTE G +++ P EI VIP+G 
Sbjct  125  EQGGIGIHLYAANRSMQGRFFCNADGELLIVPQQGRLHLTTELGVVEIEPQEIAVIPRGV  184

Query  777  RFAVDLPD  800
            RF V+LP+
Sbjct  185  RFRVELPE  192



>ref|WP_027783661.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
Length=444

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_014897945.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
 gb|AFQ49107.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia GG4]
Length=444

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGFGN F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PASAGYLSGFGNEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++G+ T+
Sbjct  68   RIRPAAVHRPFEP-FTGPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGMVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_012363191.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria]
 sp|B1YTZ1.1|HGD_BURA4 RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
ambifaria MC40-6]
 gb|ACB63214.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria MC40-6]
Length=444

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P V   +RLVSEF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-VTGPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_014722517.1| homogentisate 1,2-dioxygenase [Burkholderia sp. KJ006]
 gb|AFJ85078.1| Homogentisate 1,2-dioxygenase [Burkholderia sp. KJ006]
Length=444

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGFGN F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ +W Y
Sbjct  8    PATAGYLSGFGNEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRAWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLV+EF  S       P QLRW P+ +P  PTD ++GL T+
Sbjct  68   RIRPAAVHRPFEP-FTGRQRLVAEFGDSADVPPTPPNQLRWDPLPMPVEPTDIVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPAEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_027489973.1| homogentisate 1,2-dioxygenase [Rhodanobacter sp. OR92]
Length=432

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F+SEAI G LP GQNSP     GLYAEQ+SGT+FT+PR LN+ SW YR++P+
Sbjct  9    YQSGFGNEFASEAIPGVLPVGQNSPQRVAHGLYAEQLSGTAFTAPRHLNRRSWLYRIRPA  68

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              HEPF+P    H    + F+++   ATP QLRW P+ +PE PTDF+DGL T+ G G + 
Sbjct  69   AVHEPFQPLA--HATFHNRFDEA--PATPNQLRWDPLPLPEQPTDFLDGLVTIAGNGGAA  124

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+SM    F +ADG+ LIVPQ+GRL + TE G +++ P EI VIP+G 
Sbjct  125  EQGGIGIHLYAANRSMQGRFFYDADGELLIVPQQGRLQLATELGVIELEPQEIAVIPRGV  184

Query  777  RFAVDLPD  800
            RF V+LPD
Sbjct  185  RFRVELPD  192



>ref|WP_027788251.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia]
 gb|AIO22950.1| homogentisate 1,2-dioxygenase [Burkholderia cepacia ATCC 25416]
Length=444

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA+  Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PANAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_039323316.1| homogentisate 1,2-dioxygenase [Burkholderia sp. A9]
 gb|KHK54507.1| homogentisate 1,2-dioxygenase [Burkholderia sp. A9]
Length=444

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGFGN F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFGNEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++G+ T+
Sbjct  68   RIRPAAVHRPFEP-FTGPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGMVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_021157150.1| Homogentisate 1,2-dioxygenase [Burkholderia sp. AU4i]
 gb|ERJ40522.1| Homogentisate 1,2-dioxygenase [Burkholderia sp. AU4i]
Length=444

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA+  Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PANAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_031399556.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSh1]
 gb|KFG96289.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSh1]
Length=444

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DG+ T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFADSTDVPPTPPNQLRWDPLPMPVEPTDFVDGMVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_034197444.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSh2]
 gb|KEZ06402.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSh2]
Length=444

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+DG+ T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFADSADVPPTPPNQLRWDPLPMPVEPTDFVDGMVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>dbj|GAN08115.1| homogentisate 1,2-dioxygenase HgmA [Mucor ambiguus]
Length=442

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 130/193 (67%), Gaps = 2/193 (1%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D EY  GFGNHFSSEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ SW YR+
Sbjct  6    DYEYHEGFGNHFSSEALKDALPKGQNTPQKCPYNLYAEQLSGTAFTVPRTHNQRSWLYRI  65

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE--TPTDFIDGLYTVCG  581
            +PSV H PF      ++ LVS+F   +   TPTQ+RW P D+P   +  +F+ GL ++ G
Sbjct  66   RPSVVHTPFTRNKSVNDLLVSKFGGEDILITPTQIRWSPFDLPAAGSKINFVQGLKSLAG  125

Query  582  AGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVV  761
            AG    R G  IH+Y AN  M   AF N+DGDFLIVPQ+G L I TE G+++V P EI V
Sbjct  126  AGDPACRSGLGIHIYAANTDMGKTAFYNSDGDFLIVPQQGVLDIFTEFGKMKVAPNEIAV  185

Query  762  IPQGFRFAVDLPD  800
            I +G R++V LPD
Sbjct  186  IQRGVRYSVSLPD  198



>ref|WP_034187225.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 gb|KEA59781.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
Length=444

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA+  Y SGFGN F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PANAGYLSGFGNEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLV+EF  S       P QLRW P+ +P  PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVAEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL I TE GR+ V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLHIATEFGRVDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             V+P+G RF+V LPD
Sbjct  187  AVVPRGVRFSVALPD  201



>ref|WP_044844108.1| homogentisate 1,2-dioxygenase [Burkholderia sp. USM B20]
 gb|KJE55581.1| homogentisate 1,2-dioxygenase [Burkholderia sp. USM B20]
Length=444

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRSHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FTGPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_006406383.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
 gb|EEE06259.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans CGD2]
 gb|EEE11289.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans CGD2M]
Length=444

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALPRG+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPRGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVS+F  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FAGAQRLVSDFADSADVPPTPPNQLRWNPLPMPSEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF + LPD
Sbjct  187  AVIPRGVRFTIALPD  201



>ref|WP_007808218.1| homogentisate 1,2-dioxygenase [Rhodanobacter spathiphylli]
 gb|EIL92386.1| homogentisate 1,2-dioxygenase [Rhodanobacter spathiphylli B39]
Length=453

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 132/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F+SEAIAG LP GQNSP     GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  9    YQSGFGNEFASEAIAGTLPVGQNSPQRVAHGLYAEQLSGTAFTAPRHSNRRSWLYRIRPA  68

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              HEPF+P    H    + F+++   ATP QLRW P+ +P  PTDFIDGL T+ G G   
Sbjct  69   AVHEPFQPLA--HATFHNRFDEA--PATPNQLRWDPLPLPTQPTDFIDGLVTLAGNGGPA  124

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+YTAN+SM    F +ADG+ LIVPQ+GRL + TE G +++ P EI VIP+G 
Sbjct  125  EQGGIGIHVYTANRSMQGRFFYDADGELLIVPQQGRLRLATELGVIELEPQEIAVIPRGV  184

Query  777  RFAVDLPD  800
            RF VDLPD
Sbjct  185  RFRVDLPD  192



>ref|WP_034182841.1| homogentisate 1,2-dioxygenase [Burkholderia pyrrocinia]
 gb|KFL51235.1| homogentisate 1,2-dioxygenase [Burkholderia pyrrocinia]
Length=444

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF+D L T+
Sbjct  68   RIRPAAVHRPFEPYA-GPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVDALVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_012327989.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 sp|B1JWJ3.1|HGD_BURCC RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
cenocepacia MC0-3]
 gb|ACA89967.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia MC0-3]
Length=444

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +   PTDF+DGL T+
Sbjct  68   RIRPAAVHRPFEPYAGA-QRLVSEFGDSADVPPTPPNQLRWDPLPMLVEPTDFVDGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_036234404.1| MULTISPECIES: homogentisate 1,2-dioxygenase [Methylibium]
 gb|EWS54177.1| Homogentisate 1,2-dioxygenase [Methylibium sp. T29]
 gb|EWS58563.1| Homogentisate 1,2-dioxygenase [Methylibium sp. T29-B]
Length=435

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 133/192 (69%), Gaps = 3/192 (2%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A L YQSGF NHF SEA++GALP G+NSP  CP GLYAEQ S T+FT+PR  N+ SW YR
Sbjct  4    APLRYQSGFANHFESEALSGALPVGRNSPQRCPYGLYAEQFSATAFTAPRADNRRSWLYR  63

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            ++P+  H PF+P      RLVS+F  S  +  P  LRW P+ +P  PTDF+DGL T  G 
Sbjct  64   IRPAAMHAPFEP-YDDGGRLVSDF--STLATPPDPLRWNPLPLPAAPTDFVDGLVTWAGH  120

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G + ++ G AIH+Y A++SM   +FC+ADG+ LIVPQ GR    TE G L+V P EIVVI
Sbjct  121  GDAGVQAGAAIHLYAADRSMQQRSFCSADGELLIVPQLGRHRFVTELGVLEVEPQEIVVI  180

Query  765  PQGFRFAVDLPD  800
            P+G RF V+LPD
Sbjct  181  PRGLRFRVELPD  192



>ref|WP_011656087.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria]
 sp|Q0BHW3.1|HGD_BURCM RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
ambifaria AMMD]
 gb|ABI86260.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria AMMD]
 gb|AJY22073.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria AMMD]
Length=444

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FTGPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_006752389.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria]
 gb|EDT03255.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria IOP40-10]
Length=444

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FTGPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|XP_004354863.1| homogentisate 1,2-dioxygenase [Dictyostelium fasciculatum]
 gb|EGG16463.1| homogentisate 1,2-dioxygenase [Dictyostelium fasciculatum]
Length=443

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 134/194 (69%), Gaps = 6/194 (3%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A  +YQSGFGN F SEA+ GALP+GQN+P  CP+GLYAEQ+SG +FT PR   Q SW YR
Sbjct  6    AKYQYQSGFGNTFESEALKGALPKGQNTPQNCPMGLYAEQLSGNAFTVPRHTQQRSWLYR  65

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
             +PSV H P  P   + + L+ + N  N  A P QLRWKP  IPE   DF+DGL T+CG+
Sbjct  66   TRPSVCHTPLVPY--SKDTLLVDVNHLN--ANPNQLRWKPFPIPERSHDFVDGLVTICGS  121

Query  585  GSSYLRHGFAIHMYTANKSM--DNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            G   +RHG  +H+YTANK M  +  +F N+DGDFLIVPQ+G L I TE G ++V  GEI 
Sbjct  122  GHPSVRHGVVVHIYTANKDMSTERRSFYNSDGDFLIVPQQGTLDIQTEFGYMEVRSGEIC  181

Query  759  VIPQGFRFAVDLPD  800
            VI +G  F+V++PD
Sbjct  182  VIQRGICFSVNIPD  195



>ref|XP_001023386.1| homogentisate 1,2-dioxygenase family protein [Tetrahymena thermophila]
 gb|EAS03141.1| homogentisate 1,2-dioxygenase [Tetrahymena thermophila SB210]
Length=448

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 133/193 (69%), Gaps = 3/193 (2%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
             DL+Y  GFGNHF +EA+ GALP+GQNSP  CP  L AEQ SGT+FT PR  NQ +W Y+
Sbjct  12   TDLKYGEGFGNHFCTEALPGALPKGQNSPQQCPYNLVAEQFSGTAFTVPRASNQRTWLYK  71

Query  405  VKPSVTHEPFKPRVPTHERLVSE--FNQSNSSATPTQLRWKPVDIPET-PTDFIDGLYTV  575
            +KPSV H PFKP  PT  + +     N      TP QLRWKP+   +  P D+++ L TV
Sbjct  72   IKPSVCHTPFKPCDPTKYKYIKNNFLNAEEMHTTPNQLRWKPLPYNKAEPKDWVESLVTV  131

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             GAG   ++ G AI++Y+ANK+M N  F N+DGDFL+VPQ+G L+ITTE G++ V P EI
Sbjct  132  AGAGDPQIKQGIAIYLYSANKNMGNTVFYNSDGDFLVVPQEGTLFITTELGKMTVGPREI  191

Query  756  VVIPQGFRFAVDL  794
             V+P+G +F++DL
Sbjct  192  CVLPRGLKFSIDL  204



>gb|EPZ36041.1| RmlC-like jelly roll fold domain-containing protein [Rozella 
allomycis CSF55]
Length=431

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 134/195 (69%), Gaps = 2/195 (1%)
 Frame = +3

Query  219  FPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            F    +Y SGFGN   SEAI GALP+ QN+P VCP  LYAEQ+SGT+FT+PR  NQ +W 
Sbjct  3    FVDTFKYNSGFGNEHCSEAIVGALPKDQNTPQVCPFNLYAEQLSGTAFTAPRAQNQKTWL  62

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDI-PETPTDFIDGLYTV  575
            YR++PSV+H PF+P   T  ++++ F   N+  TP QLRW P ++  +    F+DGLYT+
Sbjct  63   YRIRPSVSHLPFQP-YSTKSKILATFTSDNTVITPNQLRWSPFELNTQESVSFVDGLYTI  121

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             GAG + L+ G A H+Y AN SM + A+ N+DGDFL VPQ+G + I +E G L V P EI
Sbjct  122  AGAGDASLKSGVAFHVYMANCSMTDSAYQNSDGDFLFVPQEGTIVIQSELGFLTVAPNEI  181

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF++ LP+
Sbjct  182  AVIPRGIRFSISLPE  196



>dbj|BAI76313.1| homogentisate 1,2-dioxygenase [Azospirillum sp. B510]
Length=453

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 145/211 (69%), Gaps = 11/211 (5%)
 Frame = +3

Query  168  IATDMESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQI  347
            +A DM   +D +T SP F     YQSGFGN F++EA+ GALP G+NSP   P GLYAEQI
Sbjct  11   LAPDM--GEDRMT-SPAF----TYQSGFGNEFATEALPGALPVGRNSPQRPPYGLYAEQI  63

Query  348  SGTSFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPV  527
            SGT+FT+PR  N+ SW YR++P+V HEPF+P  P   RL S F++    A PTQLRW P 
Sbjct  64   SGTAFTAPRAHNRRSWLYRIRPAVIHEPFQPMAPG--RLTSRFDEV--PAPPTQLRWNPP  119

