BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12091

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783985.1|  PREDICTED: protein EXECUTER 1, chloroplastic       197   8e-55   Nicotiana sylvestris
ref|XP_010322554.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    197   1e-54   Solanum lycopersicum
ref|XP_004241496.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    196   2e-54   Solanum lycopersicum
ref|XP_009601214.1|  PREDICTED: protein EXECUTER 1, chloroplastic       195   5e-54   Nicotiana tomentosiformis
ref|XP_011071839.1|  PREDICTED: protein EXECUTER 1, chloroplastic       195   6e-54   Sesamum indicum [beniseed]
ref|XP_011028578.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    193   3e-53   Populus euphratica
ref|XP_008374445.1|  PREDICTED: protein EXECUTER 1, chloroplastic       193   3e-53   
gb|EYU42561.1|  hypothetical protein MIMGU_mgv1a002602mg                192   5e-53   Erythranthe guttata [common monkey flower]
gb|KDO69690.1|  hypothetical protein CISIN_1g0061461mg                  189   1e-52   Citrus sinensis [apfelsine]
gb|KDO69689.1|  hypothetical protein CISIN_1g0061461mg                  189   1e-52   Citrus sinensis [apfelsine]
emb|CDP12382.1|  unnamed protein product                                191   1e-52   Coffea canephora [robusta coffee]
ref|XP_011044311.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    191   2e-52   Populus euphratica
ref|XP_002318039.2|  hypothetical protein POPTR_0012s08110g             191   2e-52   
ref|XP_002321589.2|  hypothetical protein POPTR_0015s08620g             190   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_007210299.1|  hypothetical protein PRUPE_ppa002543mg             190   3e-52   Prunus persica
ref|XP_002511410.1|  EXECUTER1 protein, chloroplast precursor, pu...    189   7e-52   Ricinus communis
ref|XP_006439802.1|  hypothetical protein CICLE_v10019209mg             187   3e-51   
ref|XP_006476766.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    187   3e-51   Citrus sinensis [apfelsine]
gb|KCW49293.1|  hypothetical protein EUGRSUZ_K02848                     184   9e-51   Eucalyptus grandis [rose gum]
ref|XP_012080080.1|  PREDICTED: protein EXECUTER 2, chloroplastic       186   9e-51   Jatropha curcas
gb|KJB53137.1|  hypothetical protein B456_008G294800                    184   3e-50   Gossypium raimondii
ref|XP_009363034.1|  PREDICTED: protein EXECUTER 1, chloroplastic       184   5e-50   
gb|KCW49292.1|  hypothetical protein EUGRSUZ_K02848                     183   5e-50   Eucalyptus grandis [rose gum]
ref|XP_010101202.1|  hypothetical protein L484_015006                   183   6e-50   
gb|KCW49291.1|  hypothetical protein EUGRSUZ_K02848                     183   7e-50   Eucalyptus grandis [rose gum]
ref|XP_010678752.1|  PREDICTED: protein EXECUTER 1, chloroplastic       183   1e-49   
ref|XP_010037568.1|  PREDICTED: protein EXECUTER 1, chloroplastic       183   1e-49   Eucalyptus grandis [rose gum]
gb|KJB53138.1|  hypothetical protein B456_008G294800                    183   1e-49   Gossypium raimondii
ref|XP_008367525.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    183   1e-49   
ref|XP_004501935.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    182   1e-49   Cicer arietinum [garbanzo]
ref|XP_007036194.1|  EXECUTER1 protein, chloroplast, putative iso...    182   2e-49   
ref|XP_003601283.1|  Protein EXECUTER                                   182   2e-49   Medicago truncatula
ref|XP_007036192.1|  EXECUTER1 protein, chloroplast, putative iso...    182   2e-49   
gb|EYU17659.1|  hypothetical protein MIMGU_mgv1a002899mg                181   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_004298937.1|  PREDICTED: protein EXECUTER 2, chloroplastic       181   5e-49   Fragaria vesca subsp. vesca
ref|XP_010243014.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    179   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_007138088.1|  hypothetical protein PHAVU_009G179300g             177   2e-48   Phaseolus vulgaris [French bean]
gb|EPS59467.1|  hypothetical protein M569_15340                         177   4e-48   Genlisea aurea
ref|XP_002279734.3|  PREDICTED: protein EXECUTER 1, chloroplastic       178   8e-48   Vitis vinifera
ref|XP_008453095.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    176   3e-47   Cucumis melo [Oriental melon]
ref|XP_010251274.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    176   4e-47   Nelumbo nucifera [Indian lotus]
ref|XP_003522373.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    176   4e-47   Glycine max [soybeans]
ref|XP_007138087.1|  hypothetical protein PHAVU_009G179300g             175   6e-47   Phaseolus vulgaris [French bean]
ref|XP_003528152.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    175   7e-47   Glycine max [soybeans]
ref|XP_010536627.1|  PREDICTED: protein EXECUTER 1, chloroplastic       174   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_011657482.1|  PREDICTED: protein EXECUTER 2, chloroplastic       172   5e-46   Cucumis sativus [cucumbers]
ref|XP_009380345.1|  PREDICTED: protein EXECUTER 1, chloroplastic       172   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940041.1|  PREDICTED: protein EXECUTER 1, chloroplastic       171   2e-45   Elaeis guineensis
ref|XP_006415752.1|  hypothetical protein EUTSA_v10007043mg             166   8e-44   Eutrema salsugineum [saltwater cress]
gb|AAM20453.1|  unknown protein                                         162   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893472.1|  predicted protein                                  164   5e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_008239756.1|  PREDICTED: LOW QUALITY PROTEIN: protein EXEC...    163   1e-42   
emb|CDY11792.1|  BnaC03g57860D                                          162   3e-42   Brassica napus [oilseed rape]
gb|AAD45989.1|AC005916_1  EST gb|N65787 comes from this gene            160   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109798.1|  PREDICTED: protein EXECUTER 1, chloroplastic       161   7e-42   Brassica rapa
ref|NP_564287.1|  protein EXECUTER 2                                    160   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001146198.1|  hypothetical protein                               158   7e-41   Zea mays [maize]
ref|XP_006304413.1|  hypothetical protein CARUB_v10010978mg             158   7e-41   Capsella rubella
emb|CDX90093.1|  BnaA08g18910D                                          158   8e-41   
ref|XP_004967955.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    156   3e-40   Setaria italica
ref|XP_006844970.1|  PREDICTED: protein EXECUTER 2, chloroplastic       154   1e-39   
ref|XP_010478095.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    152   6e-39   Camelina sativa [gold-of-pleasure]
gb|EAY72221.1|  hypothetical protein OsI_00074                          152   8e-39   Oryza sativa Indica Group [Indian rice]
sp|Q657X6.1|EXEC2_ORYSJ  RecName: Full=Protein EXECUTER 2, chloro...    152   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008453096.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    151   1e-38   
ref|XP_010230337.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    151   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_003565224.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    151   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_009415819.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    150   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA53814.1|  TPA: hypothetical protein ZEAMMB73_854553              150   3e-38   
tpg|DAA53811.1|  TPA: hypothetical protein ZEAMMB73_854553              149   3e-38   
ref|XP_009415820.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    150   3e-38   
ref|XP_008797614.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    145   1e-37   
ref|XP_010499237.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    149   2e-37   Camelina sativa [gold-of-pleasure]
ref|NP_001182951.1|  hypothetical protein                               148   2e-37   Zea mays [maize]
gb|KFK28712.1|  hypothetical protein AALP_AA7G037200                    146   2e-36   Arabis alpina [alpine rockcress]
ref|XP_010460515.1|  PREDICTED: protein EXECUTER 1, chloroplastic       143   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004508896.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    129   1e-30   
ref|XP_006645432.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    127   7e-30   
emb|CAN68092.1|  hypothetical protein VITISV_012749                     126   5e-29   Vitis vinifera
ref|XP_010254545.1|  PREDICTED: protein EXECUTER 1, chloroplastic       118   1e-26   Nelumbo nucifera [Indian lotus]
gb|KCW63355.1|  hypothetical protein EUGRSUZ_G009901                    112   6e-26   Eucalyptus grandis [rose gum]
ref|XP_006852930.1|  PREDICTED: protein EXECUTER 1, chloroplastic       115   1e-25   Amborella trichopoda
ref|XP_002455330.1|  hypothetical protein SORBIDRAFT_03g008585          108   2e-25   
ref|XP_002967707.1|  hypothetical protein SELMODRAFT_227764             114   4e-25   Selaginella moellendorffii
ref|XP_002271011.1|  PREDICTED: protein EXECUTER 1, chloroplastic       114   7e-25   Vitis vinifera
ref|XP_002964327.1|  hypothetical protein SELMODRAFT_166436             113   1e-24   
ref|XP_010065730.1|  PREDICTED: protein EXECUTER 1, chloroplastic       112   1e-24   Eucalyptus grandis [rose gum]
ref|XP_007042830.1|  Executer 1 isoform 4                               110   3e-24   
ref|XP_006351723.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    112   3e-24   Solanum tuberosum [potatoes]
ref|XP_007042829.1|  Executer 1 isoform 3                               110   9e-24   
ref|XP_004230540.1|  PREDICTED: protein EXECUTER 1, chloroplastic       110   9e-24   Solanum lycopersicum
ref|XP_007042827.1|  Executer 1 isoform 1                               110   1e-23   
ref|XP_004504847.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    110   1e-23   
ref|XP_002532765.1|  EXECUTER1 protein, chloroplast precursor, pu...    109   1e-23   Ricinus communis
ref|XP_011087954.1|  PREDICTED: protein EXECUTER 1, chloroplastic       109   2e-23   Sesamum indicum [beniseed]
ref|XP_010943895.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    109   2e-23   Elaeis guineensis
ref|XP_010943896.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    109   2e-23   Elaeis guineensis
ref|XP_008382212.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    104   4e-23   
ref|XP_008348881.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    104   4e-23   
ref|XP_010691393.1|  PREDICTED: protein EXECUTER 1, chloroplastic       108   5e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012081365.1|  PREDICTED: protein EXECUTER 1, chloroplastic       107   7e-23   Jatropha curcas
gb|EMT33306.1|  hypothetical protein F775_23580                         107   1e-22   
ref|XP_010527017.1|  PREDICTED: LOW QUALITY PROTEIN: protein EXEC...    107   2e-22   Tarenaya hassleriana [spider flower]
gb|KJB79580.1|  hypothetical protein B456_013G055300                    106   2e-22   Gossypium raimondii
ref|XP_002980519.1|  hypothetical protein SELMODRAFT_178249             105   2e-22   
ref|XP_002976793.1|  hypothetical protein SELMODRAFT_175826             105   3e-22   
emb|CDO97385.1|  unnamed protein product                                106   3e-22   Coffea canephora [robusta coffee]
ref|XP_001764388.1|  predicted protein                                  105   3e-22   
ref|XP_009766666.1|  PREDICTED: protein EXECUTER 1, chloroplastic       106   3e-22   Nicotiana sylvestris
gb|KJB79578.1|  hypothetical protein B456_013G055300                    105   3e-22   Gossypium raimondii
gb|KJB79577.1|  hypothetical protein B456_013G055300                    105   3e-22   Gossypium raimondii
gb|EYU18410.1|  hypothetical protein MIMGU_mgv1a005491mg                103   5e-22   Erythranthe guttata [common monkey flower]
ref|XP_011043046.1|  PREDICTED: protein EXECUTER 1, chloroplastic       105   7e-22   Populus euphratica
ref|XP_001758844.1|  predicted protein                                  104   7e-22   
ref|XP_002323934.2|  hypothetical protein POPTR_0017s07060g             104   7e-22   
ref|XP_007199722.1|  hypothetical protein PRUPE_ppa002360mg             104   9e-22   Prunus persica
ref|XP_008237129.1|  PREDICTED: protein EXECUTER 1, chloroplastic       104   9e-22   Prunus mume [ume]
gb|AES90588.2|  executer 1                                              104   1e-21   Medicago truncatula
ref|XP_007159151.1|  hypothetical protein PHAVU_002G213200g             104   1e-21   Phaseolus vulgaris [French bean]
ref|XP_003608391.1|  Protein EXECUTER                                   104   2e-21   
ref|XP_008373217.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    103   2e-21   Malus domestica [apple tree]
ref|XP_009366321.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    103   3e-21   Pyrus x bretschneideri [bai li]
ref|XP_009400393.1|  PREDICTED: protein EXECUTER 1, chloroplastic       102   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN19019.1|  Protein EXECUTER 1, chloroplastic                       102   5e-21   Glycine soja [wild soybean]
ref|XP_003541783.2|  PREDICTED: protein EXECUTER 1, chloroplastic...    102   5e-21   Glycine max [soybeans]
gb|KJB53139.1|  hypothetical protein B456_008G294800                    101   5e-21   Gossypium raimondii
emb|CDX72417.1|  BnaC07g44390D                                          101   1e-20   
ref|XP_009138201.1|  PREDICTED: protein EXECUTER 1, chloroplastic...    100   2e-20   Brassica rapa
ref|XP_002869202.1|  hypothetical protein ARALYDRAFT_913050             100   2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_009602483.1|  PREDICTED: protein EXECUTER 1, chloroplastic       100   2e-20   Nicotiana tomentosiformis
gb|EPS72739.1|  hypothetical protein M569_02016                         100   2e-20   Genlisea aurea
ref|XP_008455152.1|  PREDICTED: protein EXECUTER 1, chloroplastic       100   2e-20   
ref|NP_567929.1|  protein EXECUTER 1                                  99.8    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137062.1|  PREDICTED: protein EXECUTER 1, chloroplastic     99.8    4e-20   Cucumis sativus [cucumbers]
ref|XP_008776948.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  99.4    6e-20   Phoenix dactylifera
ref|XP_008776947.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  99.4    6e-20   Phoenix dactylifera
ref|XP_003528395.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  99.0    7e-20   Glycine max [soybeans]
ref|XP_006423689.1|  hypothetical protein CICLE_v100298792mg          95.5    1e-19   
ref|XP_007148361.1|  hypothetical protein PHAVU_006G201700g           97.1    3e-19   Phaseolus vulgaris [French bean]
ref|XP_003532602.2|  PREDICTED: protein EXECUTER 1, chloroplastic...  97.1    4e-19   Glycine max [soybeans]
ref|XP_009368302.1|  PREDICTED: protein EXECUTER 1, chloroplastic     96.3    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_006494691.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  95.5    1e-18   Citrus sinensis [apfelsine]
ref|XP_004290412.1|  PREDICTED: protein EXECUTER 1, chloroplastic     94.7    2e-18   Fragaria vesca subsp. vesca
ref|XP_006412332.1|  hypothetical protein EUTSA_v10024585mg           94.7    2e-18   
ref|XP_001762432.1|  predicted protein                                90.5    9e-18   
ref|XP_006283255.1|  hypothetical protein CARUB_v10004291mg           92.0    1e-17   Capsella rubella
emb|CDY28313.1|  BnaC03g66460D                                        92.0    2e-17   Brassica napus [oilseed rape]
ref|XP_010432534.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  92.0    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010447214.1|  PREDICTED: protein EXECUTER 1, chloroplastic     91.7    2e-17   Camelina sativa [gold-of-pleasure]
gb|KJB77570.1|  hypothetical protein B456_012G144000                  91.7    2e-17   Gossypium raimondii
gb|KHG21655.1|  Protein EXECUTER 1, chloroplastic                     91.7    2e-17   Gossypium arboreum [tree cotton]
ref|XP_009108781.1|  PREDICTED: protein EXECUTER 1, chloroplastic     91.7    3e-17   Brassica rapa
ref|XP_010437740.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  91.3    3e-17   Camelina sativa [gold-of-pleasure]
gb|KHG21654.1|  Protein EXECUTER 1, chloroplastic                     91.3    3e-17   Gossypium arboreum [tree cotton]
gb|EAZ16473.1|  hypothetical protein OsJ_31943                        90.5    5e-17   Oryza sativa Japonica Group [Japonica rice]
sp|Q7XD99.1|EXEC1_ORYSJ  RecName: Full=Protein EXECUTER 1, chloro...  90.5    6e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574086.1|  PREDICTED: protein EXECUTER 1, chloroplastic     90.5    6e-17   Brachypodium distachyon [annual false brome]
ref|XP_004982803.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  90.5    6e-17   Setaria italica
ref|XP_006662456.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  89.4    1e-16   
ref|NP_001159303.1|  uncharacterized protein LOC100304395             89.0    2e-16   Zea mays [maize]
emb|CDY46102.1|  BnaA03g52660D                                        89.0    2e-16   Brassica napus [oilseed rape]
dbj|BAJ87615.1|  predicted protein                                    86.7    7e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92734.1|  predicted protein                                    86.7    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89988.1|  predicted protein                                    86.7    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008664851.1|  PREDICTED: protein EXECUTER 1, chloroplastic...  85.9    2e-15   Zea mays [maize]
gb|EMS51015.1|  hypothetical protein TRIUR3_01679                     82.4    2e-14   Triticum urartu
emb|CAA20576.1|  hypothetical protein                                 81.3    6e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EMT14990.1|  hypothetical protein F775_08039                       74.3    4e-13   
gb|EMT28755.1|  hypothetical protein F775_09989                       76.3    2e-12   
ref|XP_002500729.1|  hypothetical protein MICPUN_57395                70.9    2e-10   Micromonas commoda
ref|XP_002954035.1|  hypothetical protein VOLCADRAFT_106212           67.4    2e-09   Volvox carteri f. nagariensis
ref|XP_005849264.1|  hypothetical protein CHLNCDRAFT_51231            65.5    9e-09   Chlorella variabilis
gb|KDO53999.1|  hypothetical protein CISIN_1g0056621mg                61.2    6e-08   Citrus sinensis [apfelsine]
gb|KDO69693.1|  hypothetical protein CISIN_1g0061461mg                61.2    2e-07   Citrus sinensis [apfelsine]
ref|XP_001422141.1|  predicted protein                                59.7    7e-07   Ostreococcus lucimarinus CCE9901
ref|XP_006439803.1|  hypothetical protein CICLE_v10019209mg           59.3    8e-07   
emb|CEG00751.1|  Protein of unknown function DUF3506                  59.3    9e-07   Ostreococcus tauri
emb|CAN67006.1|  hypothetical protein VITISV_020408                   58.9    1e-06   Vitis vinifera
ref|XP_003084183.1|  unnamed protein product                          58.5    2e-06   
ref|XP_001703381.1|  predicted protein                                53.9    5e-05   Chlamydomonas reinhardtii
ref|XP_005650349.1|  RNB-domain-containing protein                    51.6    4e-04   Coccomyxa subellipsoidea C-169



>ref|XP_009783985.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana sylvestris]
Length=651

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 137/172 (80%), Gaps = 11/172 (6%)
 Frame = +3

Query  228  FPNGNNKLLFLRDRLYSKLRCRCSKDDGPAS-PSAIVPGsntscssdntsasdssnwdwn  404
            FPN    +LFL++   S+L CRC   +  +S PSA          +++  A+ SS+WDWN
Sbjct  35   FPN----ILFLKNSKNSRLCCRCVNVNSTSSTPSA------DENCNNSCFATSSSDWDWN  84

Query  405  rwtRHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKN  584
            RWTR+FSE+EQAESYASVLKFQLE+A+E EDF EAAKLK +IAEAT+KD++AEIM  LKN
Sbjct  85   RWTRYFSEIEQAESYASVLKFQLEEAIEKEDFEEAAKLKASIAEATAKDSVAEIMSMLKN  144

Query  585  AIVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            AI EERYHDASRLCRSTGSGLVGWWVGYSKDS D FGRL+RITPG+GRFIGR
Sbjct  145  AIDEERYHDASRLCRSTGSGLVGWWVGYSKDSDDPFGRLIRITPGVGRFIGR  196



>ref|XP_010322554.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=670

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 138/171 (81%), Gaps = 5/171 (3%)
 Frame = +3

Query  228  FPNGNNKLLFLRDRLYSKLRCRCSKDDGPASPSAIVPGsntscssdntsasdssnwdwnr  407
            FPN +    FL++   S+L CRC   +  A+PSA     N +C + ++S+S S +WDWNR
Sbjct  32   FPNKS----FLKNPKNSRLCCRCVTVNNTATPSAD-ENCNNTCFASSSSSSTSLDWDWNR  86

Query  408  wtRHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNA  587
            WTR+FSE+EQ ESYASVLKFQLE+A+E EDF EAAKLK +IAEATSKD++AEIM  LKNA
Sbjct  87   WTRYFSEIEQVESYASVLKFQLEEAIEKEDFEEAAKLKASIAEATSKDSVAEIMSMLKNA  146

Query  588  IVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            I EERYHDASRLCRSTGSGLVGWWVGYSKDS D FGRL+RITPG+GRFIGR
Sbjct  147  IDEERYHDASRLCRSTGSGLVGWWVGYSKDSDDPFGRLIRITPGVGRFIGR  197



>ref|XP_004241496.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=651

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 138/171 (81%), Gaps = 5/171 (3%)
 Frame = +3

Query  228  FPNGNNKLLFLRDRLYSKLRCRCSKDDGPASPSAIVPGsntscssdntsasdssnwdwnr  407
            FPN +    FL++   S+L CRC   +  A+PSA     N +C + ++S+S S +WDWNR
Sbjct  32   FPNKS----FLKNPKNSRLCCRCVTVNNTATPSAD-ENCNNTCFASSSSSSTSLDWDWNR  86

Query  408  wtRHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNA  587
            WTR+FSE+EQ ESYASVLKFQLE+A+E EDF EAAKLK +IAEATSKD++AEIM  LKNA
Sbjct  87   WTRYFSEIEQVESYASVLKFQLEEAIEKEDFEEAAKLKASIAEATSKDSVAEIMSMLKNA  146

Query  588  IVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            I EERYHDASRLCRSTGSGLVGWWVGYSKDS D FGRL+RITPG+GRFIGR
Sbjct  147  IDEERYHDASRLCRSTGSGLVGWWVGYSKDSDDPFGRLIRITPGVGRFIGR  197



>ref|XP_009601214.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana tomentosiformis]
Length=651

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 135/172 (78%), Gaps = 11/172 (6%)
 Frame = +3

Query  228  FPNGNNKLLFLRDRLYSKLRCRCSKDDGPAS-PSAIVPGsntscssdntsasdssnwdwn  404
            FPN     LFL++   S+L CRC   +  +S PSA          +++  A+ SS WDWN
Sbjct  38   FPNK----LFLKNSKNSRLCCRCVNVNSTSSTPSA------DENCNNSCFATSSSGWDWN  87

Query  405  rwtRHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKN  584
            RWTR+FSE+EQAESYASVLKFQLE+A+E EDF EAAKLK AIAEAT+KD++AEIM  LKN
Sbjct  88   RWTRYFSEIEQAESYASVLKFQLEEAIEKEDFEEAAKLKAAIAEATAKDSVAEIMSMLKN  147

Query  585  AIVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            AI EERYHDASRLC+STGSGLVGWWVGYSKDS D FGRL+RITPG+GRFIGR
Sbjct  148  AIDEERYHDASRLCQSTGSGLVGWWVGYSKDSDDPFGRLIRITPGVGRFIGR  199



>ref|XP_011071839.1| PREDICTED: protein EXECUTER 1, chloroplastic [Sesamum indicum]
Length=664

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAE+YASVLKFQLEDA+ENEDF EAAKLK AIAEATSKD IAEIM QLK AI 
Sbjct  107  RHFSEIEQAENYASVLKFQLEDAIENEDFQEAAKLKIAIAEATSKDCIAEIMSQLKIAID  166

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCRST SGLVGWWVGYSKDS D FGRL+RITPG GRFIG+
Sbjct  167  EERYHDASRLCRSTASGLVGWWVGYSKDSDDPFGRLIRITPGTGRFIGK  215



>ref|XP_011028578.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Populus euphratica]
Length=653

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+AS+LKFQLEDA+ENEDF EAAKLK AIAEATSKD +A+IM QLKNA+ 
Sbjct  96   RHFSEIEQAESFASLLKFQLEDAIENEDFQEAAKLKIAIAEATSKDNVAQIMSQLKNAVD  155

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC+ TGSGLVGWWVGYS DS D FGRLVRITPG+GRF+GR
Sbjct  156  EERYHDASRLCKYTGSGLVGWWVGYSSDSDDPFGRLVRITPGVGRFVGR  204



>ref|XP_008374445.1| PREDICTED: protein EXECUTER 1, chloroplastic [Malus domestica]
Length=660

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLEDA+E EDF EAAKLK +I+EATSKDT+AEIM QLKNAI 
Sbjct  100  RHFSEVEQAESFASVLKFQLEDAIEKEDFEEAAKLKMSISEATSKDTVAEIMSQLKNAIE  159

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWVGY KDS D FGRL+RITPG+GRF+GR
Sbjct  160  EERYHDASRLCRYTGSGLVGWWVGYPKDSDDPFGRLIRITPGVGRFVGR  208



>gb|EYU42561.1| hypothetical protein MIMGU_mgv1a002602mg [Erythranthe guttata]
Length=655

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E+EQAE+YASVLKFQLEDA+ENEDF EAAKLK AIAEATSKD+IAEIM QLKNAI 
Sbjct  104  RHFAEIEQAENYASVLKFQLEDAIENEDFQEAAKLKKAIAEATSKDSIAEIMSQLKNAID  163

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWVGYS DS D FG+LV+ITPG GRFIG+
Sbjct  164  EERYHDASRLCRITGSGLVGWWVGYSNDSEDPFGKLVQITPGAGRFIGK  212



>gb|KDO69690.1| hypothetical protein CISIN_1g0061461mg, partial [Citrus sinensis]
 gb|KDO69691.1| hypothetical protein CISIN_1g0061461mg, partial [Citrus sinensis]
 gb|KDO69692.1| hypothetical protein CISIN_1g0061461mg, partial [Citrus sinensis]
Length=515

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESYAS+LKFQLEDA+E EDF EAA LK AIAEA SKDT+AEIM QLKNAI 
Sbjct  101  RHFSEIEQAESYASLLKFQLEDAIEREDFEEAANLKNAIAEAASKDTVAEIMAQLKNAID  160

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWVGYSKDS D FGRL++I PG+GRF+ R
Sbjct  161  EERYHDASRLCRYTGSGLVGWWVGYSKDSDDPFGRLIQIKPGVGRFVAR  209



>gb|KDO69689.1| hypothetical protein CISIN_1g0061461mg, partial [Citrus sinensis]
Length=500

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESYAS+LKFQLEDA+E EDF EAA LK AIAEA SKDT+AEIM QLKNAI 
Sbjct  101  RHFSEIEQAESYASLLKFQLEDAIEREDFEEAANLKNAIAEAASKDTVAEIMAQLKNAID  160

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWVGYSKDS D FGRL++I PG+GRF+ R
Sbjct  161  EERYHDASRLCRYTGSGLVGWWVGYSKDSDDPFGRLIQIKPGVGRFVAR  209



>emb|CDP12382.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 148/222 (67%), Gaps = 3/222 (1%)
 Frame = +3

Query  84   MAVANAWHAPHsqprpslsssssssssfpsssssHDHRVFPRRN--PILLFPNGNNKLLF  257
            MAVAN W   HS   P      + +SS  SSSS  +  +F + N   I          LF
Sbjct  1    MAVANTWATGHSSTVPIHQLRPTLNSSSSSSSSLSEQLIFAKNNKKSISSLNFSRKGWLF  60

Query  258  L-RDRLYSKLRCRCSKDDGPASPSAIVPGsntscssdntsasdssnwdwnrwtRHFSEME  434
            + ++   S+L C  S ++   S S++   +     + N S   +S WDWN W RH SE+E
Sbjct  61   IGKNNKKSRLYCLGSNNNDEGSSSSLASYTGFDDENSNNSPPPASEWDWNLWVRHISEIE  120

Query  435  QAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDA  614
            QAESYASVLKFQLEDA+E EDF EAAKLKTAI EAT KD+IAEIM +LKNA+ EERYHDA
Sbjct  121  QAESYASVLKFQLEDAIEREDFQEAAKLKTAIREATLKDSIAEIMSELKNAVDEERYHDA  180

Query  615  SRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            SRLC +TGSGLVGWWVGY KDS D FGRL+RITPGMGRF+GR
Sbjct  181  SRLCHTTGSGLVGWWVGYPKDSDDPFGRLIRITPGMGRFLGR  222



>ref|XP_011044311.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Populus euphratica]
Length=648

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLEDA+ENEDF EAAKLK AIAEATSKD +A IM +LKNAI 
Sbjct  90   RHFSEIEQAESFASVLKFQLEDAIENEDFQEAAKLKIAIAEATSKDNVALIMSELKNAIE  149

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LC+ TGSGLVGWWVGYS DS D FGRLVRITPG+GRF+GR
Sbjct  150  EERYHDASKLCKYTGSGLVGWWVGYSSDSDDPFGRLVRITPGVGRFVGR  198



>ref|XP_002318039.2| hypothetical protein POPTR_0012s08110g [Populus trichocarpa]
 gb|EEE96259.2| hypothetical protein POPTR_0012s08110g [Populus trichocarpa]
Length=648

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLEDA+ENEDF EAAKLK AIAEATSKD +A IM +LKNA+ 
Sbjct  90   RHFSEIEQAESFASVLKFQLEDAIENEDFQEAAKLKIAIAEATSKDNVAHIMSELKNAVE  149

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LC+ TGSGLVGWWVGYS DS D FGRLVRITPG+GRF+GR
Sbjct  150  EERYHDASKLCKYTGSGLVGWWVGYSSDSDDPFGRLVRITPGVGRFVGR  198



>ref|XP_002321589.2| hypothetical protein POPTR_0015s08620g [Populus trichocarpa]
 gb|EEF05716.2| hypothetical protein POPTR_0015s08620g [Populus trichocarpa]
Length=655

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+AS+LKFQLEDA+ENEDF EAAKLK AIAEATSKD +A+IM QLKNA+ 
Sbjct  97   RHFSEIEQAESFASLLKFQLEDAIENEDFQEAAKLKIAIAEATSKDNVAQIMSQLKNAVD  156

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC+ TGSGLVGWWVGYS DS D FGRLVRITP +GRF+GR
Sbjct  157  EERYHDASRLCKYTGSGLVGWWVGYSSDSDDPFGRLVRITPDVGRFVGR  205