Query  528  DIPETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRL  707
             +P+ PTDF+ GL T+ G G    + G  IH+Y AN+SM+   F +ADG+ LIVPQ+GRL
Sbjct  120  PMPDAPTDFVAGLVTMGGNGGPQAQTGCGIHLYAANRSMEGRFFYDADGELLIVPQQGRL  179

Query  708  WITTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
             + TE G L+V P EI ++P+G RF V+LPD
Sbjct  180  RLFTELGVLEVEPQEIALVPRGIRFRVELPD  210



>gb|EXX70685.1| hypothetical protein RirG_085220 [Rhizophagus irregularis DAOM 
197198w]
Length=340

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 132/197 (67%), Gaps = 8/197 (4%)
 Frame = +3

Query  234  EYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKP  413
            +Y  GFGNHFSSEA+  ALP+GQN+P  CP GLYAEQ+SGT+FT  RK NQ SW YR++P
Sbjct  9    KYMKGFGNHFSSEALQDALPKGQNTPQKCPYGLYAEQLSGTAFTVDRKNNQRSWLYRIRP  68

Query  414  SVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPV------DIPETPT--DFIDGLY  569
            SV H+PF         + ++F   +    P Q+RW P       D  +T    DF+ GL+
Sbjct  69   SVCHQPFTKLDSKSHHIANKFGIGDIHHIPNQIRWSPFNKLLLEDNKKTSNDIDFVHGLH  128

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+ GAG   +++G AIH+YTAN +MDN AF N+DGDFLIVPQ GRL I TE G L V   
Sbjct  129  TLAGAGDPTIKNGLAIHIYTANANMDNTAFYNSDGDFLIVPQHGRLDIITEFGCLMVASN  188

Query  750  EIVVIPQGFRFAVDLPD  800
            EIVVIP+G R++++ PD
Sbjct  189  EIVVIPRGIRYSINFPD  205



>ref|WP_006760631.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria]
 gb|EDT39420.1| homogentisate 1,2-dioxygenase [Burkholderia ambifaria MEX-5]
Length=444

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PARAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FTGPQRLVSEFGDSVDVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_041929920.1| homogentisate 1,2-dioxygenase [Methylibium petroleiphilum]
Length=435

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 133/192 (69%), Gaps = 3/192 (2%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A L YQSGF NHF SEA+ GALP G+NSP  CP GLYAEQ S T+FT+PR  N+ SW YR
Sbjct  4    APLRYQSGFANHFESEALPGALPVGRNSPQRCPYGLYAEQFSATAFTAPRADNRRSWLYR  63

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            ++P+  H PF+P      RLVS+F  S  +  P  LRW P+ +P  PTDF+DGL T  G 
Sbjct  64   IRPAAMHAPFEP-YDDGGRLVSDF--STLATPPDPLRWNPLPLPAAPTDFVDGLVTWAGH  120

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G + ++ G A+H+Y A++SM+  +FC+ADG+ LIVPQ GR    TE G L+V P EIVVI
Sbjct  121  GDAGVQAGAAVHLYAADRSMEQRSFCSADGELLIVPQLGRHRFVTELGVLEVEPQEIVVI  180

Query  765  PQGFRFAVDLPD  800
            P+G RF V+LPD
Sbjct  181  PRGLRFRVELPD  192



>emb|CEP10327.1| hypothetical protein [Parasitella parasitica]
Length=447

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 130/191 (68%), Gaps = 2/191 (1%)
 Frame = +3

Query  234  EYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKP  413
            EY  GFGNHF+SEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ +W YR++P
Sbjct  13   EYHQGFGNHFASEALKDALPKGQNTPQKCPYNLYAEQLSGTAFTVPRTHNQRTWLYRIRP  72

Query  414  SVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP--ETPTDFIDGLYTVCGAG  587
            SV H PF      ++ LVS+F   +   TPTQ+RW P D+P  E   +F+ GL ++ GAG
Sbjct  73   SVVHTPFVRNTSVNDLLVSKFGCEDVLITPTQIRWSPFDLPGAEDKINFVQGLKSLAGAG  132

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
                R G  IH+Y+AN  M   AF N+DGDFLIVPQ+G L I TE G+++V P EI VI 
Sbjct  133  DPACRSGLGIHIYSANTDMGKTAFYNSDGDFLIVPQQGTLDIFTEFGKMKVAPNEIAVIQ  192

Query  768  QGFRFAVDLPD  800
            +G R++V LPD
Sbjct  193  RGVRYSVSLPD  203



>gb|ABM93838.1| homogentisate 1,2-dioxygenase [Methylibium petroleiphilum PM1]
Length=443

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 135/198 (68%), Gaps = 3/198 (2%)
 Frame = +3

Query  207  GSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQ  386
            G+    A L YQSGF NHF SEA+ GALP G+NSP  CP GLYAEQ S T+FT+PR  N+
Sbjct  6    GTSMHHAPLRYQSGFANHFESEALPGALPVGRNSPQRCPYGLYAEQFSATAFTAPRADNR  65

Query  387  LSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGL  566
             SW YR++P+  H PF+P      RLVS+F  S  +  P  LRW P+ +P  PTDF+DGL
Sbjct  66   RSWLYRIRPAAMHAPFEP-YDDGGRLVSDF--STLATPPDPLRWNPLPLPAAPTDFVDGL  122

Query  567  YTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNP  746
             T  G G + ++ G A+H+Y A++SM+  +FC+ADG+ LIVPQ GR    TE G L+V P
Sbjct  123  VTWAGHGDAGVQAGAAVHLYAADRSMEQRSFCSADGELLIVPQLGRHRFVTELGVLEVEP  182

Query  747  GEIVVIPQGFRFAVDLPD  800
             EIVVIP+G RF V+LPD
Sbjct  183  QEIVVIPRGLRFRVELPD  200



>ref|WP_012214028.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
 sp|A9AFM6.1|HGD_BURM1 RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
multivorans ATCC 17616]
 gb|ABX16247.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans ATCC 
17616]
 dbj|BAG42638.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans ATCC 
17616]
Length=444

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVS+F  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FAGAQRLVSDFADSADVPPTPPNQLRWNPLPMPSEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIATELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_029907288.1| homogentisate 1,2-dioxygenase [Caulobacter sp. UNC358MFTsu5.1]
Length=427

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 134/190 (71%), Gaps = 5/190 (3%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL YQSGFGNHFSSEA+ GALP GQNSP   P GLYAEQ+SGT+FT+ R  N+ SW YR+
Sbjct  2    DLHYQSGFGNHFSSEAVPGALPLGQNSPQTPPFGLYAEQLSGTAFTAARHENRRSWLYRL  61

Query  408  KPSVTHEPFKPRVPTHERLVS-EFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +PS  H P+ P     +RL S  F+ +  + TP +LRW P+++P  PTDF+DGL T+ G 
Sbjct  62   RPSAGHGPYAPYA--QDRLKSGPFDAA--APTPNRLRWDPMEVPAEPTDFVDGLVTIGGN  117

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G    + G A H+Y AN+SM +  F NADG+ LIVPQ+G L + TE GRL V PGEIVVI
Sbjct  118  GDVATQAGMAAHLYLANRSMIDRVFQNADGELLIVPQQGDLHLVTEFGRLDVAPGEIVVI  177

Query  765  PQGFRFAVDL  794
            P+G RF V++
Sbjct  178  PRGVRFRVEI  187



>ref|WP_006765055.1| homogentisate 1,2-dioxygenase [Burkholderia dolosa]
 gb|EAY69612.1| Homogentisate 1,2-dioxygenase [Burkholderia dolosa AUO158]
 gb|ETP66280.1| homogentisate 1,2-dioxygenase [Burkholderia dolosa PC543]
 gb|AJY13621.1| homogentisate 1,2-dioxygenase [Burkholderia dolosa AU0158]
Length=444

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PASAGYMSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLV+EF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FAGPQRLVAEFGDSADVPPTPPNQLRWNPLPMPTEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMQDRFFYSADGEMLIVPQHGRLFIATEFGRLDVAPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGMRFCVALPD  201



>ref|WP_011486915.1| homogentisate 1,2-dioxygenase [Burkholderia xenovorans]
 gb|ABE29097.1| homogentisate 1,2-dioxygenase [Burkholderia xenovorans LB400]
 gb|AIP33685.1| homogentisate 1,2-dioxygenase [Burkholderia xenovorans LB400]
Length=448

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 144/208 (69%), Gaps = 4/208 (2%)
 Frame = +3

Query  177  DMESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGT  356
            D +++  N   S +   +  YQSGF N F++EA+ GALP G+NSP     GLYAEQ+SGT
Sbjct  2    DTQTRTPNTVSS-RLEIEPGYQSGFANEFATEALPGALPEGRNSPQRVAYGLYAEQVSGT  60

Query  357  SFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP  536
            +FT+PR  N+ SW YR++P+  H+PF P +P+ ERLV+ F +   +  P QLRW P+ +P
Sbjct  61   AFTAPRAHNRRSWLYRIRPAAVHKPFTP-LPS-ERLVANFAEVPPT-PPNQLRWDPLPMP  117

Query  537  ETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWIT  716
              PTDFIDG  T+ G G++    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL I 
Sbjct  118  AEPTDFIDGWVTMAGNGAAESMSGCAIHLYAANRSMQDRFFYSADGELLIVPQEGRLDIA  177

Query  717  TECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            TE GRL+V P EIVVIP+G RFAV LPD
Sbjct  178  TEMGRLEVEPFEIVVIPRGVRFAVSLPD  205



>ref|XP_009824626.1| homogentisate 1,2-dioxygenase [Aphanomyces astaci]
 gb|ETV86154.1| homogentisate 1,2-dioxygenase [Aphanomyces astaci]
Length=452

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 135/191 (71%), Gaps = 6/191 (3%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DLEY  GFGNHF+SE + GALP G N+P  C  GLYAEQ+SGT+FT PRK NQ SW YR+
Sbjct  23   DLEYLPGFGNHFASETLKGALPTGMNNPQKCNYGLYAEQLSGTAFTLPRKSNQRSWLYRI  82

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPET--PTDFIDGLYTVCG  581
             P V HE +K  +P  + +V++F  +N   TP QLRW+P+  P+T    +FI GL+T+ G
Sbjct  83   LPPVVHEQYK-EIPA-KHIVNDF--TNEHITPQQLRWQPMAFPKTSEKVNFIQGLHTMGG  138

Query  582  AGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVV  761
            AG   ++ G AIHMY AN SM + AF N+DGDFLIVPQ G L ITTE G+L V P EIVV
Sbjct  139  AGEPTMKAGLAIHMYAANTSMKDTAFYNSDGDFLIVPQVGALKITTEFGKLHVKPHEIVV  198

Query  762  IPQGFRFAVDL  794
            I +G RF+VDL
Sbjct  199  IQRGIRFSVDL  209



>ref|WP_006401545.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
 gb|EED98102.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans CGD1]
 gb|EJO51549.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans CF2]
 gb|KGC08899.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
 gb|KHS12461.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
 gb|KHS13334.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
Length=444

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVS+F  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FAGAQRLVSDFADSADVPPTPPNQLRWNPLPMPSEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>gb|AIO75777.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
Length=444

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVS+F  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FAGAQRLVSDFADSADVPPTPPNQLRWNPLPMPSEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_043275019.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIV51508.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR1153]
Length=444

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW+P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWEPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|XP_638887.1| homogentisate 1,2-dioxygenase [Dictyostelium discoideum AX4]
 sp|Q54QI4.1|HGD_DICDI RecName: Full=Homogentisate 1,2-dioxygenase; AltName: Full=Homogentisate 
oxygenase; AltName: Full=Homogentisic acid oxidase; 
AltName: Full=Homogentisicase [Dictyostelium discoideum]
 gb|EAL65497.1| homogentisate 1,2-dioxygenase [Dictyostelium discoideum AX4]
Length=432

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D EYQSGFGN F SEAI G LP+G+N+P  CPL LYAEQ+SG +FT+PR   Q SW YR+
Sbjct  7    DYEYQSGFGNSFESEAIKGTLPKGRNAPQNCPLDLYAEQLSGNAFTAPRHTQQRSWLYRI  66

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE-TPTDFIDGLYTVCGA  584
            +PSV H P K   P    LV + N  N    P QLRWKP  I E  P DF++GL T+ GA
Sbjct  67   RPSVCHTPLK---PIDSGLVCDLN--NLHVDPNQLRWKPFPITEDKPHDFVEGLITIAGA  121

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G + +RHG AIH+YTA KSM+N +F N+DGDFLIVPQ+G L I TE G ++V  GEI VI
Sbjct  122  GHASVRHGLAIHIYTATKSMENKSFYNSDGDFLIVPQQGTLDIQTEFGFMKVKSGEICVI  181

Query  765  PQGFRFAVDL  794
             +G  F+V++
Sbjct  182  QRGITFSVNV  191



>ref|XP_001842047.1| homogentisate 1,2-dioxygenase [Culex quinquefasciatus]
 gb|EDS37585.1| homogentisate 1,2-dioxygenase [Culex quinquefasciatus]
Length=436

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 133/196 (68%), Gaps = 14/196 (7%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            A+ +Y SGFG+HFSSE     GALP GQNSP  C  GLYAEQ+SG++FT+PR  N  SW 
Sbjct  2    AEYQYLSGFGSHFSSEDARCPGALPEGQNSPQKCAYGLYAEQLSGSAFTAPRTENVRSWL  61

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNS----SATPTQLRWKPVDIPET--PTDFID  560
            YR++PSV HEPFK         V+ F + N        P Q+RW P D+PET    DF+ 
Sbjct  62   YRIRPSVVHEPFK------SYQVAPFLRGNKWDEQPPNPNQMRWSPFDLPETGEERDFVA  115