>ref|XP_007210299.1| hypothetical protein PRUPE_ppa002543mg [Prunus persica]
 gb|EMJ11498.1| hypothetical protein PRUPE_ppa002543mg [Prunus persica]
Length=660

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLEDA+E EDF EAAKLK  IAEATSKDT+AEIM QLKNAI 
Sbjct  99   RHFSEIEQAESFASVLKFQLEDAIEKEDFQEAAKLKMCIAEATSKDTVAEIMSQLKNAIE  158

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC+ +GSGLVGWWVGY KDS D FGRL+RITPG+GRF+G+
Sbjct  159  EERYHDASRLCKYSGSGLVGWWVGYPKDSDDPFGRLIRITPGVGRFVGK  207



>ref|XP_002511410.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
 gb|EEF52012.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
Length=658

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQ ES+ASVLKFQLEDA+E EDF EAAKLK AIAEATSKD++AEIM +L+NAI 
Sbjct  100  RHFSEIEQVESFASVLKFQLEDAIEKEDFQEAAKLKLAIAEATSKDSVAEIMSELQNAID  159

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC+ TGSGLVGWWVGYS DS D FGRLVRITPG+GRF+GR
Sbjct  160  EERYHDASRLCKYTGSGLVGWWVGYSTDSDDPFGRLVRITPGVGRFVGR  208



>ref|XP_006439802.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 ref|XP_006439804.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 ref|XP_006439805.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53042.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53044.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53045.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
Length=659

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESYAS+LKFQLEDA+E EDF EAA LK AIAEA SKDT+AEIM QLKNAI 
Sbjct  101  RHFSEIEQAESYASLLKFQLEDAIEREDFEEAANLKNAIAEAASKDTVAEIMAQLKNAID  160

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWVGYSKDS D FGRL++I PG+GRF+ R
Sbjct  161  EERYHDASRLCRYTGSGLVGWWVGYSKDSDDPFGRLIQIKPGVGRFVAR  209



>ref|XP_006476766.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Citrus sinensis]
Length=661

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESYAS+LKFQLEDA+E EDF EAA LK AIAEA SKDT+AEIM QLKNAI 
Sbjct  103  RHFSEIEQAESYASLLKFQLEDAIEREDFEEAANLKNAIAEAASKDTVAEIMAQLKNAID  162

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWVGYSKDS D FGRL++I PG+GRF+ R
Sbjct  163  EERYHDASRLCRYTGSGLVGWWVGYSKDSDDPFGRLIQIKPGVGRFVAR  211



>gb|KCW49293.1| hypothetical protein EUGRSUZ_K02848 [Eucalyptus grandis]
Length=492

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLE+A+E EDF EAAKLK AIAEATSKD +A+IM QLKNAI 
Sbjct  92   RHFSEIEQAESFASVLKFQLEEAIEKEDFHEAAKLKMAIAEATSKDAVADIMAQLKNAIE  151

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYH+ASRLC+ TGSGLVGWWVG SKDS D FGRL+RITP +GRF+GR
Sbjct  152  EERYHEASRLCKHTGSGLVGWWVGCSKDSNDPFGRLIRITPSVGRFVGR  200



>ref|XP_012080080.1| PREDICTED: protein EXECUTER 2, chloroplastic [Jatropha curcas]
 gb|KDP31109.1| hypothetical protein JCGZ_11485 [Jatropha curcas]
Length=663

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQA+S+ASVLKFQLEDA+E EDF EAAKLK AIAEATSKD+IAEIM +L+NAI 
Sbjct  106  RHFSEIEQAQSFASVLKFQLEDAIEKEDFQEAAKLKMAIAEATSKDSIAEIMSELQNAIG  165

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DASRLC+ TGSGLVGWWVGYS DS D FGRLVRITPG+GRF+G+
Sbjct  166  EERYRDASRLCKHTGSGLVGWWVGYSTDSDDPFGRLVRITPGVGRFVGK  214



>gb|KJB53137.1| hypothetical protein B456_008G294800 [Gossypium raimondii]
Length=593

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESY SVLKFQLEDA++ EDF EAAKLK AIAE +SKD++AEIM QLK+AI 
Sbjct  96   RHFSEIEQAESYTSVLKFQLEDAIDKEDFEEAAKLKLAIAEVSSKDSVAEIMSQLKSAID  155

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRL R TGSGLVGWWVGYSKDS D FGRLVRITPG+GRF+ R
Sbjct  156  EERYHDASRLSRLTGSGLVGWWVGYSKDSDDPFGRLVRITPGVGRFVAR  204



>ref|XP_009363034.1| PREDICTED: protein EXECUTER 1, chloroplastic [Pyrus x bretschneideri]
Length=660

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS++EQAES+ SVLKFQLEDA+E EDF EA KLK +I+EATS DT+AEIM QLKNAI 
Sbjct  100  RHFSDVEQAESFVSVLKFQLEDAIEKEDFQEATKLKMSISEATSNDTVAEIMSQLKNAIE  159

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DASRLCR TGSGLVGWWVGY KDS D FGRL+RITPG+GRFIGR
Sbjct  160  EERYRDASRLCRHTGSGLVGWWVGYPKDSDDPFGRLIRITPGVGRFIGR  208



>gb|KCW49292.1| hypothetical protein EUGRSUZ_K02848 [Eucalyptus grandis]
Length=588

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLE+A+E EDF EAAKLK AIAEATSKD +A+IM QLKNAI 
Sbjct  92   RHFSEIEQAESFASVLKFQLEEAIEKEDFHEAAKLKMAIAEATSKDAVADIMAQLKNAIE  151

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYH+ASRLC+ TGSGLVGWWVG SKDS D FGRL+RITP +GRF+GR
Sbjct  152  EERYHEASRLCKHTGSGLVGWWVGCSKDSNDPFGRLIRITPSVGRFVGR  200



>ref|XP_010101202.1| hypothetical protein L484_015006 [Morus notabilis]
 gb|EXB87876.1| hypothetical protein L484_015006 [Morus notabilis]
Length=630

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+AS+LKFQLED++E EDF EAAKLK AI EATSKD++AEIM +LK AI 
Sbjct  94   RHFSEIEQAESFASLLKFQLEDSIEKEDFQEAAKLKMAIEEATSKDSVAEIMAELKIAID  153

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LCR TGSGLVGWWVGYSKDS D FGRL+ ITPG+GRF+GR
Sbjct  154  EERYHDASKLCRHTGSGLVGWWVGYSKDSDDPFGRLIHITPGVGRFVGR  202



>gb|KCW49291.1| hypothetical protein EUGRSUZ_K02848 [Eucalyptus grandis]
Length=630

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLE+A+E EDF EAAKLK AIAEATSKD +A+IM QLKNAI 
Sbjct  92   RHFSEIEQAESFASVLKFQLEEAIEKEDFHEAAKLKMAIAEATSKDAVADIMAQLKNAIE  151

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYH+ASRLC+ TGSGLVGWWVG SKDS D FGRL+RITP +GRF+GR
Sbjct  152  EERYHEASRLCKHTGSGLVGWWVGCSKDSNDPFGRLIRITPSVGRFVGR  200



>ref|XP_010678752.1| PREDICTED: protein EXECUTER 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=707

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESY+SVLKFQLE+AVENEDF EAAKLK+AI EATSKDT+AEIM +LK AI 
Sbjct  149  RHFSEIEQAESYSSVLKFQLEEAVENEDFKEAAKLKSAIVEATSKDTVAEIMSELKKAIA  208

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+L +STGSGLVGWW+G +KDS D FGRLVRITPG+G+FI R
Sbjct  209  EERYHDASKLSKSTGSGLVGWWIGSAKDSDDPFGRLVRITPGVGKFIAR  257



>ref|XP_010037568.1| PREDICTED: protein EXECUTER 1, chloroplastic [Eucalyptus grandis]
 gb|KCW49290.1| hypothetical protein EUGRSUZ_K02848 [Eucalyptus grandis]
Length=649

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLE+A+E EDF EAAKLK AIAEATSKD +A+IM QLKNAI 
Sbjct  92   RHFSEIEQAESFASVLKFQLEEAIEKEDFHEAAKLKMAIAEATSKDAVADIMAQLKNAIE  151

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYH+ASRLC+ TGSGLVGWWVG SKDS D FGRL+RITP +GRF+GR
Sbjct  152  EERYHEASRLCKHTGSGLVGWWVGCSKDSNDPFGRLIRITPSVGRFVGR  200



>gb|KJB53138.1| hypothetical protein B456_008G294800 [Gossypium raimondii]
Length=654

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESY SVLKFQLEDA++ EDF EAAKLK AIAE +SKD++AEIM QLK+AI 
Sbjct  96   RHFSEIEQAESYTSVLKFQLEDAIDKEDFEEAAKLKLAIAEVSSKDSVAEIMSQLKSAID  155

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRL R TGSGLVGWWVGYSKDS D FGRLVRITPG+GRF+ R
Sbjct  156  EERYHDASRLSRLTGSGLVGWWVGYSKDSDDPFGRLVRITPGVGRFVAR  204



>ref|XP_008367525.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Malus domestica]
Length=660

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ SVLKFQLEDA+E EDF EAAKLK +I+EATS DT+ EIM QLKNAI 
Sbjct  100  RHFSEVEQAESFVSVLKFQLEDAIEKEDFQEAAKLKMSISEATSNDTVVEIMSQLKNAIE  159

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DASRLCR TGSGLVGWWVGY KD  D FGRL+RITPG+GRFIGR
Sbjct  160  EERYRDASRLCRHTGSGLVGWWVGYPKDLDDPFGRLIRITPGVGRFIGR  208



>ref|XP_004501935.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cicer arietinum]
Length=640

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS++EQAE++AS+LKFQLEDAVE E+F EAAKLK AI +ATSKD++AEIM QLKNAI 
Sbjct  83   RHFSDIEQAETFASLLKFQLEDAVEKEEFQEAAKLKRAIVDATSKDSVAEIMSQLKNAID  142

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERYHDASRLCR TGSGLVGWWVGYSK+S D FGRL+ I+PGMGRF+G+
Sbjct  143  DERYHDASRLCRYTGSGLVGWWVGYSKNSDDPFGRLIHISPGMGRFVGK  191



>ref|XP_007036194.1| EXECUTER1 protein, chloroplast, putative isoform 3 [Theobroma 
cacao]
 gb|EOY20695.1| EXECUTER1 protein, chloroplast, putative isoform 3 [Theobroma 
cacao]
Length=614

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESYASVLKFQLEDA+E EDF EAAKLK AIAE  SKD++AEIM QLK+AI 
Sbjct  89   RHFSEIEQAESYASVLKFQLEDAIEKEDFQEAAKLKLAIAEVASKDSVAEIMSQLKSAID  148

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS L R TGSGLVGWWVGYSKDS D FGRLVRITPG+GRF+ R
Sbjct  149  EERYHDASWLSRHTGSGLVGWWVGYSKDSDDPFGRLVRITPGVGRFVAR  197



>ref|XP_003601283.1| Protein EXECUTER [Medicago truncatula]
 gb|AES71534.1| executer 1 [Medicago truncatula]
Length=630

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF ++EQAES+AS+LKFQLEDA+E E+F EAAKLK AI EATSKD++AEIM QLKNAI 
Sbjct  77   RHFDDIEQAESFASLLKFQLEDAIEKEEFQEAAKLKRAIVEATSKDSVAEIMSQLKNAID  136

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERYHDAS+LCR TGSGLVGWWVGYSK+S D FGR++RI+PGMGRF+G+
Sbjct  137  DERYHDASKLCRYTGSGLVGWWVGYSKNSEDPFGRIIRISPGMGRFVGK  185



>ref|XP_007036192.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007036193.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20693.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20694.1| EXECUTER1 protein, chloroplast, putative isoform 1 [Theobroma 
cacao]
Length=647

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAESYASVLKFQLEDA+E EDF EAAKLK AIAE  SKD++AEIM QLK+AI 
Sbjct  89   RHFSEIEQAESYASVLKFQLEDAIEKEDFQEAAKLKLAIAEVASKDSVAEIMSQLKSAID  148

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS L R TGSGLVGWWVGYSKDS D FGRLVRITPG+GRF+ R
Sbjct  149  EERYHDASWLSRHTGSGLVGWWVGYSKDSDDPFGRLVRITPGVGRFVAR  197



>gb|EYU17659.1| hypothetical protein MIMGU_mgv1a002899mg [Erythranthe guttata]
Length=627

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+A+S+AS+LKFQLEDA+E EDF EA+KLK AI E TSKD+IAEI+ QLKNAI 
Sbjct  85   RHFSEVEEADSFASLLKFQLEDAIEKEDFREASKLKKAIDETTSKDSIAEILYQLKNAID  144

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERYHDASRLCRSTGSGL+GWWVGYSK S D FGRL+RITP  GRF+GR
Sbjct  145  DERYHDASRLCRSTGSGLIGWWVGYSKSSDDPFGRLIRITPETGRFVGR  193



>ref|XP_004298937.1| PREDICTED: protein EXECUTER 2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=654

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E+EQAES+ASVLKFQLEDA+E EDF EA KLK  IAEAT KDT+++IM QLK AI 
Sbjct  97   RHFNEIEQAESFASVLKFQLEDAIEKEDFQEAVKLKMTIAEATRKDTVSKIMAQLKIAIE  156

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LC+ TGSGLVGWWVGY KD+ D FGRLVRITPG+GRF+GR
Sbjct  157  EERYHDASKLCKHTGSGLVGWWVGYPKDTDDPFGRLVRITPGVGRFVGR  205



>ref|XP_010243014.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Nelumbo nucifera]
Length=632

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAE+ ASVLKFQLEDA+E EDF EAAKLKTAIAEATSKD ++EIM  LKNAI 
Sbjct  70   RHFSEIEQAENLASVLKFQLEDAIEKEDFQEAAKLKTAIAEATSKDAVSEIMSYLKNAID  129

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS LC+ TGSGLVGWWVG SKDS D FG+LVRITPG+GRF+ R
Sbjct  130  EERYHDASVLCKLTGSGLVGWWVGCSKDSDDPFGKLVRITPGVGRFVAR  178



>ref|XP_007138088.1| hypothetical protein PHAVU_009G179300g [Phaseolus vulgaris]
 gb|ESW10082.1| hypothetical protein PHAVU_009G179300g [Phaseolus vulgaris]
Length=472

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R+FSE+EQAE++ASVLKFQL+DAVE EDF EA KLK A+ EATSKDT+AEIM QLK+AI 
Sbjct  81   RYFSEIEQAENFASVLKFQLDDAVEKEDFEEAIKLKRALLEATSKDTVAEIMDQLKSAID  140

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERYHDASRLC+ TGSGLVGWWVGYSK S D FGR++ I+PGMG+FIG+
Sbjct  141  DERYHDASRLCKCTGSGLVGWWVGYSKTSDDPFGRIIHISPGMGKFIGK  189



>gb|EPS59467.1| hypothetical protein M569_15340, partial [Genlisea aurea]
Length=499

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS++E AE+ +S+LKFQL+DAVE EDF EAAKLK +I+E TSKD+IAEIM  LKNAI+
Sbjct  24   RHFSDIEVAENDSSILKFQLDDAVEKEDFEEAAKLKLSISETTSKDSIAEIMSDLKNAII  83

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWVGYSK+ GD FGR++ ITPG+GRF+ +
Sbjct  84   EERYHDASRLCRDTGSGLVGWWVGYSKNKGDPFGRMIHITPGIGRFVAK  132



>ref|XP_002279734.3| PREDICTED: protein EXECUTER 1, chloroplastic [Vitis vinifera]
 emb|CBI15040.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   178 bits (451),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLEDA+E EDF EAAKLK AIAEA S D++ EIM QLKNAI 
Sbjct  95   RHFSEIEQAESFASVLKFQLEDAIEREDFEEAAKLKMAIAEAMSMDSVTEIMSQLKNAID  154

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LCR T SGLVGWWVG S DS D FGRLV ITPG+GRF+GR
Sbjct  155  EERYHDASKLCRHTASGLVGWWVGCSADSDDPFGRLVHITPGVGRFVGR  203



>ref|XP_008453095.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Cucumis 
melo]
Length=653

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R+FSE+EQAE++ASVLKFQLE+AVE EDF EAAKLK AIAE   KD++AEIM QLK+AI 
Sbjct  92   RYFSEIEQAENFASVLKFQLEEAVEKEDFEEAAKLKLAIAETAQKDSVAEIMHQLKSAIE  151

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DAS LC+ TGSGLVGWWVGYS+DS D FGRL+RITPG+GRFIGR
Sbjct  152  EERYQDASMLCKCTGSGLVGWWVGYSQDSDDPFGRLIRITPGVGRFIGR  200



>ref|XP_010251274.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Nelumbo nucifera]
Length=629

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQA++++S+LKFQLEDA+E EDF EAAKLK AIAEATSKD IAEIMLQLKNAI 
Sbjct  69   RHFSEVEQADNFSSLLKFQLEDAIEKEDFEEAAKLKAAIAEATSKDAIAEIMLQLKNAID  128

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DAS LC+ TGSGLVGWWVG SKDS D FG+LV+I+PG+GRF+ R
Sbjct  129  EERYRDASVLCKLTGSGLVGWWVGCSKDSDDPFGKLVQISPGVGRFVAR  177



>ref|XP_003522373.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=632

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS++EQAE++ASVLKFQL+DA+E EDF EA KL  A++EATSKDT+AEIM QLK+AI 
Sbjct  75   RHFSDIEQAENFASVLKFQLDDAIEKEDFEEAVKLNRALSEATSKDTVAEIMDQLKSAID  134

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERYHDASRLC+ TGSGLVGWWVGYSK S D FGR++ I+PGMGRFIG+
Sbjct  135  DERYHDASRLCKCTGSGLVGWWVGYSKASDDPFGRIIHISPGMGRFIGK  183



>ref|XP_007138087.1| hypothetical protein PHAVU_009G179300g [Phaseolus vulgaris]
 gb|ESW10081.1| hypothetical protein PHAVU_009G179300g [Phaseolus vulgaris]
Length=645

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R+FSE+EQAE++ASVLKFQL+DAVE EDF EA KLK A+ EATSKDT+AEIM QLK+AI 
Sbjct  81   RYFSEIEQAENFASVLKFQLDDAVEKEDFEEAIKLKRALLEATSKDTVAEIMDQLKSAID  140

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERYHDASRLC+ TGSGLVGWWVGYSK S D FGR++ I+PGMG+FIG+
Sbjct  141  DERYHDASRLCKCTGSGLVGWWVGYSKTSDDPFGRIIHISPGMGKFIGK  189



>ref|XP_003528152.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=634

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS++EQAE++ASVLKFQL+DA+E EDF EA KLK A+ EATSKDT+AE+M QLK+AI 
Sbjct  77   RHFSQIEQAENFASVLKFQLDDAIEKEDFEEAVKLKRALVEATSKDTVAEVMDQLKSAID  136

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERYHDASRLC+ TGSGLVGWWVGY K S D FGR++ I+PGMGRFIG+
Sbjct  137  DERYHDASRLCKCTGSGLVGWWVGYPKASDDPFGRIIHISPGMGRFIGK  185



>ref|XP_010536627.1| PREDICTED: protein EXECUTER 1, chloroplastic [Tarenaya hassleriana]
Length=644

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E AE+ AS+LKFQLE+A+E EDF EAAKLKTAIAEATS D +AE+M QL+ AI 
Sbjct  92   RHFSEVEDAENLASLLKFQLEEAIEKEDFQEAAKLKTAIAEATSMDVVAEVMSQLQTAIR  151

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYH ASRLCR TGSGLVGWWVGYS DS D FGR+V ITPG+GRF+G+
Sbjct  152  EERYHKASRLCRETGSGLVGWWVGYSPDSEDPFGRIVHITPGVGRFVGK  200



>ref|XP_011657482.1| PREDICTED: protein EXECUTER 2, chloroplastic [Cucumis sativus]
 gb|KGN63586.1| hypothetical protein Csa_1G004980 [Cucumis sativus]
Length=657

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R+FSE+EQAE++ASVLKFQLE+AVE EDF EAAKLK  IAE   KD++ EIM QLK+AI 
Sbjct  96   RYFSEIEQAENFASVLKFQLEEAVEKEDFEEAAKLKLVIAETARKDSVTEIMHQLKSAIE  155

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DAS LC+ TGSGLVGWWVGYS+DS D FGRL+RITPG+GRFIGR
Sbjct  156  EERYQDASMLCKCTGSGLVGWWVGYSQDSDDPFGRLIRITPGVGRFIGR  204



>ref|XP_009380345.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=658

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HFSE +QAES++S+LKFQLE+AVE EDFLEAAKLK AIAEATSKD +AE+M +LK AI 
Sbjct  84   QHFSETDQAESFSSLLKFQLEEAVEREDFLEAAKLKAAIAEATSKDAVAEVMSELKYAIE  143

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC  +GSGLVGWW G++KDSGD FGR+VRITP +GR+I +
Sbjct  144  EERYHDASRLCMLSGSGLVGWWAGWAKDSGDPFGRIVRITPAVGRYIAK  192



>ref|XP_010940041.1| PREDICTED: protein EXECUTER 1, chloroplastic [Elaeis guineensis]
Length=656

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HFSE +QAE++ SVLKFQLE+A+E EDF EAAKLK AIAEATSKD +A++M +LKNAI E
Sbjct  76   HFSETDQAENFFSVLKFQLEEAIEKEDFSEAAKLKKAIAEATSKDVVAQVMSELKNAIEE  135

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERYHDAS+LCR  GSGLVGWWVG++KDS D FGR+VRITPG+GR++ +
Sbjct  136  ERYHDASKLCRLAGSGLVGWWVGWAKDSDDPFGRIVRITPGVGRYVAK  183



>ref|XP_006415752.1| hypothetical protein EUTSA_v10007043mg [Eutrema salsugineum]
 gb|ESQ34105.1| hypothetical protein EUTSA_v10007043mg [Eutrema salsugineum]
Length=638

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ +S  S+LK QLE+A+E EDF EAAKLK AI EAT  D +AEIM QL+ AI 
Sbjct  91   RHFSEIEEIDSLVSLLKLQLEEAIEKEDFEEAAKLKKAIGEATVNDAVAEIMGQLQTAIR  150

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLCR TGSGLVGWWV Y +DSG+ FGR+VRITPG+GRFIG+
Sbjct  151  EERYHDASRLCRQTGSGLVGWWVCYPQDSGEPFGRIVRITPGVGRFIGK  199



>gb|AAM20453.1| unknown protein [Arabidopsis thaliana]
Length=352

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ ES  S+LK QLEDAVE EDF EA KLK AI+EAT  D +AEIM QL+ A+ 
Sbjct  94   RHFSEIEEVESVVSLLKSQLEDAVEKEDFEEAVKLKQAISEATVDDAVAEIMRQLQTAVN  153

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC  TGSGLVGWWVG  +DS + FGR+V ITPG+GRFIG+
Sbjct  154  EERYHDASRLCNETGSGLVGWWVGLPRDSEEPFGRIVHITPGVGRFIGK  202



>ref|XP_002893472.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69731.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ E+  S+LK QLEDAVE EDF EA KLK AIAEAT  D +AEIM QL+ AI 
Sbjct  91   RHFSEIEEVETVVSLLKSQLEDAVEKEDFEEAVKLKQAIAEATVDDAVAEIMRQLQTAIS  150

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC  TGSGLVGWWVGY +DS + FGR+V ITPG+GRFIG+
Sbjct  151  EERYHDASRLCNETGSGLVGWWVGYPRDSEEPFGRIVHITPGVGRFIGK  199



>ref|XP_008239756.1| PREDICTED: LOW QUALITY PROTEIN: protein EXECUTER 1, chloroplastic 
[Prunus mume]
Length=660

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLEDA+E EDF EAAKLK  IAEATSKDT+AEIM QLK    
Sbjct  99   RHFSEIEQAESFASVLKFQLEDAIEKEDFQEAAKLKMCIAEATSKDTVAEIMSQLKVRXA  158

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
               Y+    LC+ +GSGLVGWWVGY KDS D FGRL+RITPG+GRF+G+
Sbjct  159  FVSYYCILSLCKYSGSGLVGWWVGYPKDSDDPFGRLIRITPGVGRFVGK  207



>emb|CDY11792.1| BnaC03g57860D [Brassica napus]
Length=620

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ +   S+LK QLE+A+E EDF EAAKLK AI EAT  D++AEIM QL++AI 
Sbjct  86   RHFSEIEETDGVVSLLKVQLEEAIEREDFEEAAKLKAAIGEATVSDSVAEIMCQLQDAIR  145

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LCR TGSGLVGWWV Y +DS + FGR+VRITPG+GRFIG+
Sbjct  146  EERYHDASKLCRQTGSGLVGWWVCYPQDSEEPFGRIVRITPGVGRFIGK  194



>gb|AAD45989.1|AC005916_1 EST gb|N65787 comes from this gene [Arabidopsis thaliana]
Length=568

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ ES  S+LK QLEDAVE EDF EA KLK AI+EAT  D +AEIM QL+ A+ 
Sbjct  94   RHFSEIEEVESVVSLLKSQLEDAVEKEDFEEAVKLKQAISEATVDDAVAEIMRQLQTAVN  153

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC  TGSGLVGWWVG  +DS + FGR+V ITPG+GRFIG+
Sbjct  154  EERYHDASRLCNETGSGLVGWWVGLPRDSEEPFGRIVHITPGVGRFIGK  202



>ref|XP_009109798.1| PREDICTED: protein EXECUTER 1, chloroplastic [Brassica rapa]
Length=640

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+E+ +   S+LK QLE+A+E EDF EAAKLK AI EAT  D++AEIM QL++AI 
Sbjct  86   RHFDEIEEIDGVVSLLKVQLEEAIEREDFGEAAKLKAAIGEATVNDSVAEIMCQLQDAIR  145

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LCR TGSGLVGWWV Y +DS + FGR+VRITPG+GRFIGR
Sbjct  146  EERYHDASKLCRQTGSGLVGWWVCYPQDSEEPFGRIVRITPGVGRFIGR  194



>ref|NP_564287.1| protein EXECUTER 2 [Arabidopsis thaliana]
 sp|Q94AT5.1|EXEC2_ARATH RecName: Full=Protein EXECUTER 2, chloroplastic; Short=AtEX2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK76486.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45133.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30840.1| uncharacterized protein AT1G27510 [Arabidopsis thaliana]
Length=651

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ ES  S+LK QLEDAVE EDF EA KLK AI+EAT  D +AEIM QL+ A+ 
Sbjct  94   RHFSEIEEVESVVSLLKSQLEDAVEKEDFEEAVKLKQAISEATVDDAVAEIMRQLQTAVN  153

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC  TGSGLVGWWVG  +DS + FGR+V ITPG+GRFIG+
Sbjct  154  EERYHDASRLCNETGSGLVGWWVGLPRDSEEPFGRIVHITPGVGRFIGK  202



>ref|NP_001146198.1| hypothetical protein [Zea mays]
 gb|ACL53452.1| unknown [Zea mays]
 gb|AFW79777.1| hypothetical protein ZEAMMB73_469165 [Zea mays]
Length=627

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E++QAESYAS+L+FQLE+AVENEDF EAAKLK  I EAT  D +A +M +LKNAI 
Sbjct  67   RHFDEVDQAESYASLLQFQLEEAVENEDFAEAAKLKRDIIEATGNDAVAHVMAELKNAIE  126

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL R  G+ LVGWWVGY+KD+ D  GR+VRI+PG+GR++ +
Sbjct  127  EQRYQDASRLTRLAGTSLVGWWVGYAKDTDDSIGRIVRISPGVGRYVAK  175



>ref|XP_006304413.1| hypothetical protein CARUB_v10010978mg [Capsella rubella]
 gb|EOA37311.1| hypothetical protein CARUB_v10010978mg [Capsella rubella]
Length=646

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ E+  S+LK QLE+AVE EDF EAAKLK AIAEAT  DT+AEIM QL+ AI 
Sbjct  89   RHFSEIEEVETVVSLLKSQLEEAVEKEDFEEAAKLKQAIAEATVDDTVAEIMRQLQTAIR  148

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIG  737
            EERYHDASRLC  TGSGLVGWWVG  +D    FGRLV ITPG+GRFIG
Sbjct  149  EERYHDASRLCNQTGSGLVGWWVGRPRDFEAPFGRLVHITPGVGRFIG  196



>emb|CDX90093.1| BnaA08g18910D [Brassica napus]
Length=640

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+E+ +   S+LK QLE+A+E EDF EAAKLK AI EAT  D +AEIM  L+ AI 
Sbjct  86   RHFDEIEEIDGVVSLLKVQLEEAIEREDFGEAAKLKAAIGEATVSDAVAEIMCHLQTAIR  145

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS+LCR TGSGLVGWWV Y +DS + FGR+VRITPG+GRFIGR
Sbjct  146  EERYHDASKLCRQTGSGLVGWWVCYPQDSEEPFGRIVRITPGVGRFIGR  194



>ref|XP_004967955.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Setaria italica]
Length=627

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+EQ ESYAS+L+FQLE+AVENEDF EAAKLK AI EAT  D +A +M +LK+AI 
Sbjct  67   RHFDEVEQDESYASLLQFQLEEAVENEDFAEAAKLKRAILEATGNDAVAHVMAELKSAIE  126

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL R  G+ LVGWWVGY+KD+ D  GR+VRI+PG+GR++ +
Sbjct  127  EQRYQDASRLTRLAGTSLVGWWVGYAKDTDDSIGRIVRISPGVGRYVAK  175



>ref|XP_006844970.1| PREDICTED: protein EXECUTER 2, chloroplastic [Amborella trichopoda]
 gb|ERN06645.1| hypothetical protein AMTR_s00058p00181770 [Amborella trichopoda]
Length=634

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS+++Q E+Y+S+LKFQLE+AVENEDF EA+++K A+ E  SKD +AE+M QL+ +I+
Sbjct  77   RHFSQIDQDENYSSLLKFQLEEAVENEDFYEASQVKKALEEVASKDVVAEVMSQLEKSIM  136

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDAS +CR+TGSGLVGWWVG+S+   D  G++V+ITP +GRF+ R
Sbjct  137  EERYHDASLICRTTGSGLVGWWVGWSEGFDDPLGKIVQITPAVGRFVAR  185