Query  561  GLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQV  740
            GL+TVCGAG    RHG A+H+Y  NKSM+N AF N+DGDFLIVPQ+G L ITTE GRL V
Sbjct  116  GLHTVCGAGDVRSRHGLAVHVYLCNKSMENTAFYNSDGDFLIVPQQGPLDITTEFGRLYV  175

Query  741  NPGEIVVIPQGFRFAV  788
             P EI VIPQG RF+V
Sbjct  176  KPNEICVIPQGIRFSV  191



>ref|WP_010106006.1| homogentisate 1,2-dioxygenase [Burkholderia oklahomensis]
 gb|AIO66994.1| homogentisate 1,2-dioxygenase [Burkholderia oklahomensis]
Length=444

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALPR +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPRARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+       R+V++F  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LASGERRIVADFGDSDDVPPTPPNQLRWDPLSMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_038737323.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGX52401.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV32]
Length=444

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF+ S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFSDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>gb|AAG17115.1|AF189237_1 homogentisate 1,2-dioxygenase [Dictyostelium discoideum]
Length=431

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            D EYQSGFGN F SEAI G LP+G+N+P  CPL LYAEQ+SG +FT+PR   Q SW YR+
Sbjct  6    DYEYQSGFGNSFESEAIKGTLPKGRNAPQNCPLDLYAEQLSGNAFTAPRHTQQRSWLYRI  65

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE-TPTDFIDGLYTVCGA  584
            +PSV H P K   P    LV + N  N    P QLRWKP  I E  P DF++GL T+ GA
Sbjct  66   RPSVCHTPLK---PIDSGLVCDLN--NLHVDPNQLRWKPFPITEDKPHDFVEGLITIAGA  120

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G + +RHG AIH+YTA KSM+N +F N+DGDFLIVPQ+G L I TE G ++V  GEI VI
Sbjct  121  GHASVRHGLAIHIYTATKSMENKSFYNSDGDFLIVPQQGTLDIQTEFGFMKVKSGEICVI  180

Query  765  PQGFRFAVDL  794
             +G  F+V++
Sbjct  181  QRGITFSVNV  190



>ref|WP_007179102.1| homogentisate 1,2-dioxygenase [Burkholderia sp. Ch1-1]
 gb|EIF28338.1| homogentisate 1,2-dioxygenase [Burkholderia sp. Ch1-1]
Length=448

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = +3

Query  204  TGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLN  383
            T S +   +  YQSGF N F++EA+ GALP G+NSP     GLYAEQ+SGT+FT+PR  N
Sbjct  10   TASSRLEIEPGYQSGFANEFATEALPGALPEGRNSPQRVAYGLYAEQVSGTAFTAPRAHN  69

Query  384  QLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDG  563
            + SW YR++P+  H+PF P +P+ ERLV+ F +   +  P QLRW P+ +P  PTDFIDG
Sbjct  70   RRSWLYRIRPAAVHKPFTP-LPS-ERLVANFAEVPPT-PPNQLRWDPLPMPAEPTDFIDG  126

Query  564  LYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVN  743
              T+ G G++   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL I TE GRL++ 
Sbjct  127  WVTMAGNGAAEAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQEGRLDIATELGRLEIE  186

Query  744  PGEIVVIPQGFRFAVDLPD  800
            P EIVVIP+G RFAV LP+
Sbjct  187  PFEIVVIPRGVRFAVSLPE  205



>ref|WP_040143510.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 gb|AIO42086.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
Length=444

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 135/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P +   +RLV+EF  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-LTGPQRLVAEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GR+ V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLFIATEFGRVDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_006411569.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans]
 gb|EJO53540.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans ATCC 
BAA-247]
 gb|AJY18503.1| homogentisate 1,2-dioxygenase [Burkholderia multivorans ATCC 
BAA-247]
Length=444

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVS+F  S       P QLRW P+ +P  PTDF++GL T+
Sbjct  68   RIRPAAVHRPFEP-FAGAQRLVSDFADSADVPPTPPNQLRWNPLPMPSEPTDFVEGLVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF + LPD
Sbjct  187  AVIPRGVRFTIALPD  201



>ref|WP_038738448.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGV57440.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei BDU 
2]
Length=444

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_042446435.1| homogentisate 1,2-dioxygenase [Azospirillum lipoferum]
Length=439

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 141/203 (69%), Gaps = 9/203 (4%)
 Frame = +3

Query  192  DDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSP  371
            +D +T SP F     YQSGFGN F++EA+ GALP G+NSP   P GLYAEQISGT+FT+P
Sbjct  3    EDRMT-SPAF----TYQSGFGNEFATEALPGALPVGRNSPQRPPYGLYAEQISGTAFTAP  57

Query  372  RKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTD  551
            R  N+ SW YR++P+V HEPF+P  P   RL S F++    A PTQLRW P  +P+ PTD
Sbjct  58   RAHNRRSWLYRIRPAVIHEPFQPMAPG--RLTSRFDEV--PAPPTQLRWNPPPMPDAPTD  113

Query  552  FIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGR  731
            F+ GL T+ G G    + G  IH+Y AN+SM+   F +ADG+ LIVPQ+GRL + TE G 
Sbjct  114  FVAGLVTMGGNGGPQAQTGCGIHLYAANRSMEGRFFYDADGELLIVPQQGRLRLFTELGV  173

Query  732  LQVNPGEIVVIPQGFRFAVDLPD  800
            L+V P EI ++P+G RF V+LPD
Sbjct  174  LEVEPQEIALVPRGIRFRVELPD  196



>ref|WP_004194851.1| MULTISPECIES: homogentisate 1,2-dioxygenase [Burkholderia]
 gb|ABN83701.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 668]
 gb|EDK53653.1| homogentisate 1,2-dioxygenase [Burkholderia mallei FMH]
 gb|EDK58623.1| homogentisate 1,2-dioxygenase [Burkholderia mallei JHU]
 gb|EDO95032.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei Pasteur 
52237]
 gb|EDU08435.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1655]
 gb|EEP88795.1| homogentisate 1,2-dioxygenase [Burkholderia mallei GB8 horse 
4]
 gb|EMP76118.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR1043]
 gb|AGR71838.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR305]
 gb|AHE35237.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei NAU20B-16]
 gb|AHG33556.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR511]
 gb|AHG69244.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR146]
 gb|AHK64685.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR520]
 gb|AIO51341.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AIO57010.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AIO63450.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AIO80945.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AIO89505.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIO97131.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 576]
 gb|AIP02559.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIO14799.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIP46922.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5858]
 gb|AIP50608.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei HBPUB10134a]
 gb|AIP59269.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei HBPUB10303a]
 gb|AIP77460.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AIP80918.1| Homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC25009.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC30251.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC42474.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC48754.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC58665.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC58934.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|KGC65942.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC71587.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC90246.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC98222.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGD05485.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGD13459.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGD16471.1| homogentisate 1,2-dioxygenase [Burkholderia sp. BGJ]
 gb|KGD26330.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGD53198.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIS30660.1| homogentisate 1,2-dioxygenase [Burkholderia mallei NCTC 10247]
 gb|AIS45547.1| homogentisate 1,2-dioxygenase [Burkholderia sp. BGK]
 gb|AIS88790.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei NAU35A-3]
 gb|AIV83635.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3965]
 gb|AIV47213.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV 
48]
 gb|KGS01119.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR7504]
 gb|KGS20622.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4378]
 gb|KGS25507.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5569]
 gb|KGS26737.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR7343]
 gb|KGS41592.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5492]
 gb|KGS51222.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei ABCPW 
107]
 gb|KGS61306.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4868]
 gb|KGS66685.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR7527]
 gb|KGS77748.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR7500]
 gb|KGS94053.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR7498]
 gb|KGT00497.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGU73558.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4304]
 gb|KGU94043.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4377]
 gb|KGV02764.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4032]
 gb|KGV07729.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4503]
 gb|KGV14471.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4300]
 gb|KGV32490.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4308]
 gb|KGV44344.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4012]
 gb|KGV51558.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4003]
 gb|KGV61224.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei ABCPW 
91]
 gb|KGV74110.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4299]
 gb|KGV90307.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei ABCPW 
30]
 gb|KGW05630.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV 
25]
 gb|KGW09508.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4303]
 gb|KGW14687.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4000]
 gb|KGW22396.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR733]
 gb|KGW24549.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3016]
 gb|KGW28134.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR2451]
 gb|KGW52108.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR684]
 gb|KGW54652.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR303]
 gb|KGW75944.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR2990]
 gb|KGW83581.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR456]
 gb|KGW83989.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR332]
 gb|KGW89021.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR449]
 gb|KGX18012.1| homogentisate 1,2-dioxygenase [Burkholderia sp. ABCPW 1]
 gb|KGX23609.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSHR4009]
 gb|KGX28103.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSHR4018]
 gb|KGX30505.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR2138]
 gb|KGX39229.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3335]
 gb|KGX49400.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV44]
 gb|KGX55066.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV5]
 gb|KGX76662.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR435]
 gb|KIX38105.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KIX56635.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KIX61237.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KIX66680.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KIY04841.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AJX02596.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AJX23515.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR491]
 gb|AJX78133.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR2543]
 gb|AJX80178.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 7894]
 gb|AJX86950.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AJX27768.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei K96243]
 gb|AJX37514.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AJX42361.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AJX49118.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AJX53937.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AJX59795.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei Pasteur 
52237]
 gb|AJX64887.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 gb|AJY33390.1| homogentisate 1,2-dioxygenase [Burkholderia mallei]
 emb|CFL13655.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFM57804.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFM79208.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFN15256.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFO49945.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFO76103.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFO86955.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFP11854.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFB50397.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFD84476.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFD88513.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK39884.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK42208.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK43810.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK55577.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK60301.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK63103.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK74023.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK73239.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK83581.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK84419.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK91964.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL02298.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFK97985.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL06904.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL19174.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL28178.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL43489.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL35711.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL58048.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL45051.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL51699.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL44263.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL56144.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL80983.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFL92862.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFM16444.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFM30594.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFM61840.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFM95014.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFN42428.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFO07622.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFP23557.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT51093.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT55226.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT46430.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT53818.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT59599.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT75915.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT83630.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT83405.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFT88869.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFU15415.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFU18262.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFU25711.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFU50531.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFU64181.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFU72369.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFV70141.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFV73698.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFV77760.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFV94825.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFW14197.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFW46228.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
 emb|CFW77701.1| homogentisate 1%2C2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_004186050.1| MULTISPECIES: homogentisate 1,2-dioxygenase [pseudomallei group]
 ref|YP_109335.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei K96243]
 ref|YP_103636.1| homogentisate 1,2-dioxygenase [Burkholderia mallei ATCC 23344]
 ref|YP_992196.1| homogentisate 1,2-dioxygenase [Burkholderia mallei SAVP1]
 sp|Q62I34.1|HGD_BURMA RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
mallei ATCC 23344]
 sp|Q63RD3.1|HGD_BURPS RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
pseudomallei K96243]
 sp|Q3JPA3.1|HGD_BURP1 RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
pseudomallei 1710b]
 sp|A3MMH2.1|HGD_BURM7 RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
mallei NCTC 10247]
 sp|A2S9M1.1|HGD_BURM9 RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
mallei NCTC 10229]
 sp|A1V1U3.1|HGD_BURMS RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
mallei SAVP1]
 sp|A3NYN0.1|HGD_BURP0 RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
pseudomallei 1106a]
 emb|CAH36747.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei K96243]
 gb|AAU49603.1| homogentisate 1,2-dioxygenase [Burkholderia mallei ATCC 23344]
 gb|ABA47587.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1710b]
 gb|ABM49776.1| homogentisate 1,2-dioxygenase [Burkholderia mallei SAVP1]
 gb|ABN03848.1| homogentisate 1,2-dioxygenase [Burkholderia mallei NCTC 10229]
 gb|ABN90235.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1106a]
 gb|ABO04335.1| homogentisate 1,2-dioxygenase [Burkholderia mallei NCTC 10247]
 gb|EBA48465.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 305]
 gb|EDP86555.1| homogentisate 1,2-dioxygenase [Burkholderia mallei ATCC 10399]
 gb|EDS84374.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei S13]
 gb|EEC36333.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 576]
 gb|EES27434.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1106b]
 gb|EES43942.1| homogentisate 1,2-dioxygenase [Burkholderia mallei PRL-20]
 gb|EET08482.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1710a]
 gb|AFR17102.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei BPC006]
 emb|CDU29376.1| Homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=450

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  14   PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  73

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  74   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  132

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  133  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  192

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  193  AVIPRGVRFAVALPD  207



>ref|WP_038780753.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGD35878.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_004550058.1| MULTISPECIES: homogentisate 1,2-dioxygenase [pseudomallei group]
 gb|ACQ98445.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR346]
 gb|EIF77852.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 354e]
 gb|EIF82281.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 354a]
 gb|AHE27288.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei NCTC 
13178]
 gb|EXJ00198.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR6137]
 gb|KEO67794.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5855]
 gb|AIP09514.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIP23424.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5855]
 gb|AIP40037.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5848]
 gb|AIV60177.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR2243]
 gb|AIV70916.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR62]
 gb|KGS72809.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5596]
 gb|KGU70292.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR465J]
 gb|KGU78907.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR543]
 gb|KGU98716.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4372]
 gb|KGV71314.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3964]
 gb|KGV87351.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3951]
 gb|KGW00711.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3960]
 gb|KGW38677.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR1000]
 gb|KGW64397.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR1029]
 gb|KGW69480.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3458]
 gb|KGX07568.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSHR44]
 gb|KGX31705.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR3709]
 gb|AJX96613.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei PB08298010]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_038767753.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGS55491.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5613]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_038792042.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGV23800.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4462]
 gb|KGW99803.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR640]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_038772262.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGS01935.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5608]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>gb|EQA88204.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR338]
Length=450

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  14   PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  73

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  74   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  132

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  133  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  192

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  193  AVIPRGVRFAVALPD  207



>ref|WP_045719850.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KJR93451.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPCEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_045605144.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AJX71415.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR840]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFTTEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPCEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>gb|EEH29768.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei Pakistan 
9]
Length=450