>ref|XP_010478095.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=644

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ E+  S+LK QLE+AV+ EDF EA KLK AIAEAT  D +AEIM QL+ AI 
Sbjct  90   RHFSEVEEIEAVVSLLKSQLEEAVKKEDFEEAVKLKQAIAEATVDDAVAEIMRQLQTAIS  149

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC  TGSGLVGWWV   +D  +LFGR+V ITPG+GRFI +
Sbjct  150  EERYHDASRLCNETGSGLVGWWVSRPRDYAELFGRIVHITPGVGRFIAK  198



>gb|EAY72221.1| hypothetical protein OsI_00074 [Oryza sativa Indica Group]
Length=625

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF++++QAESYAS+LKFQLE+AV+NEDF EA+KLK AI EAT  D +A++M +LK AI 
Sbjct  64   RHFADVDQAESYASLLKFQLEEAVDNEDFAEASKLKKAILEATGNDAVAQVMSELKTAIE  123

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL +   + LVGWWVGY+KD+ D  GR+VRI+PG+GR++ +
Sbjct  124  EQRYQDASRLTKLARTNLVGWWVGYAKDTDDSIGRIVRISPGVGRYVAK  172



>sp|Q657X6.1|EXEC2_ORYSJ RecName: Full=Protein EXECUTER 2, chloroplastic; Short=OsEX2; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD44852.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD44891.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ10235.1| hypothetical protein OsJ_00066 [Oryza sativa Japonica Group]
 dbj|BAG91905.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF++++QAESYAS+LKFQLE+AV+NEDF EA+KLK AI EAT  D +A++M +LK AI 
Sbjct  66   RHFADVDQAESYASLLKFQLEEAVDNEDFAEASKLKKAILEATGNDAVAQVMSELKTAIE  125

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL +   + LVGWWVGY+KD+ D  GR+VRI+PG+GR++ +
Sbjct  126  EQRYQDASRLTKLARTNLVGWWVGYAKDTDDSIGRIVRISPGVGRYVAK  174



>ref|XP_008453096.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Cucumis 
melo]
 ref|XP_008453097.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Cucumis 
melo]
Length=551

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  459  LKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRSTG  638
             +FQLE+AVE EDF EAAKLK AIAE   KD++AEIM QLK+AI EERY DAS LC+ TG
Sbjct  5    FQFQLEEAVEKEDFEEAAKLKLAIAETAQKDSVAEIMHQLKSAIEEERYQDASMLCKCTG  64

Query  639  SGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            SGLVGWWVGYS+DS D FGRL+RITPG+GRFIGR
Sbjct  65   SGLVGWWVGYSQDSDDPFGRLIRITPGVGRFIGR  98



>ref|XP_010230337.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=638

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E++QAESYASVL F+LE+AVE EDF EAA LK AI +AT+ D +A +M QLK+AI 
Sbjct  70   RHFAEVDQAESYASVLAFRLEEAVEGEDFAEAAALKRAIRDATAHDAVAHVMAQLKSAIE  129

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL +  G+ LVGWWVGY+KD+ D  GR+VRI+PG+GR++ +
Sbjct  130  EQRYQDASRLTKLAGTSLVGWWVGYAKDTDDSIGRIVRISPGVGRYVAK  178



>ref|XP_003565224.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=632

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E++QAESYASVL F+LE+AVE EDF EAA LK AI +AT+ D +A +M QLK+AI 
Sbjct  70   RHFAEVDQAESYASVLAFRLEEAVEGEDFAEAAALKRAIRDATAHDAVAHVMAQLKSAIE  129

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL +  G+ LVGWWVGY+KD+ D  GR+VRI+PG+GR++ +
Sbjct  130  EQRYQDASRLTKLAGTSLVGWWVGYAKDTDDSIGRIVRISPGVGRYVAK  178



>ref|XP_009415819.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=654

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS+ +QAES +S LKFQL++AVE EDFLEAAKLK AI EATSKD +AE++  LKNAI 
Sbjct  82   RHFSDTDQAESLSSALKFQLQEAVEKEDFLEAAKLKRAIEEATSKDVVAEVLSALKNAIK  141

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRL +  GS L+GWW  +++DS D FGR+V+ITP  GR++ +
Sbjct  142  EERYHDASRLSKLAGSRLIGWWACWAEDSDDPFGRIVQITPAFGRYVAK  190



>tpg|DAA53814.1| TPA: hypothetical protein ZEAMMB73_854553 [Zea mays]
Length=496

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E++QAESYAS+L+FQLE+AVENEDF EAAKLK  I  AT  D +A +M +LK+AI 
Sbjct  64   RHFDEVDQAESYASLLQFQLEEAVENEDFAEAAKLKRDIIAATGNDAVAHVMAELKSAIE  123

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL R  G+ LVGWWVGY+K   D  GR+VRI+PG+GR++ +
Sbjct  124  EQRYQDASRLTRLAGTSLVGWWVGYAKGIDDSIGRIVRISPGVGRYVAK  172



>tpg|DAA53811.1| TPA: hypothetical protein ZEAMMB73_854553 [Zea mays]
Length=486

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E++QAESYAS+L+FQLE+AVENEDF EAAKLK  I  AT  D +A +M +LK+AI 
Sbjct  64   RHFDEVDQAESYASLLQFQLEEAVENEDFAEAAKLKRDIIAATGNDAVAHVMAELKSAIE  123

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL R  G+ LVGWWVGY+K   D  GR+VRI+PG+GR++ +
Sbjct  124  EQRYQDASRLTRLAGTSLVGWWVGYAKGIDDSIGRIVRISPGVGRYVAK  172



>ref|XP_009415820.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=645

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFS+ +QAES +S LKFQL++AVE EDFLEAAKLK AI EATSKD +AE++  LKNAI 
Sbjct  82   RHFSDTDQAESLSSALKFQLQEAVEKEDFLEAAKLKRAIEEATSKDVVAEVLSALKNAIK  141

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRL +  GS L+GWW  +++DS D FGR+V+ITP  GR++ +
Sbjct  142  EERYHDASRLSKLAGSRLIGWWACWAEDSDDPFGRIVQITPAFGRYVAK  190



>ref|XP_008797614.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Phoenix dactylifera]
Length=312

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  465  FQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRSTGSG  644
            FQLE+A+E EDF EAAKLK AIAEATSKD +A +M +LKNA+ EERYHDASRL R  GSG
Sbjct  40   FQLEEAIEKEDFSEAAKLKKAIAEATSKDVVALVMSELKNAVEEERYHDASRLWRLAGSG  99

Query  645  LVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            LVGWWVG++KDS D FGR+VRITPG+GR++ +
Sbjct  100  LVGWWVGWAKDSDDPFGRIVRITPGVGRYVAK  131



>ref|XP_010499237.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=647

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ E+  S+LK QLE+AV+ EDF EA KLK AIAEAT  D +AEIM QL+ AI 
Sbjct  89   RHFSEIEEVEAVVSLLKSQLEEAVKKEDFEEAVKLKQAIAEATVDDAVAEIMRQLQTAIS  148

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DASRLC  TG GLVGWWV   +D  +LFGR+V ITPG+GRFI +
Sbjct  149  EERYQDASRLCNETGCGLVGWWVSRPRDYAELFGRIVHITPGVGRFIAK  197



>ref|NP_001182951.1| hypothetical protein [Zea mays]
 gb|ACR35247.1| unknown [Zea mays]
 tpg|DAA53812.1| TPA: hypothetical protein ZEAMMB73_854553 [Zea mays]
 tpg|DAA53813.1| TPA: hypothetical protein ZEAMMB73_854553 [Zea mays]
Length=622

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E++QAESYAS+L+FQLE+AVENEDF EAAKLK  I  AT  D +A +M +LK+AI 
Sbjct  64   RHFDEVDQAESYASLLQFQLEEAVENEDFAEAAKLKRDIIAATGNDAVAHVMAELKSAIE  123

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            E+RY DASRL R  G+ LVGWWVGY+K   D  GR+VRI+PG+GR++ +
Sbjct  124  EQRYQDASRLTRLAGTSLVGWWVGYAKGIDDSIGRIVRISPGVGRYVAK  172



>gb|KFK28712.1| hypothetical protein AALP_AA7G037200 [Arabis alpina]
Length=659

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HFSE+++ +S  S LK QLE A+E EDF EAAKLK  I EAT  DT+AEIMLQL+ AI 
Sbjct  89   QHFSEIDKIDSLVSHLKIQLEKAIEIEDFKEAAKLKKDIVEATWNDTVAEIMLQLQAAIS  148

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DASRLC  TGSGL+GWWVG S+DS + FGR+V IT G+GRFIG+
Sbjct  149  EERYRDASRLCSVTGSGLLGWWVGCSEDSEEPFGRIVHITQGVGRFIGK  197



>ref|XP_010460515.1| PREDICTED: protein EXECUTER 1, chloroplastic [Camelina sativa]
Length=648

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ E+  S+LK QLE+AV+ EDF EA KLK AIAEAT  D +AEIM QL+ AI 
Sbjct  90   RHFSEVEEVEAVVSLLKSQLEEAVKKEDFEEAVKLKQAIAEATVDDAVAEIMRQLQTAIS  149

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDASRLC  TGSGLVGWWV   +D  +LFGR+V ITPG+GRFI +
Sbjct  150  EERYHDASRLCNETGSGLVGWWVSRPRDYAELFGRIVHITPGVGRFIAK  198



>ref|XP_004508896.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Cicer arietinum]
Length=608

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  M++AE  AS+ + QLE A++ ED+ EAA+LK  I EATS D +A+IM QLK+ I 
Sbjct  62   QHFFHMQKAERTASLFELQLEHAIDREDYGEAARLKRDIDEATSVDAVAQIMSQLKSFID  121

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIG  737
            +ERY DAS+LC  +G GL+GWWVG +KD  D  GR+++ITPG+GRFI 
Sbjct  122  DERYEDASKLCTLSGCGLLGWWVGLAKDFDDPIGRIIQITPGVGRFIA  169



>ref|XP_006645432.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Oryza brachyantha]
Length=577

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +3

Query  429  MEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYH  608
            M+    +  +  FQLE+AV+NEDF EAA LK AI EAT  D +A++M +LK AI E+RY 
Sbjct  25   MDNVVGFKHIPSFQLEEAVDNEDFSEAANLKKAILEATGNDAVAQVMSELKIAIEEQRYQ  84

Query  609  DASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            DASRL +   + LVGWWVGY+KD+ D  GR+VRITPG+GR++ +
Sbjct  85   DASRLTKLARTNLVGWWVGYAKDTDDSIGRIVRITPGVGRYVAK  128



>emb|CAN68092.1| hypothetical protein VITISV_012749 [Vitis vinifera]
Length=943

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+EQAES+ASVLKFQLEDA+E EDF EAAKLK AIAEA S D++ EIM QLKNAI 
Sbjct  852  RHFSEIEQAESFASVLKFQLEDAIEREDFEEAAKLKMAIAEAMSMDSVTEIMSQLKNAID  911

Query  594  EERYHDASRLCRSTGSGLV  650
            EERYHDAS+LCR T SGLV
Sbjct  912  EERYHDASKLCRHTASGLV  930



>ref|XP_010254545.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nelumbo nucifera]
 ref|XP_010254546.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nelumbo nucifera]
Length=690

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E+E+ E   SVLK QL DA+  ED+ EAAKLK AIA A + DT+ ++      AI 
Sbjct  130  KHFKEVEEQERIVSVLKSQLVDAIYKEDYEEAAKLKVAIAAAATNDTVGKVTSHFNRAIK  189

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+RL    G+GLVGWW G S+ SGD +GR++RIT   GR++ +
Sbjct  190  EERYQDAARLRDYAGAGLVGWWAGISEGSGDPYGRIIRITAEHGRYVAK  238



>gb|KCW63355.1| hypothetical protein EUGRSUZ_G009901, partial [Eucalyptus grandis]
 gb|KCW63356.1| hypothetical protein EUGRSUZ_G009901, partial [Eucalyptus grandis]
 gb|KCW63357.1| hypothetical protein EUGRSUZ_G009901, partial [Eucalyptus grandis]
Length=281

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E++  E   S+LK QL +AV  ED+ EA +LK AIA A++ DT+  +M  LK+AI 
Sbjct  141  RHFEEIDGQERLLSILKSQLSNAVVKEDYEEAGRLKVAIAAASTGDTVGRVMSYLKSAIN  200

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDA+ +  + G+GLVGWW G S D+ D +G ++R+T   GR++ R
Sbjct  201  EERYHDAAFMRDNAGAGLVGWWAGTSNDTYDPYGVIIRVTAEHGRYVAR  249



>ref|XP_006852930.1| PREDICTED: protein EXECUTER 1, chloroplastic [Amborella trichopoda]
 ref|XP_011626429.1| PREDICTED: protein EXECUTER 1, chloroplastic [Amborella trichopoda]
 gb|ERN14397.1| hypothetical protein AMTR_s00033p00235330 [Amborella trichopoda]
Length=726

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+E+ E   SVLK QL DAV+ ED+ EAAKLK AIA A   DT+  ++ +L  A+ 
Sbjct  158  RHFKEVEEQEKLVSVLKAQLRDAVQREDYNEAAKLKVAIAAAAVNDTVGRVLSRLNKALK  217

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +  + G+GLVGWW G S+DS D +GR+  I+   GR++ R
Sbjct  218  EERYEDAAFIRDNAGAGLVGWWAGISEDSTDPYGRIFHISSAHGRYVAR  266



>ref|XP_002455330.1| hypothetical protein SORBIDRAFT_03g008585 [Sorghum bicolor]
 gb|EES00450.1| hypothetical protein SORBIDRAFT_03g008585, partial [Sorghum bicolor]
Length=170

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +3

Query  489  NEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRSTGSGLVGWWVGY  668
            NEDF+EA KLK  I E T  D +A +M +LK++I ++RY DAS+L R  G+ LVGWWVGY
Sbjct  1    NEDFVEAVKLKRDIIEDTGNDAVAHVMAELKSSIEDQRYQDASKLTRLAGTSLVGWWVGY  60

Query  669  SKDSGDLFGRLVRITPGMGRFIGR  740
            +KD+ D  GR+VRI+PG+GR++ +
Sbjct  61   AKDTDDSIGRIVRISPGVGRYVAK  84



>ref|XP_002967707.1| hypothetical protein SELMODRAFT_227764 [Selaginella moellendorffii]
 gb|EFJ31054.1| hypothetical protein SELMODRAFT_227764 [Selaginella moellendorffii]
Length=693

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 75/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF ++E+ ++  S LKFQLE+AV+ E+F EAAKLK AI  A + D I+E+  +L+ A+ E
Sbjct  129  HFPKVEEEDNLISALKFQLEEAVKLENFQEAAKLKRAIEAAKANDVISEVNKELQRALQE  188

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+RL    G+GLVGWW G SKD  D FGR++R+    GR I +
Sbjct  189  ERYKDAARLRDEAGAGLVGWWAGISKDGSDPFGRIIRVRAAHGRLIAQ  236



>ref|XP_002271011.1| PREDICTED: protein EXECUTER 1, chloroplastic [Vitis vinifera]
 emb|CBI38225.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HFSE+++ E   S+LK QL  AV+ ED+ +AA+LK AIA A + DT+  +M  L  AI 
Sbjct  139  KHFSEVDEQERIVSILKSQLGHAVKKEDYEDAARLKVAIAAAATNDTVGRVMSLLNRAIA  198

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +  S G+GLVGWW G S D+ D +GR+VRI+   GR++ R
Sbjct  199  EERYDDAAFIRDSAGAGLVGWWAGISDDNNDPYGRIVRISAEHGRYVAR  247



>ref|XP_002964327.1| hypothetical protein SELMODRAFT_166436 [Selaginella moellendorffii]
 gb|EFJ34660.1| hypothetical protein SELMODRAFT_166436 [Selaginella moellendorffii]
Length=684

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF ++E+ ++  S LKFQLE+AV+ E F EAAKLK AI  A + D I+E+  +L+ A+ E
Sbjct  129  HFPKVEEEDNLISALKFQLEEAVKLEHFQEAAKLKRAIEAAKANDVISEVNKELQRALQE  188

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+RL    G+GLVGWW G SKD  D FGR++R+    GR I +
Sbjct  189  ERYKDAARLRDEAGAGLVGWWAGISKDGSDPFGRIIRVRAAHGRLIAQ  236



>ref|XP_010065730.1| PREDICTED: protein EXECUTER 1, chloroplastic [Eucalyptus grandis]
 ref|XP_010065731.1| PREDICTED: protein EXECUTER 1, chloroplastic [Eucalyptus grandis]
Length=704

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E++  E   S+LK QL +AV  ED+ EA +LK AIA A++ DT+  +M  LK+AI 
Sbjct  141  RHFEEIDGQERLLSILKSQLSNAVVKEDYEEAGRLKVAIAAASTGDTVGRVMSYLKSAIN  200

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDA+ +  + G+GLVGWW G S D+ D +G ++R+T   GR++ R
Sbjct  201  EERYHDAAFMRDNAGAGLVGWWAGTSNDTYDPYGVIIRVTAEHGRYVAR  249



>ref|XP_007042830.1| Executer 1 isoform 4 [Theobroma cacao]
 gb|EOX98661.1| Executer 1 isoform 4 [Theobroma cacao]
Length=546

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QL +AV  ED+ +AA+LK AIA A + DT+  ++  L  A+V
Sbjct  117  KHFEQVDEQERLLSLLKSQLNEAVSREDYEDAARLKVAIAAAATNDTVGRVISHLNRAVV  176

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+HDA+ L  + G+GLVGWW G S D+ D +G ++R+T   GR++ R
Sbjct  177  EERFHDAAFLRDNAGAGLVGWWAGLSDDTKDPYGLIIRVTAEHGRYVAR  225



>ref|XP_006351723.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Solanum tuberosum]
Length=691

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHFSE+E+ E   SVLK QL  A+  ED+ +AA+LK AIA A +KD +  +M  +  AI 
Sbjct  132  RHFSEVEEEERLVSVLKSQLAHAISREDYEDAARLKVAIAAAATKDIVGRVMSHVNKAIE  191

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  +    G+GLVGWW G S+D  D +GR++RI+   GR++ R
Sbjct  192  EERYRDAVFMRDCAGTGLVGWWAGTSQDVSDPYGRIIRISAEHGRYVAR  240



>ref|XP_007042829.1| Executer 1 isoform 3 [Theobroma cacao]
 gb|EOX98660.1| Executer 1 isoform 3 [Theobroma cacao]
Length=681

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QL +AV  ED+ +AA+LK AIA A + DT+  ++  L  A+V
Sbjct  117  KHFEQVDEQERLLSLLKSQLNEAVSREDYEDAARLKVAIAAAATNDTVGRVISHLNRAVV  176

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+HDA+ L  + G+GLVGWW G S D+ D +G ++R+T   GR++ R
Sbjct  177  EERFHDAAFLRDNAGAGLVGWWAGLSDDTKDPYGLIIRVTAEHGRYVAR  225



>ref|XP_004230540.1| PREDICTED: protein EXECUTER 1, chloroplastic [Solanum lycopersicum]
Length=692

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HFSE+E+ E   SVLK QL  A+  ED+ +AA+LK AIA A +KD +  +M  +  A+ 
Sbjct  133  KHFSEVEEEERLVSVLKAQLAHAISREDYEDAARLKVAIAAAATKDIVGRVMSHVNKALE  192

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GLVGWW G S+D  D +GR++RI+   GR++ R
Sbjct  193  EERYRDAAFMRDCAGTGLVGWWAGTSQDVSDPYGRIIRISAEHGRYVAR  241



>ref|XP_007042827.1| Executer 1 isoform 1 [Theobroma cacao]
 ref|XP_007042828.1| Executer 1 isoform 1 [Theobroma cacao]
 gb|EOX98658.1| Executer 1 isoform 1 [Theobroma cacao]
 gb|EOX98659.1| Executer 1 isoform 1 [Theobroma cacao]
Length=685

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QL +AV  ED+ +AA+LK AIA A + DT+  ++  L  A+V
Sbjct  117  KHFEQVDEQERLLSLLKSQLNEAVSREDYEDAARLKVAIAAAATNDTVGRVISHLNRAVV  176

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+HDA+ L  + G+GLVGWW G S D+ D +G ++R+T   GR++ R
Sbjct  177  EERFHDAAFLRDNAGAGLVGWWAGLSDDTKDPYGLIIRVTAEHGRYVAR  225



>ref|XP_004504847.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004504848.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Cicer arietinum]
 ref|XP_004504849.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X3 
[Cicer arietinum]
 ref|XP_004504850.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X4 
[Cicer arietinum]
 ref|XP_004504851.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X5 
[Cicer arietinum]
 ref|XP_004504852.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X6 
[Cicer arietinum]
Length=696

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E++  E   ++LK QL  AV  ED+ EAAKLK AIA A++ D++  +M  LK AI 
Sbjct  110  QHFEEVDDQERLVTILKAQLRHAVYVEDYEEAAKLKVAIAAASNNDSVGRVMSLLKRAIK  169

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERY DA+ L    G+GLVGWW G SKD  D  G ++RITP  GR++ R
Sbjct  170  DERYSDAAFLRDKAGAGLVGWWAGISKDINDPHGLIIRITPEHGRYVAR  218



>ref|XP_002532765.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
 gb|EEF29622.1| EXECUTER1 protein, chloroplast precursor, putative [Ricinus communis]
Length=675

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E++  E   +VLK QL  AV  ED+ +AA+LK AIA A + D +  +M QL  A+ 
Sbjct  112  KHFDEVDDQERIVTVLKSQLGHAVNREDYEDAARLKVAIAAAATNDVVGRVMSQLNRAVA  171

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ L  + G+GLVGWW G S+D  D +G ++RIT   GRF+ R
Sbjct  172  EERYQDAALLRDNAGAGLVGWWSGMSEDEHDPYGLIIRITAEHGRFVAR  220



>ref|XP_011087954.1| PREDICTED: protein EXECUTER 1, chloroplastic [Sesamum indicum]
Length=698

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QL  A+E ED+ EAA++K AIA A + DT+ ++M  LK  + 
Sbjct  141  KHFVDVDELERIVSILKSQLASAIEREDYEEAARIKVAIAAAATNDTVGKVMSHLKKFVN  200

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ L    G+GLVGWW G S+D+ D +GR++ I+   GR+I R
Sbjct  201  EERYGDAALLRDYAGAGLVGWWAGISEDADDPYGRIIHISAEYGRYIAR  249



>ref|XP_010943895.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=706

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E+E+       LK QL DA+  ED+ EA KLK AIA AT KDT+   +  +  AI 
Sbjct  147  RHFAEVEEQHRLVFALKSQLTDAIIREDYKEAMKLKLAIAAATQKDTVGTAISDMNRAIE  206

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G+S+D  D +GR++RI+   GR++ R
Sbjct  207  EERYADAAHIRDHAGAGLLGWWAGFSEDGADPYGRIIRISAEHGRYVAR  255



>ref|XP_010943896.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=702

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E+E+       LK QL DA+  ED+ EA KLK AIA AT KDT+   +  +  AI 
Sbjct  147  RHFAEVEEQHRLVFALKSQLTDAIIREDYKEAMKLKLAIAAATQKDTVGTAISDMNRAIE  206

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G+S+D  D +GR++RI+   GR++ R
Sbjct  207  EERYADAAHIRDHAGAGLLGWWAGFSEDGADPYGRIIRISAEHGRYVAR  255



>ref|XP_008382212.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Malus domestica]
Length=246

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E+EQ E   S+LK QL  AV  EDF +AA+LK AIA A + D +  ++  L  AI E
Sbjct  115  HFLEVEQQERLVSLLKSQLRRAVSAEDFEDAARLKVAIAAAATNDVVGRVISHLNRAIQE  174

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+    + G+GLVGWW G S+D  D  G ++R+T   GR++ R
Sbjct  175  ERYQDAAFFRDNAGAGLVGWWAGLSEDKKDPRGIIIRVTAEHGRYVAR  222



>ref|XP_008348881.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Malus domestica]
Length=262

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E+EQ E   S+LK QL  AV  EDF +AA+LK AIA A + D +  ++  L  AI E
Sbjct  115  HFLEVEQQERLVSLLKSQLRRAVSAEDFEDAARLKVAIAAAATNDVVGRVISHLNRAIQE  174

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+    + G+GLVGWW G S+D  D  G ++R+T   GR++ R
Sbjct  175  ERYQDAAFFRDNAGAGLVGWWAGLSEDKKDPRGIIIRVTAEHGRYVAR  222



>ref|XP_010691393.1| PREDICTED: protein EXECUTER 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=709

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E+E+ E    +LK QL +AVE ED+ +AAKLK AIA A +KD +  +M  LKNA+ E
Sbjct  142  HFKEVEEQERLIKLLKSQLRNAVEKEDYEDAAKLKVAIAAAGTKDAVGSVMSYLKNAVEE  201

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA  +  + G+GLVGWW G S D  D  G ++RI+   GR++ R
Sbjct  202  ERYQDAVFVRDNAGAGLVGWWAGVSDDRNDPHGCIIRISAEHGRYVAR  249



>ref|XP_012081365.1| PREDICTED: protein EXECUTER 1, chloroplastic [Jatropha curcas]
 gb|KDP29991.1| hypothetical protein JCGZ_18758 [Jatropha curcas]
Length=687

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+++ E   SVLK QL  AV  ED+  AA+LK AIA A + D++  +M QL  A+ 
Sbjct  123  RHFEEVDEQERIVSVLKSQLNHAVNREDYEAAARLKVAIAAAATNDSVGTVMSQLNRAVT  182

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EE Y DA+ L  + G+GLVGWW G S+D  D +G ++RIT   GR++ R
Sbjct  183  EEHYKDAAFLRDNAGAGLVGWWSGISEDVHDPYGLIIRITAEHGRYVAR  231



>gb|EMT33306.1| hypothetical protein F775_23580 [Aegilops tauschii]
Length=577

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 22/112 (20%)
 Frame = +3

Query  471  LEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLK----------------------N  584
            LE+AVE EDF EAA LK A+ +AT+ D ++ +M +LK                      +
Sbjct  13   LEEAVEGEDFAEAAALKRALLDATADDAVSRVMAELKVYSNLPVSPSPAPDSHHVLLPRS  72

Query  585  AIVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            AI E+RY DASRL +  G+ LVGWWVGY+KD+ D  GR+VRITPG+GR++ +
Sbjct  73   AIEEQRYQDASRLTKLAGTSLVGWWVGYAKDTDDSIGRIVRITPGVGRYVAK  124



>ref|XP_010527017.1| PREDICTED: LOW QUALITY PROTEIN: protein EXECUTER 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=709

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ +   SVLK QL+ AVE ED+ +AA++K AIA A + DT+ ++M  L  AIV
Sbjct  131  KHFEQVDEQQRLLSVLKSQLKRAVEQEDYEDAARVKVAIAAAATNDTVGKVMSSLSRAIV  190

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EE Y DA+ L    G+GLVGWW G S+D  D +G +++IT   GR++ R
Sbjct  191  EEXYMDAAYLRDKAGAGLVGWWSGISEDVKDPYGLIIQITAEHGRYVAR  239



>gb|KJB79580.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
Length=629

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QL +AV  ED+ +AA+LK AIA A++ DT+   M  L  A+V
Sbjct  108  KHFEQVDEQERLLSLLKAQLYEAVCKEDYEDAARLKVAIAAASTNDTVGRTMSHLNKAVV  167

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+ DA+ L  + G+GLVGWW G S D+ D  G ++RIT   GR++ R
Sbjct  168  EERFEDAAFLRDTAGTGLVGWWAGLSDDTKDPHGLIIRITAEHGRYVAR  216



>ref|XP_002980519.1| hypothetical protein SELMODRAFT_178249 [Selaginella moellendorffii]
 gb|EFJ18170.1| hypothetical protein SELMODRAFT_178249 [Selaginella moellendorffii]
Length=590

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +3

Query  420  FSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEE  599
            F E+E+ E+  SVLKF LE+AVE ED+ EA +++  + +   +DT+ ++M  LK A+ EE
Sbjct  44   FHEVEEQENLLSVLKFDLEEAVEEEDYSEATRIRNEMLDIRRRDTLGQLMGDLKTALEEE  103

Query  600  RYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            RY DA+R+   T +GLVGWW G +++  D FGR++ IT   GR + R
Sbjct  104  RYEDAARIRDETDAGLVGWWAGAAEEGNDPFGRIINITSSQGRLVAR  150



>ref|XP_002976793.1| hypothetical protein SELMODRAFT_175826 [Selaginella moellendorffii]
 gb|EFJ21903.1| hypothetical protein SELMODRAFT_175826 [Selaginella moellendorffii]
Length=590

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +3

Query  420  FSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEE  599
            F E+E+ E+  SVLKF LE+AVE ED+ EA +++  + +   +DT+ ++M  LK A+ EE
Sbjct  44   FHEVEEQENLLSVLKFDLEEAVEEEDYSEATRIRNEMLDIRRRDTLGQLMGDLKTALEEE  103

Query  600  RYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            RY DA+R+   T +GLVGWW G +++  D FGR++ IT   GR + R
Sbjct  104  RYEDAARIRDETDAGLVGWWAGAAEEGNDPFGRIINITSSQGRLVAR  150



>emb|CDO97385.1| unnamed protein product [Coffea canephora]
Length=695

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HFS++++ E   SVLK QL  A+  ED+ +AA+LK AIA A + DTIA+ M  L  A+ 
Sbjct  137  KHFSDVDEQERIVSVLKSQLASAINREDYEDAARLKVAIAAAATSDTIAKAMSHLNRAVQ  196

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ L    G+GLVGWW G S+D+ D +G ++ I+   GR++ R
Sbjct  197  EERYGDAALLRDYAGAGLVGWWAGISEDTHDPYGCIIHISAEHGRYVAR  245



>ref|XP_001764388.1| predicted protein [Physcomitrella patens]
 gb|EDQ70655.1| predicted protein [Physcomitrella patens]
Length=638

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            + F+E+E  ES A++LK Q+E AVE EDF  AAK K A+   T KD +A++M  L+ A+ 
Sbjct  60   KVFAEVESCESLATMLKIQMEKAVEQEDFQSAAKCKAALDAVTEKDIVADVMNGLEQALA  119