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  14   PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  73

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  74   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  132

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  133  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  192

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  193  AVIPRGVRFAVALPD  207



>ref|WP_004552674.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|EIF67545.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1026a]
 gb|EIF69182.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1258a]
 gb|EIF71045.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1258b]
 gb|AFI65240.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1026b]
 gb|AIO87531.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIP15491.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AJX08600.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 1026b]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_038794775.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPCEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>dbj|GAN45692.1| homogentisate 1,2-dioxygenase [Mizugakiibacter sediminis]
Length=436

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y SGFGN F++EA+ GALPRGQNSP   P GLYAEQ+SGT+FT+PR +N+ SW YR++P+
Sbjct  6    YMSGFGNEFATEALPGALPRGQNSPQRVPYGLYAEQLSGTAFTAPRHMNRRSWLYRIRPA  65

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF  R+    R  + F+++   ATP QLRW P  +P+ P DF+DGL+TV G G + 
Sbjct  66   ALHQPF--RLLADGRFHNRFDEA--PATPNQLRWDPFPLPQAPADFVDGLFTVAGNGGAA  121

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+ M    F +AD + LIVPQ+GRL I TE G L V P EI VIP+G 
Sbjct  122  AQSGVGIHVYAANRPMQGRYFYDADAELLIVPQQGRLRIATELGVLDVAPVEIAVIPRGV  181

Query  777  RFAVDLPD  800
            RF V+LPD
Sbjct  182  RFRVELPD  189



>gb|KGV70630.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR4375]
Length=442

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  6    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  65

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  66   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  124

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  125  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPCEI  184

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  185  AVIPRGVRFAVALPD  199



>ref|WP_038728323.1| MULTISPECIES: homogentisate 1,2-dioxygenase [pseudomallei group]
 gb|KGC77695.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIV79256.1| homogentisate 1,2-dioxygenase [Burkholderia sp. TSV202]
 gb|KGV11302.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV 
43]
 gb|KGV42452.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV 
31]
 gb|KGW61011.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR1357]
Length=444

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRVVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_045737505.1| homogentisate 1,2-dioxygenase [Xanthomonas sp. MUS 060]
Length=433

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 129/192 (67%), Gaps = 7/192 (4%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
            L YQSGFGN F++EA+AGALP GQNSP     GLYAEQ+SGT+FT+PR  N+ SW YR++
Sbjct  6    LRYQSGFGNEFATEAVAGALPVGQNSPQRVAHGLYAEQLSGTAFTAPRAANRRSWLYRIR  65

Query  411  PSVTHEPFKPRVPTHERLVSEFNQS--NSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            PS+ H  F P    H      F+ +  N    P QLRW P+ +PE   DF+DGLYT+ G 
Sbjct  66   PSLLHGGFAPYTQAHG-----FHNTFQNGPVPPDQLRWSPLPLPEASVDFVDGLYTMAGN  120

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GS+  +HG A+H+Y AN SM    F NAD + LIVPQ GRL + TE G L+V P EIVVI
Sbjct  121  GSAEAQHGVAVHLYAANASMQGRFFYNADAELLIVPQLGRLQVCTELGTLEVAPQEIVVI  180

Query  765  PQGFRFAVDLPD  800
            P+G RF V LPD
Sbjct  181  PRGVRFRVGLPD  192



>ref|WP_038753466.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGR94939.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei ABCPW 
111]
Length=444

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V++F  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVADFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_043311744.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGS60244.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR5609]
Length=444

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPVQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_009974038.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AGZ28506.1| hmgA: homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 
NCTC 13179]
Length=444

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFTTEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPVQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_015601085.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis]
 gb|AGK47522.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis MSMB121]
 gb|AJY41767.1| homogentisate 1,2-dioxygenase [Burkholderia sp. 2002721687]
Length=444

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V++F  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAMHRPFE-LVSGERRIVADFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_038759067.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIV97724.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei A79A]
 gb|AIV89673.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei B03]
 gb|AIV63573.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei K42]
 gb|KGX68691.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei TSV28]
 gb|KGY05058.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei A79D]
 gb|KGY06009.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei A79C]
Length=444

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW+P+ +P  PTDF++G  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWEPLPMPAQPTDFVEGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>gb|EIP88354.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis MSMB43]
Length=450

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  14   PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  73

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V++F  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  74   RIRPAAMHRPFE-LVSGERRIVADFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  132

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  133  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  192

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  193  AVIPRGVRFAVALPD  207



>ref|WP_010091511.1| homogentisate 1,2-dioxygenase [Burkholderia ubonensis]
Length=444

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PASAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRSHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLV+EF  S       P QLRW P+ +P  P DFI+G  T+
Sbjct  68   RIRPAAVHRPFEP-FAGPQRLVAEFGDSPDVPPTPPNQLRWDPLPMPAEPVDFIEGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F N DG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYNTDGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_007663799.1| homogentisate 1,2-dioxygenase [Caulobacter sp. AP07]
 gb|EJL36537.1| homogentisate 1,2-dioxygenase [Caulobacter sp. AP07]
Length=427

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 132/190 (69%), Gaps = 5/190 (3%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL YQSGFGN F++EA+ GALP GQNSP   P GLYAEQ+SGT+FT+PR  N+ SW YR+
Sbjct  2    DLHYQSGFGNSFATEAVPGALPVGQNSPQTPPFGLYAEQLSGTAFTAPRHENRRSWLYRL  61

Query  408  KPSVTHEPFKPRVPTHERLVS-EFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +PS  H P+ P V   ERL S  F+ +  + TP +LRW P++IP  P DF+DGL T+ G 
Sbjct  62   RPSAGHGPYAPYV--QERLKSGPFDAA--APTPNRLRWDPLEIPAEPVDFVDGLVTLAGN  117

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G    + G A H+Y AN+SM    F NADG+ LIVPQ+G L + TE GR+ V PGEI VI
Sbjct  118  GDVATQQGMATHLYLANRSMTGRVFQNADGELLIVPQQGSLRLVTELGRIDVAPGEIAVI  177

Query  765  PQGFRFAVDL  794
            P+G RF V++
Sbjct  178  PRGVRFRVEV  187



>gb|ESA12272.1| hypothetical protein GLOINDRAFT_65414 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX70683.1| hypothetical protein RirG_085220 [Rhizophagus irregularis DAOM 
197198w]
Length=453

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 132/197 (67%), Gaps = 8/197 (4%)
 Frame = +3

Query  234  EYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKP  413
            +Y  GFGNHFSSEA+  ALP+GQN+P  CP GLYAEQ+SGT+FT  RK NQ SW YR++P
Sbjct  9    KYMKGFGNHFSSEALQDALPKGQNTPQKCPYGLYAEQLSGTAFTVDRKNNQRSWLYRIRP  68

Query  414  SVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPV------DIPETPT--DFIDGLY  569
            SV H+PF         + ++F   +    P Q+RW P       D  +T    DF+ GL+
Sbjct  69   SVCHQPFTKLDSKSHHIANKFGIGDIHHIPNQIRWSPFNKLLLEDNKKTSNDIDFVHGLH  128

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+ GAG   +++G AIH+YTAN +MDN AF N+DGDFLIVPQ GRL I TE G L V   
Sbjct  129  TLAGAGDPTIKNGLAIHIYTANANMDNTAFYNSDGDFLIVPQHGRLDIITEFGCLMVASN  188

Query  750  EIVVIPQGFRFAVDLPD  800
            EIVVIP+G R++++ PD
Sbjct  189  EIVVIPRGIRYSINFPD  205



>ref|WP_028226625.1| homogentisate 1,2-dioxygenase [Burkholderia ferrariae]
Length=447

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 128/188 (68%), Gaps = 1/188 (1%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y SGFGN F++EA+ GALP G+NSP     GLYAEQISGT+FT+PR  N+ +W YR++P 
Sbjct  18   YMSGFGNEFATEALPGALPEGRNSPQRVAYGLYAEQISGTAFTAPRSHNRRAWLYRIRPG  77

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF P      RLV++F     +  P QLRW P+ +P  PTDFIDG  T+ G GS+ 
Sbjct  78   AVHQPFVPVTARAGRLVADFGAVPPT-PPNQLRWDPLPMPAEPTDFIDGWVTMAGNGSAA  136

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
               G AIH+Y AN+ M +  F N+DG+ LIVPQ GRL I TE GRL+V P EI VIP+G 
Sbjct  137  SMSGCAIHLYAANRPMTDRFFYNSDGELLIVPQHGRLAIATEMGRLEVEPFEIAVIPRGV  196

Query  777  RFAVDLPD  800
            RF VDLPD
Sbjct  197  RFTVDLPD  204



>ref|WP_009889415.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis]
 gb|AHI64252.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis H0587]
 gb|AHI71921.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis 2002721723]
 gb|AHI78853.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis E444]
 gb|AIC88046.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis USAMRU 
Malaysia #20]
 gb|AIP25028.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis E264]
 gb|AIP62413.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis]
 gb|AIS97030.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis MSMB59]
 gb|AIT20977.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis E254]
 gb|KIS56528.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis Phuket 
4W-1]
 gb|AJX99761.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis 2002721643]
Length=444

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V++F  S       P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVADFGDSGDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>sp|Q2SYQ6.1|HGD_BURTA RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Burkholderia 
thailandensis E264]
 gb|ABC36904.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis E264]
Length=450

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  14   PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  73

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V++F  S       P QLRW P+ +P  PTDF+DG  T+
Sbjct  74   RIRPAAVHRPFE-LVSGERRIVADFGDSGDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  132

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  133  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  192

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  193  AVIPRGVRFAVALPD  207



>ref|NP_001271223.1| homogentisate 1,2-dioxygenase [Xenopus (Silurana) tropicalis]
Length=443

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 133/195 (68%), Gaps = 9/195 (5%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            A+L+Y SGFGN FSSE     G+LP GQNSP VCP GLYAEQ+SG++FT PR  N+ SWF
Sbjct  2    AELKYLSGFGNEFSSEDPRCPGSLPEGQNSPQVCPYGLYAEQLSGSAFTCPRSTNKRSWF  61

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPT---DFIDGLY  569
            YR+ PSV H+PF     T+E+     N       P Q+RWKP  IP       DFIDGLY
Sbjct  62   YRILPSVRHKPFV----TYEQKNLTHNWDEVEPDPNQMRWKPYQIPTAAAHKQDFIDGLY  117

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+CGAG +  R+G AIH+YTAN SM +    N+DGDFLIVPQ+G+L I TE G+L V P 
Sbjct  118  TLCGAGDTRSRNGIAIHIYTANTSMIDRCLYNSDGDFLIVPQQGKLLILTEFGKLLVEPN  177

Query  750  EIVVIPQGFRFAVDL  794
            EI VI QG RF+V++
Sbjct  178  EICVIQQGMRFSVEV  192



>ref|WP_038789456.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGU64636.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR983]
Length=444

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF++G  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVEGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|XP_011193887.1| PREDICTED: homogentisate 1,2-dioxygenase [Bactrocera cucurbitae]
Length=435

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 134/189 (71%), Gaps = 5/189 (3%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            D +Y +GFG++FSSE     G+LP GQNSP +CP GLYAEQISG++FT+PRK N  SW Y
Sbjct  3    DYQYMNGFGSYFSSEDKRCPGSLPDGQNSPQICPYGLYAEQISGSAFTAPRKENLKSWLY  62

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCG  581
            R++PSV HEPFKP       L +++N  + +  P Q+RWKP DIP    +F++G++T+CG
Sbjct  63   RIRPSVMHEPFKP-FNGKTGLNNDWNGQHPN--PNQMRWKPFDIPLEDVNFVEGIHTICG  119

Query  582  AGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVV  761
            +G  +  HG AIH+Y    SM+  AF N+DGDFLIVPQKG L ITTE G L V P EI +
Sbjct  120  SGDVHSHHGLAIHIYICTTSMEKTAFYNSDGDFLIVPQKGSLEITTEFGNLVVRPNEICI  179

Query  762  IPQGFRFAV  788
            IPQG R++V
Sbjct  180  IPQGIRYSV  188



>ref|XP_008863813.1| homogentisate 1,2-dioxygenase [Aphanomyces invadans]
 gb|ETW07720.1| homogentisate 1,2-dioxygenase [Aphanomyces invadans]
Length=459

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 136/192 (71%), Gaps = 6/192 (3%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            +DLEY  GFGNHF+SE + GALP G N+P  C  GLYAEQ+SGT+FT PRK NQ SW YR
Sbjct  22   SDLEYLPGFGNHFASEVLKGALPTGMNNPQKCNYGLYAEQLSGTAFTLPRKSNQRSWLYR  81

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPET--PTDFIDGLYTVC  578
            + P V H+ +K  +P  + +V++F  +N   TP QLRW+P+ +P+     +FI GL+T+ 
Sbjct  82   ILPPVVHDQYK-EIPA-KHIVNDF--ANQHITPQQLRWQPMALPKASEKVNFIQGLHTMG  137

Query  579  GAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIV  758
            GAG   ++ G AIHMY AN SM + AF N+DGDFLIVPQ G L ITTE G+L V P EIV
Sbjct  138  GAGEPTMKAGLAIHMYAANASMKDTAFYNSDGDFLIVPQVGALKITTEFGKLHVKPREIV  197

Query  759  VIPQGFRFAVDL  794
            VI +G RF++DL
Sbjct  198  VIQRGIRFSIDL  209



>ref|WP_037528594.1| homogentisate 1,2-dioxygenase [Sphingomonas wittichii]
Length=425

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 127/185 (69%), Gaps = 2/185 (1%)
 Frame = +3

Query  246  GFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPSVTH  425
            GFGNHFS+EAI GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+  H
Sbjct  3    GFGNHFSTEAIPGALPIGRNSPQHVPFGLYAEQLSGTAFTAPRAENRRSWLYRLRPTANH  62