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            +ERY DA+ L    G+GLVGWWVG ++   D +GR++ I    GR + +
Sbjct  120  DERYDDATLLRDKAGAGLVGWWVGLAEGGNDPYGRIINIYAAHGRLVAK  168



>ref|XP_009766666.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana sylvestris]
Length=697

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+E+E+ E   SVLK QL  A+  ED+ +AAKLK  IA A +KD +  +M +L  A+ 
Sbjct  138  KHFTEVEEEERLVSVLKSQLAHAISREDYEDAAKLKVGIAAAATKDIVGRVMSRLNKAVE  197

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EE+Y DA  +    G+GLVGWW G S+D  D +GR++RI+   GR++ +
Sbjct  198  EEQYKDAIFMRDYAGTGLVGWWAGTSEDVNDPYGRIIRISAEHGRYVAK  246



>gb|KJB79578.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
Length=667

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QL +AV  ED+ +AA+LK AIA A++ DT+   M  L  A+V
Sbjct  108  KHFEQVDEQERLLSLLKAQLYEAVCKEDYEDAARLKVAIAAASTNDTVGRTMSHLNKAVV  167

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+ DA+ L  + G+GLVGWW G S D+ D  G ++RIT   GR++ R
Sbjct  168  EERFEDAAFLRDTAGTGLVGWWAGLSDDTKDPHGLIIRITAEHGRYVAR  216



>gb|KJB79577.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
 gb|KJB79579.1| hypothetical protein B456_013G055300 [Gossypium raimondii]
Length=683

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QL +AV  ED+ +AA+LK AIA A++ DT+   M  L  A+V
Sbjct  108  KHFEQVDEQERLLSLLKAQLYEAVCKEDYEDAARLKVAIAAASTNDTVGRTMSHLNKAVV  167

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+ DA+ L  + G+GLVGWW G S D+ D  G ++RIT   GR++ R
Sbjct  168  EERFEDAAFLRDTAGTGLVGWWAGLSDDTKDPHGLIIRITAEHGRYVAR  216



>gb|EYU18410.1| hypothetical protein MIMGU_mgv1a005491mg [Erythranthe guttata]
Length=482

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            ++F E+++ E  AS+LK QL  A+E ED+ +AA++K AIA A + DT+   M  LK  + 
Sbjct  129  KYFVEVDEQERIASILKSQLASAIEREDYEDAARIKVAIAAAATNDTVGRAMSHLKKFVE  188

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GLVGWW G   D  D +GR++ I+   GR+I R
Sbjct  189  EERYGDAALIRDYAGAGLVGWWTGIPDDPNDPYGRIIHISAEYGRYIAR  237



>ref|XP_011043046.1| PREDICTED: protein EXECUTER 1, chloroplastic [Populus euphratica]
Length=677

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF ++++ +   S+LK QL +AV  ED+ +AA+LK AIA A S DT+  +M QL  A+ +
Sbjct  116  HFDQVDEQQRLVSLLKSQLGNAVNREDYEDAARLKVAIAAAASNDTVGRVMSQLNRALAQ  175

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY +A+ L  + G+GLVGWW G S+D  D +G ++RIT   GR++ R
Sbjct  176  ERYLEAAFLRDNAGAGLVGWWSGVSEDVDDPYGLIIRITAEHGRYVAR  223



>ref|XP_001758844.1| predicted protein [Physcomitrella patens]
 gb|EDQ76350.1| predicted protein [Physcomitrella patens]
Length=588

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +3

Query  420  FSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEE  599
            F+E+E +ES A+ LK QLE AVE E+F  AAK K A+   T KD +AE+M  LK A+ EE
Sbjct  19   FAEVETSESLATTLKSQLEKAVEQENFQAAAKCKVALDAVTQKDVVAEVMNGLKKALAEE  78

Query  600  RYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            RY +A+      G+GLVGWWVG ++   D +GR++ I    GR + +
Sbjct  79   RYDNATLFRDKAGAGLVGWWVGLAEGGNDPYGRIINIYAAHGRLVAK  125



>ref|XP_002323934.2| hypothetical protein POPTR_0017s07060g [Populus trichocarpa]
 gb|EEF04067.2| hypothetical protein POPTR_0017s07060g [Populus trichocarpa]
Length=677

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF ++++ +   S+LK QL +AV  ED+ +AA+LK AIA A S DT+  +M QL  A+ +
Sbjct  116  HFDQVDEQQRLVSLLKSQLGNAVNREDYEDAARLKVAIAAAASNDTVGRVMSQLNRALAQ  175

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY +A+ L  + G+GLVGWW G S+D  D +G ++RIT   GR++ R
Sbjct  176  ERYLEAAFLRDNAGAGLVGWWSGISEDVDDPYGLIIRITAEHGRYVAR  223



>ref|XP_007199722.1| hypothetical protein PRUPE_ppa002360mg [Prunus persica]
 gb|EMJ00921.1| hypothetical protein PRUPE_ppa002360mg [Prunus persica]
Length=682

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E+E+ E   S+LK QL  AV  EDF +AA+LK AIA A + D +  ++  L  A+ 
Sbjct  118  QHFLEVEEQERLLSLLKSQLGRAVYTEDFEDAARLKVAIAAAATNDVVGRVIFHLNRAVQ  177

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+    + G+GLVGWW G SKD  D  G ++R+T   GR++ R
Sbjct  178  EERYQDAAFFRDNAGAGLVGWWAGLSKDKKDPHGLIIRVTAEHGRYVAR  226



>ref|XP_008237129.1| PREDICTED: protein EXECUTER 1, chloroplastic [Prunus mume]
 ref|XP_008237130.1| PREDICTED: protein EXECUTER 1, chloroplastic [Prunus mume]
 ref|XP_008237131.1| PREDICTED: protein EXECUTER 1, chloroplastic [Prunus mume]
Length=682

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E+E+ E   S+LK QL  AV  EDF +AA+LK AIA A + D +  ++  L  A+ 
Sbjct  118  QHFLEVEEQERLLSLLKSQLGRAVYTEDFEDAARLKVAIAAAATNDVVGRVIFHLNRAVQ  177

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+    + G+GLVGWW G SKD  D  G ++R+T   GR++ R
Sbjct  178  EERYQDAAFFRDNAGAGLVGWWAGLSKDKKDPHGLIIRVTAEHGRYVAR  226



>gb|AES90588.2| executer 1 [Medicago truncatula]
Length=708

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            +F +++  E    +LK QL  AV  ED+ EAAKLK AIA A + D++ ++   LK AI E
Sbjct  115  YFDQVDDQERLLIILKSQLRHAVYVEDYEEAAKLKVAIAAAANNDSVGKVKTLLKRAIKE  174

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY+DA+ L    G+GLVGWW G SKD  D  G ++RITP  GR++ R
Sbjct  175  ERYNDAAFLRDKAGAGLVGWWAGISKDVNDPHGLIIRITPEHGRYVAR  222



>ref|XP_007159151.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
 ref|XP_007159152.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
 gb|ESW31145.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
 gb|ESW31146.1| hypothetical protein PHAVU_002G213200g [Phaseolus vulgaris]
Length=684

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+++ E   S+LK QL  AV  ED+ +AA+LK A A A + D++  +M  L  AI 
Sbjct  96   RHFEEIDEQERLLSILKSQLSRAVYLEDYEDAARLKVAFAAAANNDSVGRVMSYLNRAIK  155

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ L    G GLVGWW G S+D  D  G ++RITP  GR++ R
Sbjct  156  EERYGDAAFLRDKAGVGLVGWWAGISEDVNDPHGLIIRITPEHGRYVAR  204



>ref|XP_003608391.1| Protein EXECUTER [Medicago truncatula]
Length=772

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            +F +++  E    +LK QL  AV  ED+ EAAKLK AIA A + D++ ++   LK AI E
Sbjct  115  YFDQVDDQERLLIILKSQLRHAVYVEDYEEAAKLKVAIAAAANNDSVGKVKTLLKRAIKE  174

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY+DA+ L    G+GLVGWW G SKD  D  G ++RITP  GR++ R
Sbjct  175  ERYNDAAFLRDKAGAGLVGWWAGISKDVNDPHGLIIRITPEHGRYVAR  222



>ref|XP_008373217.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Malus domestica]
Length=681

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E+EQ E   S+LK QL  AV  EDF +AA+LK AIA A + D +  ++  L  A+ E
Sbjct  118  HFLEVEQQERLVSLLKSQLGRAVYAEDFEDAARLKVAIAAAATNDVVGRVISHLNRAVEE  177

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+    + G+GLVGWW G SKD  D  G ++R+T   GR++ R
Sbjct  178  ERYQDAAFFRDNAGAGLVGWWAGLSKDKKDPRGLIIRVTAEHGRYVAR  225



>ref|XP_009366321.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009366322.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Pyrus x bretschneideri]
Length=678

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E+EQ E   S+LK QL  AV  EDF +AA+LK AIA A + D +  ++  L  A+ E
Sbjct  118  HFLEVEQQERLVSLLKSQLGRAVYAEDFEDAARLKVAIAAAATNDVVGRVISHLNRAVEE  177

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+    + G+GLVGWW G SKD  D  G ++R+T   GR++ R
Sbjct  178  ERYQDAAFFRDNAGAGLVGWWAGLSKDKKDPRGIIIRVTAEHGRYVAR  225



>ref|XP_009400393.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400394.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400395.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400396.1| PREDICTED: protein EXECUTER 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=712

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E+E+ E   S+LK QL DA+  E++ +A KLK AIA AT  D +   +  +  AI 
Sbjct  154  RHFTEIEEQERLLSILKSQLNDAIAKEEYEDAVKLKLAIAGATENDIVGTAISTMNRAIE  213

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EE Y+ A+ +    G+GLVGWW G+S+D  D +GR++ I+   GR++ R
Sbjct  214  EENYNGAAHIRDHAGAGLVGWWSGFSEDGADPYGRIIHISAEYGRYVAR  262



>gb|KHN19019.1| Protein EXECUTER 1, chloroplastic [Glycine soja]
Length=636

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF  +++ E    +LK +L DA+  ED+ +AA LK AIA   +KDT+   +  LK AI E
Sbjct  68   HFHVVDEQELLLDILKSRLGDALRLEDYEDAATLKVAIATVATKDTVGTAISHLKRAIEE  127

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+ L    G+GLVGWW G SKD  D  G ++RITP  GR++ R
Sbjct  128  ERYSDAAFLRDEAGTGLVGWWAGMSKDINDPHGLIIRITPEHGRYVAR  175



>ref|XP_003541783.2| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=643

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF  +++ E    +LK +L DA+  ED+ +AA LK AIA   +KDT+   +  LK AI E
Sbjct  75   HFHVVDEQELLLDILKSRLGDALRLEDYEDAATLKVAIATVATKDTVGTAISHLKRAIEE  134

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+ L    G+GLVGWW G SKD  D  G ++RITP  GR++ R
Sbjct  135  ERYSDAAFLRDEAGTGLVGWWAGMSKDINDPHGLIIRITPEHGRYVAR  182



>gb|KJB53139.1| hypothetical protein B456_008G294800 [Gossypium raimondii]
Length=516

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +3

Query  555  IAEIMLQLKNAIVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFI  734
            + E ++ L++AI EERYHDASRL R TGSGLVGWWVGYSKDS D FGRLVRITPG+GRF+
Sbjct  5    LLESVVYLQSAIDEERYHDASRLSRLTGSGLVGWWVGYSKDSDDPFGRLVRITPGVGRFV  64

Query  735  GR  740
             R
Sbjct  65   AR  66



>emb|CDX72417.1| BnaC07g44390D [Brassica napus]
Length=683

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  ++  +   SVLK QL  AV+ ED+ +AA+LK AIA A++ D++  +M     A++
Sbjct  116  KHFEHVDDQDRLLSVLKSQLNGAVKREDYEDAARLKVAIAAASANDSVGRVMSSFNRAVL  175

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G ++D  D FG +V+IT   GR++ R
Sbjct  176  EERYKDAVYLRDKAGAGLVGWWSGIAEDVKDPFGLIVQITAEHGRYVAR  224



>ref|XP_009138201.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Brassica rapa]
Length=689

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  ++  +   S+LK QL  AV+ ED+ +AA+LK AIA A++ D +  +M     A++
Sbjct  125  KHFERIDDQDRLLSLLKSQLNGAVKREDYEDAARLKVAIAAASTNDAVGRVMSSFNRAVL  184

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  185  EERYKDAVYLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  233



>ref|XP_002869202.1| hypothetical protein ARALYDRAFT_913050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45461.1| hypothetical protein ARALYDRAFT_913050 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF +++  +   SVLK QL  A++ ED+ +AA+LK AIA   + D + ++M     A++
Sbjct  115  KHFEQVDDQDRLLSVLKSQLNRAIKREDYEDAARLKVAIAATATNDAVGKVMSTFYRAVL  174

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  175  EERYKDAVYLRDKAGAGLVGWWSGISQDVKDPFGLIVQITAEHGRYVAR  223



>ref|XP_009602483.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana tomentosiformis]
Length=697

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+E+E+ E   SVLK QL  A+  ED+ +AAKLK  IA A +KD +  +M +L  A+ 
Sbjct  138  KHFTEVEEEERLVSVLKSQLAHAISREDYEDAAKLKVGIAAAATKDIVGRVMSRLNKAVE  197

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EE+Y DA  +    G+GLVGWW G S+D    +GR++ I+   GR++ +
Sbjct  198  EEQYKDAIFMRDYAGTGLVGWWAGTSEDVNYPYGRIIHISAEHGRYVAK  246



>gb|EPS72739.1| hypothetical protein M569_02016, partial [Genlisea aurea]
Length=621

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+LK QLE A++ ED+ +AA++K AIA A++ DT+  ++  ++  + 
Sbjct  90   KHFVDVDEQERIISILKGQLEVAIDGEDYADAARIKLAIAAASTNDTVGRVLSHMEKFVG  149

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EE Y DA+ L    G+GLVGWW G S D GD +G +++I+   GR+I R
Sbjct  150  EELYRDAALLRDYGGAGLVGWWAGISDDPGDPYGCVIQISAEYGRYIAR  198



>ref|XP_008455152.1| PREDICTED: protein EXECUTER 1, chloroplastic [Cucumis melo]
Length=695

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E+++ E   S LK +L  AV  ED+ +AA+LK AIA   + DT+   M  L  AI 
Sbjct  122  KHFDEVDEQERLVSFLKSRLSHAVYAEDYQDAARLKVAIAALATNDTVGRAMSYLHRAIE  181

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDA+ +  + G+GLVGWW G SKD+ +  G ++RIT   GR++ R
Sbjct  182  EERYHDAAFIRDNAGAGLVGWWSGISKDNHNSRGLIIRITAEHGRYVAR  230



>ref|NP_567929.1| protein EXECUTER 1 [Arabidopsis thaliana]
 ref|NP_849488.1| protein EXECUTER 1 [Arabidopsis thaliana]
 sp|Q93YW0.1|EXEC1_ARATH RecName: Full=Protein EXECUTER 1, chloroplastic; Short=AtEX1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24154.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51248.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86257.1| protein EXECUTER 1 [Arabidopsis thaliana]
 gb|AEE86258.1| protein EXECUTER 1 [Arabidopsis thaliana]
Length=684