Query  426  EPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSYLRH  605
             PF+P     + L+          +P +LRW P+ +P  P DFIDGL T  G G      
Sbjct  63   APFRPY--DRDLLIRTAPFDEVPPSPNRLRWDPLPLPVGPVDFIDGLITFGGNGDVASAT  120

Query  606  GFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGFRFA  785
            G A+H+Y AN+SMD  AF NADG+ LIVPQ+GRL ITTE G ++V P EI +IP+G RF+
Sbjct  121  GMAVHLYAANRSMDRRAFLNADGELLIVPQQGRLLITTELGLIEVEPLEIAIIPRGLRFS  180

Query  786  VDLPD  800
            VDLPD
Sbjct  181  VDLPD  185



>ref|WP_038794023.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGD33308.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF++G  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVEGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|XP_003294282.1| homogentisate 1,2-dioxygenase [Dictyostelium purpureum]
 gb|EGC29187.1| homogentisate 1,2-dioxygenase [Dictyostelium purpureum]
Length=440

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 131/186 (70%), Gaps = 3/186 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN+F SEA+ GALP+GQN+P  CP  LYAEQ+SG +FT  R   Q SW YR++PS
Sbjct  12   YQSGFGNNFESEAVRGALPKGQNTPQNCPYNLYAEQLSGNAFTVGRHAQQRSWLYRIRPS  71

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
            V H PFKP     E L+++ N  N    P QLRWKP  I + P DF+DGL T+ GAG   
Sbjct  72   VCHTPFKPLEKGAE-LLADLN--NLHIDPNQLRWKPFPISDKPHDFVDGLITIGGAGHPS  128

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
            +RHG AIH+YTAN++M++ +F N+DGDFLIVPQ+G L I TE G LQV  GEI VI +G 
Sbjct  129  VRHGIAIHIYTANQNMEDKSFYNSDGDFLIVPQQGTLDIQTEFGNLQVKSGEICVIQRGI  188

Query  777  RFAVDL  794
             F+V +
Sbjct  189  CFSVSV  194



>ref|WP_040126730.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
 gb|AIO31161.1| homogentisate 1,2-dioxygenase [Burkholderia cenocepacia]
Length=444

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 134/195 (69%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PASAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  PTDF++G  T+
Sbjct  68   RIRPAAVHRPFEP-FAGPQRLVSEFGDSADVPPTPPNQLRWDPLPMPVEPTDFVEGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL I TE GR+ V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQQGRLCIATEFGRIDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_035480104.1| homogentisate 1,2-dioxygenase [Burkholderia phenoliruptrix]
Length=448

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 142/208 (68%), Gaps = 4/208 (2%)
 Frame = +3

Query  177  DMESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGT  356
            D  ++  +  GS +   +  YQSGF N F++EA+ GALP G+NSP     GLYAEQ+SGT
Sbjct  2    DTSTRQPDTAGS-RLEIEPGYQSGFANEFATEALPGALPVGRNSPQRAAYGLYAEQLSGT  60

Query  357  SFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP  536
            +FT+PR  N+ SW YR++P+  HEPF P +P+  RLV+ F +   +  P QLRW  + +P
Sbjct  61   AFTAPRGHNRRSWLYRIRPAAVHEPFTP-LPS-ARLVANFAEVPPT-PPNQLRWDALPMP  117

Query  537  ETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWIT  716
              PTDFIDG  T+ G G++    G AIH+Y AN+SM +  F NADG+ LIVPQ+GRL I 
Sbjct  118  AEPTDFIDGWVTMAGNGAAESMSGCAIHLYAANRSMQDRFFYNADGELLIVPQEGRLDIA  177

Query  717  TECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            TE GRL+V P EIVVIP+G RFAV LPD
Sbjct  178  TEMGRLEVTPFEIVVIPRGVRFAVSLPD  205



>ref|WP_042583258.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSHR3999]
 gb|KIP18367.1| homogentisate 1,2-dioxygenase [Burkholderia sp. MSHR3999]
 gb|AJX18110.1| homogentisate 1,2-dioxygenase [Burkholderia ubonensis MSMB22]
Length=444

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PASAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRSHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLV+EF  S       P QLRW P+ +P  P DF++G  T+
Sbjct  68   RIRPAAVHRPFEP-FAGPQRLVAEFGDSPDVPPTPPNQLRWDPLPMPAEPVDFVEGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F N DG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYNTDGELLIVPQQGRLFIATEFGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_038752570.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGC28821.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGECRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_008213525.1| homogentisate 1,2-dioxygenase [Rhodanobacter sp. 115]
 gb|EIL93623.1| homogentisate 1,2-dioxygenase [Rhodanobacter sp. 115]
Length=434

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F+SEA+ G LP GQNSP     GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  7    YQSGFGNEFASEAVPGVLPEGQNSPQRVAHGLYAEQLSGTAFTAPRHANRRSWLYRIRPA  66

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+ F P +  HE   + F+++   ATP QLRW P+ +PE PTDF++GL T+ G G + 
Sbjct  67   AMHKSFAPLL--HELFHNRFDEA--PATPNQLRWDPLPLPEAPTDFVEGLLTLAGNGGAA  122

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+SM+   F +ADG+ LIVPQ+GRL I TE G L+V P EI VIP+G 
Sbjct  123  EQAGVGIHLYAANRSMEGRFFYDADGELLIVPQQGRLHIATELGVLEVKPLEIAVIPRGV  182

Query  777  RFAVDLPD  800
            RF V+L D
Sbjct  183  RFRVELLD  190



>ref|WP_042337350.1| homogentisate 1,2-dioxygenase, partial [Burkholderia ferrariae]
Length=233

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 131/190 (69%), Gaps = 4/190 (2%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
            L+Y +GF N  ++EA+ GALP G+NSP     GLYAEQISGT+FT+PR  N+ SW YR++
Sbjct  14   LQYLTGFANECATEALPGALPAGRNSPQRVAYGLYAEQISGTAFTAPRHSNRRSWLYRIR  73

Query  411  PSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGS  590
            P+  H PF+P   T  R +S F++  +   P QLRW P   P+ PTDFIDG+ T+ G G 
Sbjct  74   PTAVHPPFEPFANT--RWLSRFDEVPTP--PNQLRWSPQPYPDAPTDFIDGIVTIAGNGG  129

Query  591  SYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQ  770
              +  G  IH+YTAN+SM +  F N DG+ LIVPQ+GRL+I TE G L V P EIVVIP+
Sbjct  130  PAVGTGAGIHLYTANRSMHDRFFYNVDGELLIVPQEGRLFIRTEFGALDVEPHEIVVIPR  189

Query  771  GFRFAVDLPD  800
            G RFAV+LPD
Sbjct  190  GVRFAVELPD  199



>ref|XP_002065026.1| GK14896 [Drosophila willistoni]
 gb|EDW76012.1| GK14896 [Drosophila willistoni]
Length=437

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 135/195 (69%), Gaps = 8/195 (4%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            ++ +Y SGFG+HFSSE      +LP GQNSP +CP  LYAEQ+SG++FT+PR  NQ +W 
Sbjct  2    SEYKYLSGFGSHFSSEDERCPNSLPIGQNSPQICPYKLYAEQLSGSAFTAPRTENQRTWL  61

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP---ETPTDFIDGLY  569
            YR  PS  H+PFKP V    +  ++ N +     P QLRWKP D+P   + P DF+ GL+
Sbjct  62   YRRLPSAVHQPFKPFVGA--KYFTQ-NWNEQPPNPNQLRWKPFDLPTERKKPVDFVQGLH  118

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            TVCGAG   +RHG AIH+Y  N SM+N AF N+DGDFLIVPQ+G L ITTE G++ V P 
Sbjct  119  TVCGAGDPRVRHGLAIHVYLCNVSMENSAFYNSDGDFLIVPQQGVLDITTELGKMTVAPN  178

Query  750  EIVVIPQGFRFAVDL  794
            EI VIPQG RFAV +
Sbjct  179  EICVIPQGIRFAVGV  193



>ref|WP_042262350.1| homogentisate 1,2-dioxygenase [Burkholderia heleia]
Length=450

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 136/202 (67%), Gaps = 8/202 (4%)
 Frame = +3

Query  216  KFPADLE--YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQL  389
            + P D++  Y SGF N F++EA+AGALP GQNSP  C  GLYAEQ+SGT+FT+PR  N+ 
Sbjct  6    RHPTDVQHGYMSGFANEFATEALAGALPAGQNSPQRCAYGLYAEQLSGTAFTAPRSHNRR  65

Query  390  SWFYRVKPSVTHEPFKP-----RVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDF  554
            +WFYR++P   H+PF P      V    RLV++F +   +  P+QLRW  + +P  PTDF
Sbjct  66   TWFYRIRPGAVHQPFAPVTSRLDVNGAPRLVADFGEVPPTP-PSQLRWDALPMPTAPTDF  124

Query  555  IDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRL  734
            IDG  T+ G GS+    G AIH+Y AN+ M +  F N DG+ LIVPQ+GRL I TE GRL
Sbjct  125  IDGWVTMSGNGSAASMSGCAIHLYAANRPMVDRFFYNTDGELLIVPQQGRLAIRTEMGRL  184

Query  735  QVNPGEIVVIPQGFRFAVDLPD  800
             V P EI VIP+G RF VDLPD
Sbjct  185  DVEPFEIAVIPRGVRFTVDLPD  206



>emb|CEF66808.1| Homogentisate 1,2-dioxygenase [Strongyloides ratti]
Length=439

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 133/194 (69%), Gaps = 5/194 (3%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
             +L YQ+GFGN F++E     GALP GQNSP +C  GLYAEQ+SGT+FT  RK NQ SW 
Sbjct  5    GNLTYQTGFGNEFATEDQRCVGALPEGQNSPQMCNYGLYAEQLSGTAFTVGRKDNQRSWL  64

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPT--DFIDGLYT  572
            YR++PSV H+PF   +P  E      + S   + P Q+RW P  +PE     DFI  LYT
Sbjct  65   YRIRPSVIHKPFI-SLPKEEIPHFTNDSSKVYSNPNQMRWHPHPLPENGNNIDFIQSLYT  123

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
             CGAG    R+G  IHMY+ N SM+N  F N+DGDFLIVPQ+G L+ITTE GRL+V+P E
Sbjct  124  FCGAGDVKSRNGIYIHMYSCNVSMENKVFYNSDGDFLIVPQEGSLYITTEFGRLKVDPLE  183

Query  753  IVVIPQGFRFAVDL  794
            IVVIPQG RF+VD+
Sbjct  184  IVVIPQGIRFSVDI  197



>ref|WP_038779032.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGS77110.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei MSHR7334]
Length=444

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y A +SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAATRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|XP_002430776.1| Homogentisate 1,2-dioxygenase, putative [Pediculus humanus corporis]
 gb|EEB18038.1| Homogentisate 1,2-dioxygenase, putative [Pediculus humanus corporis]
Length=439

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 131/190 (69%), Gaps = 7/190 (4%)
 Frame = +3

Query  231  LEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            L+Y +GFGN F SE      +LP GQN+P VCP GLYAEQ+SGT+FT+PR  N+ +WFYR
Sbjct  5    LKYLAGFGNEFQSEDPRYPNSLPIGQNNPQVCPYGLYAEQLSGTAFTAPRGENKRTWFYR  64

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            ++PSV HEPF    P        F+  + +  P QLRWKP D+P   TDF+DGL+TVCGA
Sbjct  65   IRPSVIHEPF---TPIKSNTTVRFDDVHPN--PNQLRWKPFDMPTGVTDFVDGLFTVCGA  119

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G    RHG AIH+Y  N SM N  F NADGDFLIVPQ+G L ITTE G++ ++P EI V+
Sbjct  120  GDPKTRHGTAIHVYLCNVSMTNKCFYNADGDFLIVPQQGSLKITTEFGKVLIDPNEIFVV  179

Query  765  PQGFRFAVDL  794
             QG +F V++
Sbjct  180  QQGMKFKVEV  189



>ref|WP_019467035.1| homogentisate 1,2-dioxygenase [Dyella japonica]
 gb|AIF49419.1| homogentisate 1,2-dioxygenase [Dyella japonica A8]
Length=432

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 130/189 (69%), Gaps = 4/189 (2%)
 Frame = +3

Query  234  EYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKP  413
            +YQ+GF N F++EA+ G LP GQNSP   PLGLYAEQISGT+FT+PR  N+ SW YR++P
Sbjct  7    QYQTGFANEFATEALPGVLPEGQNSPQAAPLGLYAEQISGTAFTAPRHSNRRSWLYRIRP  66

Query  414  SVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSS  593
            +  H PF+       R  + FN+    A P QLRW P  +P  PTDFIDGL+TV G GS+
Sbjct  67   AAMHHPFEAM--PEGRFHNRFNEV--PANPNQLRWSPFPLPSEPTDFIDGLFTVAGNGSA  122

Query  594  YLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQG  773
              + G  IH+Y AN+SM    F NADG+ LIVPQ+GRL +TTE G +++ P EI VIP+G
Sbjct  123  ADQTGVGIHVYAANRSMQGRFFYNADGELLIVPQQGRLKLTTEMGVIELEPLEIAVIPRG  182

Query  774  FRFAVDLPD  800
             RF V+L D
Sbjct  183  VRFRVELLD  191



>gb|KDR25008.1| homogentisate 1,2-dioxygenase [Burkholderia zhejiangensis]
Length=360

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 136/190 (72%), Gaps = 4/190 (2%)
 Frame = +3

Query  231  LEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVK  410
            L+YQ+GF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++
Sbjct  3    LDYQTGFANEFATEALPGALPVGRNSPQRAPYGLYAEQLSGTAFTAPRHNNRRSWLYRIR  62

Query  411  PSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGS  590
            P+  H PF+ R+  + RL+S F++  +   P QLRW P+ +P+ PTDF+ GL T+ G G+
Sbjct  63   PAAMHLPFE-RI-ENARLLSRFDELPTP--PNQLRWDPLPMPDAPTDFVSGLVTMAGNGA  118

Query  591  SYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQ  770
              L  G  IH+Y AN SM +  F NADG+ LIVPQ+GRL + TE G L+V P EIVVIP+
Sbjct  119  PDLGRGCGIHLYAANSSMTDRFFYNADGELLIVPQQGRLRVATEMGVLEVEPQEIVVIPR  178

Query  771  GFRFAVDLPD  800
            G RF V+LPD
Sbjct  179  GARFRVELPD  188



>ref|WP_028198792.1| homogentisate 1,2-dioxygenase [Burkholderia fungorum]
Length=448

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 138/199 (69%), Gaps = 3/199 (2%)
 Frame = +3

Query  204  TGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLN  383
            T S +   +  YQSGF N F+SEA+ GALP G+NSP     GLYAEQ+SGT+FT+PR  N
Sbjct  10   TASSRLEIEPGYQSGFANEFASEALPGALPEGRNSPQRAAYGLYAEQLSGTAFTAPRGHN  69

Query  384  QLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDG  563
            + SW YR++P+  H+PF  ++P+ ERLV+ F +   +  P QLRW  + +P  PTDFIDG
Sbjct  70   RRSWLYRIRPAAVHKPFT-QLPS-ERLVANFAEVPPTP-PNQLRWDALPMPTEPTDFIDG  126

Query  564  LYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVN  743
              T+ G GS+   +G AIH+Y AN+SM +  F NADG+ LIVPQ+GRL I TE G+L V 
Sbjct  127  WVTMAGNGSAEAMNGCAIHLYAANRSMQDRFFYNADGELLIVPQEGRLHIATEMGQLDVE  186

Query  744  PGEIVVIPQGFRFAVDLPD  800
            P EI VIP+G RFAV LPD
Sbjct  187  PFEIAVIPRGVRFAVSLPD  205



>ref|WP_036017507.1| homogentisate 1,2-dioxygenase [Burkholderia mimosarum]
Length=449

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 130/193 (67%), Gaps = 6/193 (3%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y SGF N F+SEA+ GALP GQNSP  C  GLYAEQ+SGT+FT+PR  N+ +WFYR++P 
Sbjct  15   YMSGFANEFASEALLGALPEGQNSPQRCAYGLYAEQLSGTAFTAPRSHNRRTWFYRIRPG  74

Query  417  VTHEPFKPRVPTHE-----RLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCG  581
              H+PF P     +     RLV++F     +  P QLRW  + +P  PTDFIDG  T+ G
Sbjct  75   AVHQPFTPLASHLDTNGAPRLVADFGDVPPTP-PNQLRWDALPMPAEPTDFIDGWVTMSG  133

Query  582  AGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVV  761
             GS+    G AIH+Y AN+SM +  F N DG+ LIVPQ+GRL I TE GRL V P EIVV
Sbjct  134  NGSAASMSGCAIHLYAANRSMVDRFFYNTDGELLIVPQQGRLAIRTEMGRLDVEPFEIVV  193

Query  762  IPQGFRFAVDLPD  800
            IP+G RF VDLPD
Sbjct  194  IPRGVRFTVDLPD  206



>emb|CDS10852.1| hypothetical protein LRAMOSA11338 [Absidia idahoensis var. thermophila]
Length=440

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 130/190 (68%), Gaps = 6/190 (3%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y  GFGNHF SEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ SW YR++PS
Sbjct  12   YHEGFGNHFVSEALPDALPKGQNTPQKCPYELYAEQLSGTAFTVPRSHNQRSWLYRIRPS  71

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPE--TPTDFIDGLYTVCGAGS  590
            V H+PF P    H+ +V+  N S+   TPTQLRW P D+P      DF+ G+ TV  AG 
Sbjct  72   VVHKPFAPF--KHDSIVA--NSSSCEITPTQLRWSPFDLPADGEKVDFVQGIKTVSVAGD  127

Query  591  SYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQ  770
                 G AIH+YTAN +MD+ AF N+DGD LIVPQ+GRL I TE G++ V P EI VI +
Sbjct  128  PTAASGLAIHIYTANTNMDHKAFYNSDGDILIVPQQGRLDICTEFGKMMVAPNEICVIQR  187

Query  771  GFRFAVDLPD  800
            G R++V LPD
Sbjct  188  GIRYSVSLPD  197



>ref|WP_044455939.1| homogentisate 1,2-dioxygenase [Pandoraea vervacti]
 gb|AJP57714.1| homogentisate 1,2-dioxygenase [Pandoraea vervacti]
Length=439

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
             +L Y SGF N F++EA+ GALP GQNSP   P GLYAEQ+SGT+FT+PR  N+ SW YR
Sbjct  9    GELGYLSGFINEFATEALPGALPIGQNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWVYR  68

Query  405  VKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            ++P+  H+PF P    + R +S F+  +    P Q+RW P+ +P+TPTDF+DG+ T+ G 
Sbjct  69   IRPAAMHKPFTPV--ENARWLSRFD--DVPTPPNQMRWDPLPMPDTPTDFVDGMVTMAGN  124

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GS    HG  IH+Y ANKSMD   F NADG+ LIVPQ+GRL I TE G LQV P EI V+
Sbjct  125  GSPDAGHGCGIHVYAANKSMDGRFFYNADGELLIVPQEGRLRIATEFGVLQVEPYEIAVL  184

Query  765  PQGFRFAVDLPD  800
            P+G RF V LPD
Sbjct  185  PRGVRFRVTLPD  196



>ref|WP_035978446.1| homogentisate 1,2-dioxygenase [Burkholderia glumae]
 gb|KHJ63046.1| homogentisate 1,2-dioxygenase [Burkholderia glumae]
Length=447

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQ GF NHF++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  13   YQCGFANHFATEALPGALPEGRNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLYRIRPA  72

Query  417  VTHEPFKP--RVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
              H PF P  R      LV++F  S       P  LRW P+ +PE PTDF+DG  T+ G 
Sbjct  73   AVHGPFAPLARPQAPAALVADFADSAEVPPTPPDPLRWDPLPMPEAPTDFVDGWVTMAGN  132

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL I TE GRL+V P +I VI
Sbjct  133  GSAAAMNGCAIHLYAANRSMQGRFFYDADGELLIVPQQGRLAIATELGRLEVEPQQIAVI  192

Query  765  PQGFRFAVDLPD  800
            P+G RF+V LPD
Sbjct  193  PRGVRFSVTLPD  204



>ref|XP_005182921.1| PREDICTED: homogentisate 1,2-dioxygenase [Musca domestica]
Length=343

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 131/194 (68%), Gaps = 5/194 (3%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            ++ +Y  GFG+HFSSE      ALP GQN+P  CP GLYAEQ+SGT+FT+PRK N  +W 
Sbjct  2    SEYKYMCGFGSHFSSEDPRCPNALPEGQNTPQKCPYGLYAEQLSGTAFTAPRKENARTWL  61

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPET--PTDFIDGLYT  572
            YR+ PS  H PF+       + +S  N       P Q+RWKP D+P      +F+ GL+T
Sbjct  62   YRINPSAKHLPFQSYEKEGGKYLSH-NWDEQKPNPNQMRWKPFDMPAAGEKVNFVQGLHT  120

Query  573  VCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGE  752
            VCGAG +  RHG A+H+Y  N SM+N AF N+DGDFLIVPQ+G L ITTE G+++V P E
Sbjct  121  VCGAGDARSRHGLAVHVYMCNVSMENMAFYNSDGDFLIVPQEGVLDITTEFGKMKVAPNE  180

Query  753  IVVIPQGFRFAVDL  794
            I VIPQG RFAV++
Sbjct  181  ICVIPQGIRFAVNV  194



>ref|WP_010116835.1| homogentisate 1,2-dioxygenase [Burkholderia oklahomensis]
 gb|AJX33079.1| homogentisate 1,2-dioxygenase [Burkholderia oklahomensis C6786]
Length=444

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 133/195 (68%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+       R+V++F  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LASGERRIVADFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRDRFFYSADGELLIVPQQGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF+V LPD
Sbjct  187  AVIPRGVRFSVALPD  201



>ref|WP_028371967.1| homogentisate 1,2-dioxygenase [Burkholderia sp. UYPR1.413]
Length=440

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGF N F++EA+ GALP+G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  13   YQSGFANEFATEALPGALPQGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLYRIRPA  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF   +P+H RLV+ F +   +  P QLRW P+ +P  PTDFIDG  T+ G GS+ 
Sbjct  73   AVHQPFT-ALPSH-RLVANFAEVPPTP-PNQLRWDPLPMPVEPTDFIDGWVTMAGNGSAE  129

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
              +G AIH+Y AN+SM +  F NADG+ LIVPQ GRL I TE G+L+V P EI VIP+G 
Sbjct  130  SMNGCAIHVYAANQSMQDRFFYNADGELLIVPQAGRLSIFTELGKLEVEPFEIAVIPRGV  189

Query  777  RFAVDLPD  800
            RF+V LPD
Sbjct  190  RFSVALPD  197



>ref|XP_008118688.1| PREDICTED: homogentisate 1,2-dioxygenase [Anolis carolinensis]
Length=440

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 132/195 (68%), Gaps = 9/195 (5%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            ADL+Y SGFGN  SSE     GALP GQN+P VCP GLYAEQISG++FT PR  N+ SW 
Sbjct  5    ADLKYMSGFGNEHSSEDPRCPGALPEGQNNPQVCPYGLYAEQISGSAFTCPRSTNRRSWM  64

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPET---PTDFIDGLY  569
            YR+ PSV H+PF+P     ++     N   +   P QLRWKP +IP T     DF+ GL+
Sbjct  65   YRILPSVCHKPFQPV----DQGYLTHNWDEAEPEPNQLRWKPFEIPITTQRKVDFVTGLH  120

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            T+CGAG    R+G AIH++T N SM N  F N+DGDFLIVPQ+G L ITTE G+L V P 
Sbjct  121  TLCGAGEPRSRNGLAIHVFTCNTSMSNSCFYNSDGDFLIVPQQGELLITTEFGKLLVEPN  180

Query  750  EIVVIPQGFRFAVDL  794
            EI VI QG RF+V++
Sbjct  181  EICVIQQGMRFSVEV  195



>ref|WP_038762374.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KGD47299.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+  ALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPSALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRVVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_028040177.1| homogentisate 1,2-dioxygenase [Caulobacter sp. URHA0033]
Length=427

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 132/190 (69%), Gaps = 5/190 (3%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL+YQSGFGNH SSEA  GALP GQNSP   P GLYAEQ+SGT+FT+PR  N+ SW YR+
Sbjct  2    DLQYQSGFGNHVSSEAAPGALPVGQNSPQKPPFGLYAEQLSGTAFTAPRHENRRSWLYRL  61

Query  408  KPSVTHEPFKPRVPTHERLVS-EFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
            +PS  H P+ P     +RL S  F+ +  + TP +LRW P+++P  PTDF+DGL T+ G 
Sbjct  62   RPSAGHGPYAPYA--QDRLKSGPFDAA--APTPNRLRWDPMEVPAEPTDFVDGLVTIGGN  117

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            G    + G A H+Y AN+SM +  F NADG+ LIVPQ+G L   TE GR+   PGEIVVI
Sbjct  118  GDVTTQSGMAAHLYLANRSMIDRVFQNADGELLIVPQRGALRFITEFGRIDAAPGEIVVI  177

Query  765  PQGFRFAVDL  794
            P+G RF V+L
Sbjct  178  PRGVRFRVEL  187



>ref|WP_031374102.1| homogentisate 1,2-dioxygenase [Lysobacter antibioticus]
Length=427

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 131/186 (70%), Gaps = 4/186 (2%)
 Frame = +3

Query  243  SGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPSVT  422
            SGFGN F+SEA+AGALP+GQNSP     GLYAEQ+SGT+FT+PRK N+ SW YR++P+  
Sbjct  2    SGFGNEFASEAVAGALPQGQNSPQRAAFGLYAEQLSGTAFTAPRKENRRSWLYRIRPAAM  61

Query  423  HEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSYLR  602
            H  F P      R  ++F   N   +P QLRW P+ +PE  TDF+DGLYT+ G GSS  +
Sbjct  62   HGTFAPY--GQPRFHNDFG--NGPVSPDQLRWDPLPLPEAATDFVDGLYTMAGNGSSAGQ  117

Query  603  HGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGFRF  782
            HG  IH+Y AN+SM+   F +ADG+ LIVPQ+GRL + TE G L+V P E+ VIP+G RF
Sbjct  118  HGCGIHLYAANRSMEGRYFYSADGELLIVPQQGRLLVATEFGALEVEPLEVAVIPRGVRF  177

Query  783  AVDLPD  800
             V+L D
Sbjct  178  RVELLD  183



>ref|WP_045678791.1| homogentisate 1,2-dioxygenase [Burkholderia glumae]
Length=455

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQ GF NHF++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  21   YQCGFANHFATEALPGALPEGRNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLYRIRPA  80

Query  417  VTHEPFKP--RVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
              H PF P  R      LV++F  S       P  LRW P+ +PE PTDF+DG  T+ G 
Sbjct  81   AVHGPFAPLARPQAPAALVADFADSAEVPPTPPDPLRWDPLPMPEAPTDFVDGWVTMAGN  140

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL I TE GRL+V P +I VI
Sbjct  141  GSAAAMNGCAIHLYAANRSMQGRFFYDADGELLIVPQQGRLAIATELGRLEVEPQQIAVI  200

Query  765  PQGFRFAVDLPD  800
            P+G RF+V LPD
Sbjct  201  PRGVRFSVTLPD  212



>ref|WP_011487936.1| homogentisate 1,2-dioxygenase [Burkholderia xenovorans]
 gb|ABE30239.1| homogentisate 1,2-dioxygenase [Burkholderia xenovorans LB400]
 gb|AIP32821.1| homogentisate 1,2-dioxygenase [Burkholderia xenovorans LB400]
Length=431

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 130/189 (69%), Gaps = 4/189 (2%)
 Frame = +3

Query  234  EYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKP  413
            EY +GF N F++E + GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW YR++P
Sbjct  4    EYMTGFANEFATETLPGALPESRNSPQRAPYGLYAEQFSGTAFTAPRHSNRRSWLYRIRP  63

Query  414  SVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSS  593
            +  HEPF P V T  RL+S F++      P QLRW P+  P+TP DFIDGL T+ G GS 
Sbjct  64   AAVHEPFAPLVNT--RLLSRFDEV--PPPPNQLRWNPLPYPDTPLDFIDGLVTMAGNGSP  119

Query  594  YLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQG  773
                G  IH+YTA +SM    F +ADG+ LIVPQ+GRL I+TE G L+V P EIVVIP+G
Sbjct  120  EAGTGCGIHLYTATRSMQGRFFYDADGELLIVPQEGRLLISTELGALEVEPQEIVVIPRG  179

Query  774  FRFAVDLPD  800
             RF V+LPD
Sbjct  180  VRFKVELPD  188



>gb|ACR32188.1| Homogentisate 1,2-dioxygenase [Burkholderia glumae BGR1]
 gb|AJY63998.1| homogentisate 1,2-dioxygenase [Burkholderia glumae LMG 2196 = 
ATCC 33617]
Length=463

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQ GF NHF++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  29   YQCGFANHFATEALPGALPEGRNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLYRIRPA  88

Query  417  VTHEPFKP--RVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
              H PF P  R      LV++F  S       P  LRW P+ +PE PTDF+DG  T+ G 
Sbjct  89   AVHGPFAPLARPQAPAALVADFADSAEVPPTPPDPLRWDPLPMPEAPTDFVDGWVTMAGN  148

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL I TE GRL+V P +I VI
Sbjct  149  GSAAAMNGCAIHLYAANRSMQGRFFYDADGELLIVPQQGRLAIATELGRLEVEPQQIAVI  208

Query  765  PQGFRFAVDLPD  800
            P+G RF+V LPD
Sbjct  209  PRGVRFSVTLPD  220



>ref|WP_017875198.1| homogentisate 1,2-dioxygenase [Janthinobacterium sp. CG3]
Length=435

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGFGN F++EA+ GALP  QNSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  10   YQSGFGNEFATEALPGALPAHQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLYRIRPA  69

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF  R   + R+VS F+  + +A P QLRW P+ +P+ P DFID   T+ G GS  
Sbjct  70   AMHQPF--RQIGNGRIVSRFD--DVAAPPNQLRWDPLPMPQAPVDFIDSWVTMAGNGSHA  125

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G AIH+Y AN+SMD   F NADG+ LIVPQ+GRL I TE G L V P EI V+P+G 
Sbjct  126  QQSGCAIHLYAANQSMDKRYFYNADGELLIVPQQGRLRIATELGVLDVAPREIAVVPRGV  185

Query  777  RFAVDLPD  800
            RF V LPD
Sbjct  186  RFQVSLPD  193



>ref|WP_042299640.1| homogentisate 1,2-dioxygenase [Burkholderia kururiensis]
Length=442

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 134/188 (71%), Gaps = 3/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ +W YR++P+
Sbjct  15   YQSGFANEFATEALPGALPAGRNSPQRAPYGLYAEQLSGTAFTAPRAHNRRTWLYRIRPA  74

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF   +P+ ERLV++F  +    +P QLRW P+ +P  PTDF+D   T+ G GS+ 
Sbjct  75   AMHQPFT-ALPS-ERLVADFG-TVPPTSPNQLRWDPLPMPTAPTDFVDSWVTMAGNGSAN  131

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
               G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL I TE GRL + P EI VIP+G 
Sbjct  132  AMSGCAIHLYAANRSMKDRYFYDADGELLIVPQQGRLAIATEMGRLDIEPFEIAVIPRGV  191

Query  777  RFAVDLPD  800
            RFAV LPD
Sbjct  192  RFAVSLPD  199



>ref|XP_006682365.1| hypothetical protein BATDEDRAFT_20910 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76833.1| hypothetical protein BATDEDRAFT_20910 [Batrachochytrium dendrobatidis 
JAM81]
Length=459

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 137/200 (69%), Gaps = 10/200 (5%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYR  404
            A+ +YQSGFGN F +EA+ GALP G N+P   P GLYAEQ+SGT+FT PR+  Q +W YR
Sbjct  2    ANYKYQSGFGNDFETEALPGALPVGMNTPQKVPYGLYAEQLSGTAFTVPREDQQRTWLYR  61

Query  405  VKPSVTHEPFKPRVPTHERLVSEFN-------QSNSSATPTQLRWKPVDIP-ETPTDFID  560
            ++PSV H PFK R+ + E+LV  F+       +    +TP QLRW P     E+ TDFI 
Sbjct  62   IRPSVCHAPFK-RIAS-EQLVRSFSVVGDEDSKVECESTPNQLRWSPFPFSTESNTDFIR  119

Query  561  GLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQV  740
            GL+TVCGAG++  R G AIH+Y AN  M + AF N+DGDFLIVPQ+G L I TE G + V
Sbjct  120  GLHTVCGAGAAASRSGLAIHVYAANADMKDTAFYNSDGDFLIVPQQGTLDIQTELGFMSV  179

Query  741  NPGEIVVIPQGFRFAVDLPD  800
             PGEI VI +G R+AV LPD
Sbjct  180  APGEICVIQRGIRYAVKLPD  199



>ref|WP_045600228.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis]
 gb|AJY29208.1| homogentisate 1,2-dioxygenase [Burkholderia thailandensis 34]
Length=444

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ+SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V++F  S       P QLRW P+ +P  P DF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVADFGDSGDVPPTPPNQLRWDPLPMPAQPADFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>ref|WP_043227126.1| homogentisate 1,2-dioxygenase [Burkholderia glumae]
Length=447

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 4/192 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQ GF NHF++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++PS
Sbjct  13   YQCGFANHFATEALPGALPEGRNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLYRIRPS  72

Query  417  VTHEPFKP--RVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTVCGA  584
              H PF P  R      LV++F  S       P  LRW P+ +P+ PTDF+DG  T+ G 
Sbjct  73   AVHGPFAPLARPQALAALVADFADSAEVPPTPPDPLRWDPLPMPDAPTDFVDGWVTMAGN  132

Query  585  GSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVI  764
            GS+   +G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL I TE GRL+V P +I VI
Sbjct  133  GSAAAMNGCAIHLYAANRSMQGRFFYDADGELLIVPQQGRLAIATELGRLEVEPQQIAVI  192

Query  765  PQGFRFAVDLPD  800
            P+G RF+V LPD
Sbjct  193  PRGVRFSVTLPD  204



>ref|WP_013338134.1| homogentisate 1,2-dioxygenase [Burkholderia sp. CCGE1003]
 gb|ADN56505.1| homogentisate 1,2-dioxygenase [Burkholderia sp. CCGE1003]
Length=448

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 3/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGF N F++EA+ GALP G+NSP     GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  21   YQSGFANEFATEALPGALPEGRNSPQRVAYGLYAEQLSGTAFTAPRGHNRRSWLYRIRPA  80

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF  R+P+ ER+V+ F     + +P QLRW P+ +P  PTDF+DG  T+ G G++ 
Sbjct  81   AVHKPFT-RLPS-ERIVANFADVPPT-SPDQLRWDPLPMPTEPTDFVDGWVTMAGNGAAE  137

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
               G AIH+Y AN+SM    F NADG+ LIVPQ+GRL I TE GRL V P EI VIP+G 
Sbjct  138  SMSGCAIHVYAANRSMSGRFFYNADGELLIVPQQGRLEIATELGRLDVQPFEIAVIPRGV  197

Query  777  RFAVDLPD  800
            RFAV+LPD
Sbjct  198  RFAVNLPD  205



>emb|CAQ72076.1| Homogentisate 1,2-dioxygenase [Cupriavidus taiwanensis LMG 19424]
Length=456

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 138/209 (66%), Gaps = 4/209 (2%)
 Frame = +3

Query  174  TDMESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISG  353
            T  E++D+ +  +    A+  Y SGF N F++EA+ GALP GQNSP   P GLYAEQ+SG
Sbjct  9    THPETQDNTMDLTHTQLAEHGYMSGFANEFATEALPGALPVGQNSPQRAPYGLYAEQLSG  68

Query  354  TSFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDI  533
            T+FT+PR  N+ SW YR++P+  H+PF   +    R +S F+Q   S  P Q+RW P  +
Sbjct  69   TAFTAPRAHNRRSWLYRIRPAAMHKPFT--LIEQSRFLSRFDQVPPS--PNQMRWSPPAM  124

Query  534  PETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWI  713
            P  PTDF+DG+ T+ G G      G  IH+Y AN+SM +  F NADG+ LIVPQ+GRL +
Sbjct  125  PSVPTDFVDGIVTMAGNGGPEAMTGCGIHLYLANRSMQDRFFYNADGEMLIVPQQGRLLM  184

Query  714  TTECGRLQVNPGEIVVIPQGFRFAVDLPD  800
             TE GRL V P EIVVIP+G RF V+LPD
Sbjct  185  VTELGRLAVEPHEIVVIPRGVRFRVELPD  213



>ref|WP_030102015.1| homogentisate 1,2-dioxygenase [Burkholderia sp. K24]
 gb|KFX62953.1| homogentisate 1,2-dioxygenase [Burkholderia sp. K24]
Length=448

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 139/199 (70%), Gaps = 3/199 (2%)
 Frame = +3

Query  204  TGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLN  383
            T S +   +  YQSGF N F+SEA+ GALP G+NSP     GLYAEQ+SGT+FT+PR  N
Sbjct  10   TASSRLEIEPGYQSGFANEFASEALPGALPEGRNSPQRAAYGLYAEQLSGTAFTAPRGHN  69

Query  384  QLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDG  563
            + SW YR++P+  H+PF  ++P+ ERLV+ F +  ++  P QLRW  + +P  PTDFIDG
Sbjct  70   RRSWLYRIRPAAVHKPFT-QLPS-ERLVANFAEVPATP-PNQLRWDALPMPTEPTDFIDG  126

Query  564  LYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVN  743
              T+ G GS+   +G AIH+Y AN+SM +  F +ADG+ LIVPQ+GRL I TE G+L V 
Sbjct  127  WVTMAGNGSAEAMNGCAIHLYAANRSMQDRFFYSADGELLIVPQEGRLHIATEMGQLDVE  186

Query  744  PGEIVVIPQGFRFAVDLPD  800
            P EI VIP+G RFAV LPD
Sbjct  187  PFEIAVIPRGVRFAVSLPD  205



>gb|AAG17116.1|AF189238_1 homogentisate 1,2-dioxygenase [Danio rerio]
Length=393

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 134/195 (69%), Gaps = 9/195 (5%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            A L+Y SGFGN FSSE     G+LP GQN+P VCP GLYAEQ+SG++FT PR  N+ SW 
Sbjct  2    AGLKYMSGFGNEFSSEDPRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWL  61

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP---ETPTDFIDGLY  569
            YR+ PSV H+PF  R+   + L   +N+      P QLRWKP +IP   E   DF+ GL+
Sbjct  62   YRILPSVRHKPFT-RMSCGD-LTENWNEVEPD--PNQLRWKPFNIPKSSEKKVDFVSGLH  117

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            TVCGAG S  R+G AIHMY+ N SM +  F NADGDFLIVPQ+G + ITTE G++ V P 
Sbjct  118  TVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEILITTEFGKMMVEPN  177

Query  750  EIVVIPQGFRFAVDL  794
            EI VI QG RF+VD+
Sbjct  178  EICVIQQGMRFSVDV  192



>gb|EIE88763.1| homogentisate 1,2-dioxygenase [Rhizopus delemar RA 99-880]
Length=431

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 130/189 (69%), Gaps = 3/189 (2%)
 Frame = +3

Query  240  QSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPSV  419
             +GFGNHFSSEA+  ALP+GQN+P  CP  LYAEQ+SGT+FT PR  NQ SW YR++PSV
Sbjct  1    MNGFGNHFSSEALPDALPKGQNTPQKCPYNLYAEQLSGTAFTVPRTHNQRSWLYRIRPSV  60

Query  420  THEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP--ETPTDFIDGLYTVCGAGSS  593
             H PFKP       LVS++   +   TPTQ+RW P D+P  +   +FI GL ++ GAG  
Sbjct  61   VHAPFKP-CDLSNLLVSKYGGDDVLITPTQIRWSPFDLPKDDEKVNFIQGLKSLAGAGDP  119

Query  594  YLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQG  773
              R G A+H+YTAN  M   AF N+DGDFLIVPQ+G L I TE G+++ +P EIVVI +G
Sbjct  120  ACRSGLAVHIYTANTDMGKTAFYNSDGDFLIVPQQGTLDIYTEFGKIKASPNEIVVIQRG  179

Query  774  FRFAVDLPD  800
             R++V L D
Sbjct  180  VRYSVSLAD  188



>ref|WP_013587215.1| homogentisate 1,2-dioxygenase [Burkholderia sp. CCGE1001]
 gb|ADX53951.1| homogentisate 1,2-dioxygenase [Burkholderia sp. CCGE1001]
Length=448

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 142/208 (68%), Gaps = 4/208 (2%)
 Frame = +3

Query  177  DMESKDDNVTGSPKFPADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGT  356
            D  ++  +  GS +   +  YQSGF N F++EA+ GALP G+NSP     GLYAEQ+SGT
Sbjct  2    DTSTRQPDTAGS-RLEIEPGYQSGFANEFATEALPGALPVGRNSPQRAAYGLYAEQLSGT  60

Query  357  SFTSPRKLNQLSWFYRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP  536
            +FT+PR  N+ SW YR++P+  H+PF P +P+  RLV+ F +   +  P QLRW  + +P
Sbjct  61   AFTAPRGHNRRSWLYRIRPAAVHKPFTP-LPS-ARLVANFAEVPPT-PPNQLRWDALPMP  117

Query  537  ETPTDFIDGLYTVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWIT  716
              PTDFIDG  T+ G G++    G AIH+Y AN+SM +  F NADG+ LIVPQ+GRL I 
Sbjct  118  AEPTDFIDGWVTMAGNGAAESMSGCAIHLYAANRSMQDRFFYNADGELLIVPQEGRLDIA  177

Query  717  TECGRLQVNPGEIVVIPQGFRFAVDLPD  800
            TE GRL+V P EIVVIP+G RFAV LPD
Sbjct  178  TEMGRLEVTPFEIVVIPRGVRFAVSLPD  205



>ref|WP_014189341.1| homogentisate 1,2-dioxygenase [Azospirillum lipoferum]
 emb|CBS90486.1| homogentisate 1,2-dioxygenase [Azospirillum lipoferum 4B]
Length=434

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 134/193 (69%), Gaps = 4/193 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P+   YQSGFGN F++EA+ GALP G+NSP   P GLYAEQISGT+FT+PR  N+ SW Y
Sbjct  3    PSAFTYQSGFGNEFATEALPGALPVGRNSPQRPPYGLYAEQISGTAFTAPRAHNRRSWLY  62

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCG  581
            R++P+V HEPF+P      RL S F++    A PTQLRW P  +P+  TDF+ GL T+ G
Sbjct  63   RIRPAVVHEPFQPM--ESGRLTSRFDEV--PAPPTQLRWNPPPMPDMATDFVAGLVTMGG  118

Query  582  AGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVV  761
             G    + G  IH+Y AN+SM+   F +ADG+ LIVPQ+GRL + TE G L+V P EI +
Sbjct  119  NGGPQAQAGCGIHLYAANRSMEGRFFYDADGELLIVPQQGRLRLFTELGALEVEPQEIAL  178

Query  762  IPQGFRFAVDLPD  800
            IP+G RF V+LPD
Sbjct  179  IPRGLRFRVELPD  191



>ref|WP_026067841.1| homogentisate 1,2-dioxygenase [Pusillimonas noertemannii]
Length=446

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            Y SGFGN  ++EA+ GALP GQNSP     GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  19   YMSGFGNEHATEALPGALPVGQNSPQRVAYGLYAEQLSGTAFTAPRSRNRRSWLYRIRPA  78

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H PF+P   + E LV++FN +  +  P QLRW PV IPE  TDF+ GL T+ G GS+ 
Sbjct  79   AVHRPFEPL--SSEHLVADFN-TVPATPPYQLRWNPVPIPELATDFVAGLRTMAGNGSAT  135

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
               G A+H+Y AN+SM +  FC+ADG+ LIVPQ+GRL + TE GR+ + P EI VIP+G 
Sbjct  136  QMSGCAVHVYAANRSMTDQFFCDADGELLIVPQRGRLQLDTEMGRIDIEPLEIAVIPRGV  195

Query  777  RFAVDLPD  800
            RF V LPD
Sbjct  196  RFRVILPD  203



>ref|WP_036115841.1| MULTISPECIES: homogentisate 1,2-dioxygenase [Luteibacter]
Length=436

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQ+GFGN F++EA+AG LP GQNSP     GLYAEQ+SG++FT+PR  N+ SW YR++P+
Sbjct  10   YQTGFGNEFATEAVAGVLPTGQNSPQQVAQGLYAEQLSGSAFTAPRHRNRRSWLYRIRPA  69

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H PF      HE   + F ++  SATP Q+RW P+ +P TPTDF+DGL T+ G G + 
Sbjct  70   AQHSPFS--ALGHETFHNRFQEA--SATPNQMRWDPLPMPSTPTDFLDGLVTMGGNGGAE  125

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
             + G  IH+Y AN+SM+   F +ADG+ LIVPQ+GRL I TE G L V P EI V+P+G 
Sbjct  126  EQAGIGIHLYCANRSMEGRYFYDADGELLIVPQQGRLRIRTELGVLDVAPLEIAVVPRGV  185

Query  777  RFAVDLPD  800
            RF V+LPD
Sbjct  186  RFLVELPD  193



>ref|WP_012287671.1| homogentisate 1,2-dioxygenase [Caulobacter sp. K31]
 sp|B0T816.1|HGD_CAUSK RecName: Full=Homogentisate 1,2-dioxygenase; Short=HGDO; AltName: 
Full=Homogentisate oxygenase; AltName: Full=Homogentisic 
acid oxidase; AltName: Full=Homogentisicase [Caulobacter sp. 
K31]
 gb|ABZ72779.1| homogentisate 1,2-dioxygenase [Caulobacter sp. K31]
Length=427

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 129/189 (68%), Gaps = 3/189 (2%)
 Frame = +3

Query  228  DLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRV  407
            DL+YQSGF NHFS+EA+ GALP GQNSP   P GLYAEQ+SGT+FT+PR  N+ SW YR+
Sbjct  2    DLQYQSGFANHFSTEAVPGALPVGQNSPQAPPYGLYAEQLSGTAFTAPRHENRRSWLYRL  61

Query  408  KPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAG  587
            +PS  H P+ P V   ERL S      +  TP +LRW P++IPE P DF+DGL T+ G G
Sbjct  62   RPSAGHGPYAPYV--QERLKSG-PFGAAVPTPNRLRWDPLEIPEAPLDFVDGLVTLAGNG  118

Query  588  SSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIP  767
                + G A H+Y AN+SM +  F NADG+ LIVPQ G L   TE G +   PGE+VVIP
Sbjct  119  DVATQAGMAAHLYLANRSMIDRVFQNADGELLIVPQLGALRFVTELGVIDAAPGEVVVIP  178

Query  768  QGFRFAVDL  794
            +G RF V+L
Sbjct  179  RGVRFRVEL  187



>ref|WP_017333320.1| homogentisate 1,2-dioxygenase [Burkholderia pyrrocinia]
Length=444

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            PA   Y SGF N F++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ +W Y
Sbjct  8    PATAGYLSGFANEFATEALPGALPHGRNSPQRAPYGLYAEQLSGTAFTAPRSHNRRTWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+P     +RLVSEF  S       P QLRW P+ +P  P DF++G  T+
Sbjct  68   RIRPAAVHRPFEP-FGGPQRLVSEFGDSPDVPPTPPNQLRWNPLPMPVEPVDFVEGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+   +G AIH+Y AN+SM +  F N DG+ LIVPQ+GRL I TE GRL V P EI
Sbjct  127  AGNGSAAAMNGCAIHLYAANRSMQDRFFYNTDGELLIVPQQGRLQIATELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RF V LPD
Sbjct  187  AVIPRGVRFTVALPD  201



>ref|WP_044357680.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|KIX45141.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
Length=444

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNSS--ATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+GRL+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGRLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV L D
Sbjct  187  AVIPRGVRFAVALLD  201



>ref|WP_042310699.1| homogentisate 1,2-dioxygenase [Burkholderia terrae]
Length=440

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 3/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGF N F++EA+ GALP+G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+
Sbjct  13   YQSGFANEFATEALPGALPQGRNSPQRAPYGLYAEQLSGTAFTAPRGHNRRSWLYRIRPA  72

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              H+PF   +P+H RLV+ F     +  P QLRW P+ +P  PTDFIDG  T+ G G++ 
Sbjct  73   AVHQPFT-ALPSH-RLVANFADVPPT-PPNQLRWDPLPMPTEPTDFIDGWVTMAGNGAAE  129

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
              +G AIH+Y AN+SM +  F NADG+ LIVPQ GRL I TE G+L V P EI VIP+G 
Sbjct  130  AMNGCAIHVYAANQSMQDRYFYNADGELLIVPQAGRLSIFTEMGKLDVEPFEIAVIPRGV  189

Query  777  RFAVDLPD  800
            RF+V LPD
Sbjct  190  RFSVALPD  197



>ref|WP_025772404.1| homogentisate 1,2-dioxygenase [Sphingomonas sp. BHC-A]
Length=429

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = +3

Query  240  QSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPSV  419
             +GFGNHF++EA+ GALP G+NSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P+ 
Sbjct  1    MTGFGNHFATEAVPGALPVGRNSPQHAPYGLYAEQLSGTAFTAPRAENRRSWLYRLRPAA  60

Query  420  THEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSYL  599
             H P++P     + L+          TP +LRW P+ IPE P DFIDGL + CGAG    
Sbjct  61   NHPPYRPY--EADTLLRSGPFDEVPPTPNRLRWNPLPIPERPLDFIDGLISYCGAGDPAA  118

Query  600  RHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGFR  779
              G A+H+Y AN+ M+  AF NADG+ LIVPQ+GRL +TTE G + + P +I +IP+G R
Sbjct  119  GEGLAVHLYAANRPMEKRAFANADGEMLIVPQQGRLRLTTEMGAMDIAPHQIALIPRGVR  178

Query  780  FAVDLPD  800
            F VDLPD
Sbjct  179  FKVDLPD  185



>ref|WP_017225367.1| homogentisate 1,2-dioxygenase [Cupriavidus basilensis]
Length=446

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = +3

Query  237  YQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFYRVKPS  416
            YQSGF N F++EA+ GALP GQNSP   P GLYAEQ+SGT+FT+PR  N+ SW YR++P 
Sbjct  20   YQSGFANEFATEALPGALPVGQNSPQRAPYGLYAEQLSGTAFTAPRAHNRRSWLYRIRPG  79

Query  417  VTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIPETPTDFIDGLYTVCGAGSSY  596
              HEPF  R+    RLVS F++   S  P Q+RW P  +P  PTDF+DG+ T+ G G   
Sbjct  80   AMHEPFT-RM-AQSRLVSRFDEVPPS--PNQMRWSPPAMPSEPTDFVDGIVTMAGNGGPE  135

Query  597  LRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEIVVIPQGF  776
              +G  IH+Y AN+SM +  F NADG+ LIVPQ+GRL + TE G L+V P EIVV+P+G 
Sbjct  136  AMNGCGIHLYLANRSMTDRFFYNADGEMLIVPQQGRLRLATEMGLLEVEPQEIVVVPRGV  195

Query  777  RFAVDLPD  800
            RF V+LPD
Sbjct  196  RFRVELPD  203



>ref|WP_038717067.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AIP70089.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei]
 gb|AJW91630.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 406e]
Length=444

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  8    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  67

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  68   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  126

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+G L+I TE GRL V P EI
Sbjct  127  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGCLFIMTELGRLDVEPFEI  186

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  187  AVIPRGVRFAVALPD  201



>gb|EDO86086.1| homogentisate 1,2-dioxygenase [Burkholderia pseudomallei 406e]
Length=442

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 131/195 (67%), Gaps = 3/195 (2%)
 Frame = +3

Query  222  PADLEYQSGFGNHFSSEAIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWFY  401
            P +  YQSGF N F++EA+ GALP  +NSP   P GLYAEQ SGT+FT+PR  N+ SW Y
Sbjct  6    PGEAGYQSGFANEFATEALPGALPHARNSPQRAPYGLYAEQFSGTAFTAPRGHNRRSWLY  65

Query  402  RVKPSVTHEPFKPRVPTHERLVSEFNQSNS--SATPTQLRWKPVDIPETPTDFIDGLYTV  575
            R++P+  H PF+  V    R+V+EF  S+      P QLRW P+ +P  PTDF+DG  T+
Sbjct  66   RIRPAAVHRPFE-LVSGERRIVAEFGDSDDVPPTPPNQLRWDPLPMPAQPTDFVDGWVTM  124

Query  576  CGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPGEI  755
             G GS+    G AIH+Y AN+SM    F +ADG+ LIVPQ+G L+I TE GRL V P EI
Sbjct  125  AGNGSAAAMSGCAIHLYAANRSMRERFFYSADGELLIVPQEGCLFIMTELGRLDVEPFEI  184

Query  756  VVIPQGFRFAVDLPD  800
             VIP+G RFAV LPD
Sbjct  185  AVIPRGVRFAVALPD  199



>ref|NP_694498.2| homogentisate 1,2-dioxygenase [Danio rerio]
 gb|AAH64283.1| Hgd protein [Danio rerio]
 gb|AAI52650.1| Homogentisate 1,2-dioxygenase [Danio rerio]
Length=443

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 134/195 (69%), Gaps = 9/195 (5%)
 Frame = +3

Query  225  ADLEYQSGFGNHFSSE--AIAGALPRGQNSPLVCPLGLYAEQISGTSFTSPRKLNQLSWF  398
            A L+Y SGFGN FSSE     G+LP GQN+P VCP GLYAEQ+SG++FT PR  N+ SW 
Sbjct  2    AGLKYMSGFGNEFSSEDPRCPGSLPEGQNNPQVCPYGLYAEQLSGSAFTCPRSSNKRSWL  61

Query  399  YRVKPSVTHEPFKPRVPTHERLVSEFNQSNSSATPTQLRWKPVDIP---ETPTDFIDGLY  569
            YR+ PSV H+PF  R+   + L   +N+      P QLRWKP +IP   E   DF+ GL+
Sbjct  62   YRILPSVRHKPFT-RMSCGD-LTENWNEVEPD--PNQLRWKPFNIPKSSEKKVDFVSGLH  117

Query  570  TVCGAGSSYLRHGFAIHMYTANKSMDNCAFCNADGDFLIVPQKGRLWITTECGRLQVNPG  749
            TVCGAG S  R+G AIHMY+ N SM +  F NADGDFLIVPQ+G + ITTE G++ V P 
Sbjct  118  TVCGAGDSKSRNGIAIHMYSCNTSMTDKCFQNADGDFLIVPQQGEILITTEFGKMMVEPN  177

Query  750  EIVVIPQGFRFAVDL  794
            EI VI QG RF+VD+
Sbjct  178  EICVIQQGMRFSVDV  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1655620752480