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF +++  +   SVLK QL  A++ ED+ +AA+LK AIA   + D + ++M     A++
Sbjct  118  KHFDQVDDQDRLLSVLKSQLNRAIKREDYEDAARLKVAIAATATNDAVGKVMSTFYRALL  177

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  178  EERYKDAVYLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  226



>ref|XP_004137062.1| PREDICTED: protein EXECUTER 1, chloroplastic [Cucumis sativus]
 ref|XP_011658818.1| PREDICTED: protein EXECUTER 1, chloroplastic [Cucumis sativus]
 gb|KGN43753.1| hypothetical protein Csa_7G065120 [Cucumis sativus]
Length=700

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E+++ E   S LK ++  AV  ED+ +AA+LK AIA   + DT+   M  L  AI 
Sbjct  123  KHFDEVDEQERLVSFLKSRISHAVYAEDYQDAARLKVAIAALATNDTVGRAMSYLHRAIE  182

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERYHDA+ +  + G+GLVGWW G SKD  +  G ++RIT   GR++ R
Sbjct  183  EERYHDAAFIRDNAGAGLVGWWSGISKDKNNSRGLIIRITAEHGRYVAR  231



>ref|XP_008776948.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=701

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E+E+ +S  SVLK QL DA+  E++ EAAKLK AIA AT KDT+   +  +  AI 
Sbjct  147  RHFAEIEEQQSLVSVLKSQLSDAIIRENYKEAAKLKLAIAAATEKDTVGAAISDMNRAIE  206

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G+S+D  D +GR++RI+   GR++ R
Sbjct  207  EERYADAAYIRDHAGAGLLGWWAGFSEDGADPYGRIIRISAEHGRYVAR  255



>ref|XP_008776947.1| PREDICTED: protein EXECUTER 1, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=705

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+E+E+ +S  SVLK QL DA+  E++ EAAKLK AIA AT KDT+   +  +  AI 
Sbjct  147  RHFAEIEEQQSLVSVLKSQLSDAIIRENYKEAAKLKLAIAAATEKDTVGAAISDMNRAIE  206

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G+S+D  D +GR++RI+   GR++ R
Sbjct  207  EERYADAAYIRDHAGAGLLGWWAGFSEDGADPYGRIIRISAEHGRYVAR  255



>ref|XP_003528395.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Glycine max]
Length=699

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+++ E   S LK QL  AV  ED+ +AA+LK A A A + D++  +M  L  AI 
Sbjct  104  RHFEEIDEQERLLSTLKSQLSRAVYLEDYEDAARLKVAFAAAANNDSVGRVMSYLNRAIK  163

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ L    G+GLVGWW G S+   D    ++RITP  GR++ R
Sbjct  164  EERYGDAAFLRDKAGTGLVGWWAGISEGVNDPHSLIIRITPEHGRYVAR  212



>ref|XP_006423689.1| hypothetical protein CICLE_v100298792mg, partial [Citrus clementina]
 gb|ESR36929.1| hypothetical protein CICLE_v100298792mg, partial [Citrus clementina]
Length=333

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E++  E   S+LK QL +AV  E++ +AA+LK AIA A + D +  +M  L  A+V+
Sbjct  121  HFDEVDDQERLVSILKSQLGNAVFKEEYDDAARLKVAIAAAATNDAVGRVMSNLNRAVVQ  180

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+ L  + G+GLVGWW G S+D  D +G ++R+T   G+++ R
Sbjct  181  ERYEDAALLRDNAGAGLVGWWAGISEDKKDPYGLIIRVTAEHGKYVAR  228



>ref|XP_007148361.1| hypothetical protein PHAVU_006G201700g [Phaseolus vulgaris]
 gb|ESW20355.1| hypothetical protein PHAVU_006G201700g [Phaseolus vulgaris]
Length=629

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = +3

Query  414  RH-FSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAI  590
            RH F E+E+ E    +LK ++ +AV+ ED+ +AA LK AIA     DT+  ++  L  A+
Sbjct  81   RHRFHEVEEQERLLRILKSRIGNAVKLEDYDDAATLKVAIAAVAKDDTVGTVISNLNRAV  140

Query  591  VEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIG  737
             EERY DA+ L    G+GLVGWW G SKD+ D  G ++RITP  GR++ 
Sbjct  141  EEERYSDAAFLRDEAGTGLVGWWAGMSKDTIDPHGVIIRITPEHGRYVA  189



>ref|XP_003532602.2| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Glycine max]
Length=699

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF E+++ E   S+ K QL  AV  E++ +AA+LK A A   + D++  +M  L  AI 
Sbjct  130  RHFEEIDEQERLLSIFKSQLSRAVYLENYEDAARLKVAFAATANNDSVGRVMSYLNRAIK  189

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ L    G+GLVGWW G S+   D  G ++RITP  GR++ R
Sbjct  190  EERYGDAAFLRDKAGAGLVGWWSGISEGVNDPHGLIIRITPEHGRYVAR  238



>ref|XP_009368302.1| PREDICTED: protein EXECUTER 1, chloroplastic [Pyrus x bretschneideri]
Length=708

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E+EQ E   S+LK QL  AV  EDF +AA+LK AIA A + D +  ++  L  AI E
Sbjct  145  HFLEVEQQERLVSLLKLQLGRAVYAEDFEDAARLKVAIAAAAANDVVGRVISHLNRAIQE  204

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+    + G+GLVGWW G S+D  D  G ++R+T   GR++ R
Sbjct  205  ERYQDAAFFRDTAGAGLVGWWAGLSEDKKDPHGIIIRVTAEHGRYVAR  252



>ref|XP_006494691.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006494692.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Citrus sinensis]
 ref|XP_006494693.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X3 
[Citrus sinensis]
 ref|XP_006494694.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X4 
[Citrus sinensis]
Length=684

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E++  E   S+LK QL +AV  E++ +AA+LK AIA A + D +  +M  L  A+V+
Sbjct  121  HFDEVDDQERLVSILKSQLGNAVFKEEYDDAARLKVAIAAAATNDAVGRVMSNLNRAVVQ  180

Query  597  ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            ERY DA+ L  + G+GLVGWW G S+D  D +G ++R+T   G+++ R
Sbjct  181  ERYEDAALLRDNAGAGLVGWWAGISEDKKDPYGLIIRVTAEHGKYVAR  228



>ref|XP_004290412.1| PREDICTED: protein EXECUTER 1, chloroplastic [Fragaria vesca 
subsp. vesca]
 ref|XP_011458399.1| PREDICTED: protein EXECUTER 1, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=658

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF E+E+ E   S+LK QL  AV  EDF +AA+LK AIA A++ D +  ++ +L  A+ 
Sbjct  93   QHFLEVEEEERLVSILKAQLGRAVNVEDFEDAARLKVAIAAASTNDVVGRVISRLNTALQ  152

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY +A+    +  +GLVGWW G SKDS D  G ++R+T   GR++ R
Sbjct  153  EERYQEAAFFRDNAAAGLVGWWAGISKDSKDPHGLIIRVTAEHGRYVAR  201



>ref|XP_006412332.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
 ref|XP_006412333.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
 gb|ESQ53785.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
 gb|ESQ53786.1| hypothetical protein EUTSA_v10024585mg [Eutrema salsugineum]
Length=683

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF +++  +   SVLK QL  A++ ED+ +AA+LK AIA A + D +  +M +   A++
Sbjct  118  KHFDQIDDQDRLLSVLKSQLSRAIKREDYDDAARLKVAIAAAATNDAVGRVMSRFNKAVL  177

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  178  EERYKDAVYLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  226



>ref|XP_001762432.1| predicted protein [Physcomitrella patens]
 gb|EDQ72899.1| predicted protein, partial [Physcomitrella patens]
Length=348

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = +3

Query  462  KFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRSTGS  641
            + Q+E+A+  EDF +A ++K  +A   S+D +A  M   KNA+ EERY DA+ L    G 
Sbjct  14   QLQIEEAINLEDFEKAGRIKKKLAAVKSEDLVAGAMSDYKNALEEERYRDAAYLRDEAGV  73

Query  642  GLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            GLVGWW G S+D  D +GR++ I+P  GRFI +
Sbjct  74   GLVGWWAGMSEDDKDPYGRIINISPSEGRFIAK  106



>ref|XP_006283255.1| hypothetical protein CARUB_v10004291mg [Capsella rubella]
 gb|EOA16153.1| hypothetical protein CARUB_v10004291mg [Capsella rubella]
Length=676

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  ++  +   SVLK QL  A++ ED+ +AA+LK AIA A + D + ++M     A++
Sbjct  111  KHFELVDDQDRLLSVLKSQLNRAIKREDYEDAARLKVAIAAAATNDAVGKVMSSFYRAVL  170

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  171  EERYKDAVDLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  219



>emb|CDY28313.1| BnaC03g66460D [Brassica napus]
Length=699

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  +++ +   SVLK QL  AV+ E++ +AA+LK AIA A + D +  +M     A++
Sbjct  126  KHFELIDEQDRLISVLKSQLNGAVKREEYEDAARLKVAIAAAATNDAVGRVMSSFNRAVL  185

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  186  EERYKDAVYLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  234



>ref|XP_010432534.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=678

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  ++  +   SVLK QL+ A++ ED+ +AA LK AIA A + D + ++M     A++
Sbjct  113  KHFELVDDQDRLLSVLKSQLKRAIKREDYEDAASLKVAIAAAATNDAVGKVMSSFYRAVL  172

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  173  EERYKDAVDLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  221



>ref|XP_010447214.1| PREDICTED: protein EXECUTER 1, chloroplastic [Camelina sativa]
 ref|XP_010447215.1| PREDICTED: protein EXECUTER 1, chloroplastic [Camelina sativa]
Length=674

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  ++  +   SVLK QL+ A++ ED+ +AA LK AIA A + D + ++M     A++
Sbjct  109  KHFELVDDQDRLLSVLKSQLKRAIKREDYEDAASLKVAIAAAATNDAVGKVMSSFYRAVL  168

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  169  EERYKDAVDLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  217



>gb|KJB77570.1| hypothetical protein B456_012G144000 [Gossypium raimondii]
Length=679

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+L+ QL +AV +ED+ +AA+LK AIA A+  DT+  ++  L  A++
Sbjct  114  KHFEQVDEQERLLSLLRSQLNEAVLSEDYEDAARLKVAIAAASRNDTVGRVISHLNRAVM  173

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+ DA  L  + G+GLVGWW G   D+ D +G ++RIT   GR++ R
Sbjct  174  EERFLDAVFLRDNAGAGLVGWWAGLPNDTKDPYGLIIRITAEHGRYVAR  222



>gb|KHG21655.1| Protein EXECUTER 1, chloroplastic [Gossypium arboreum]
Length=679

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+L+ QL +AV +ED+ +AA+LK AIA A+  DT+  ++  L  A++
Sbjct  114  KHFEQVDEQERLLSLLRSQLNEAVLSEDYEDAARLKVAIAAASRNDTVGRVISHLNRAVM  173

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+ DA  L  + G+GLVGWW G   D+ D +G ++RIT   GR++ R
Sbjct  174  EERFLDAVFLRDNAGAGLVGWWAGLPNDTKDPYGLIIRITAEHGRYVAR  222



>ref|XP_009108781.1| PREDICTED: protein EXECUTER 1, chloroplastic [Brassica rapa]
 emb|CDY48441.1| BnaA08g11500D [Brassica napus]
Length=696

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  ++  +   SVLK QL  AV+ E++ +AA+LK AIA A + D +  +M     A++
Sbjct  125  KHFELIDDQDRLISVLKSQLNGAVKREEYEDAARLKVAIAAAATNDAVGRVMSSFNRAVL  184

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  185  EERYKDAVYLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  233



>ref|XP_010437740.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
 ref|XP_010437741.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Camelina sativa]
Length=675

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  ++  +   SVLK QL+ A++ ED+ +AA LK AIA A + D + ++M     A++
Sbjct  110  KHFELVDDQDRLLSVLKSQLKRAIKREDYEDAASLKVAIAAAATNDAVGKVMSSFFRAVL  169

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA  L    G+GLVGWW G S+D  D FG +V+IT   GR++ R
Sbjct  170  EERYKDAVDLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHGRYVAR  218



>gb|KHG21654.1| Protein EXECUTER 1, chloroplastic [Gossypium arboreum]
Length=724

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF ++++ E   S+L+ QL +AV +ED+ +AA+LK AIA A+  DT+  ++  L  A++
Sbjct  114  KHFEQVDEQERLLSLLRSQLNEAVLSEDYEDAARLKVAIAAASRNDTVGRVISHLNRAVM  173

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EER+ DA  L  + G+GLVGWW G   D+ D +G ++RIT   GR++ R
Sbjct  174  EERFLDAVFLRDNAGAGLVGWWAGLPNDTKDPYGLIIRITAEHGRYVAR  222



>gb|EAZ16473.1| hypothetical protein OsJ_31943 [Oryza sativa Japonica Group]
Length=693

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+ +E++E     L+ QL  AV  EDF  A KLK AIA  +  DT+   +  L +AI 
Sbjct  138  QHFALIEESERLVDELQLQLRTAVYREDFRSAHKLKLAIAATSKNDTVGRAISDLNSAIE  197

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S +  D +G ++RI+   GR++ +
Sbjct  198  EERYMDATYIRDHAGAGLLGWWSGISGNLSDPYGLIIRISAEHGRYVAK  246



>sp|Q7XD99.1|EXEC1_ORYSJ RecName: Full=Protein EXECUTER 1, chloroplastic; Short=OsEX1; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAL59023.1|AC087182_6 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54343.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB47802.1| expressed protein [Oryza sativa Japonica Group]
Length=727

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+ +E++E     L+ QL  AV  EDF  A KLK AIA  +  DT+   +  L +AI 
Sbjct  172  QHFALIEESERLVDELQLQLRTAVYREDFRSAHKLKLAIAATSKNDTVGRAISDLNSAIE  231

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S +  D +G ++RI+   GR++ +
Sbjct  232  EERYMDATYIRDHAGAGLLGWWSGISGNLSDPYGLIIRISAEHGRYVAK  280



>ref|XP_003574086.1| PREDICTED: protein EXECUTER 1, chloroplastic [Brachypodium distachyon]
Length=708

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+ +E++E     LK QL  AV  ED+  A KLK AIA  +  DT+   +  L  AIV
Sbjct  154  QHFALVEESERLVDELKLQLRTAVYREDYRSAHKLKLAIAATSRIDTVGRSISDLHRAIV  213

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S +  D +G ++R++   GR++ +
Sbjct  214  EERYMDAAHIRDHAGAGLLGWWSGVSGNLSDPYGLIIRVSAEHGRYVAK  262



>ref|XP_004982803.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X1 
[Setaria italica]
 ref|XP_004982804.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X2 
[Setaria italica]
 ref|XP_004982805.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X3 
[Setaria italica]
 ref|XP_004982806.1| PREDICTED: protein EXECUTER 1, chloroplastic-like isoform X4 
[Setaria italica]
Length=699

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+ +E++E     L+ QL  AV  ED+  A KLK AIA     DT+   +  L  AI 
Sbjct  142  RHFALIEESERLVDELQLQLRAAVCREDYRSAHKLKLAIAATAKNDTVGRAISDLNRAIE  201

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S +  D +G ++RI+   GR++ R
Sbjct  202  EERYRDATYIRDHAGAGLLGWWSGISGNLSDPYGLIIRISAEHGRYVAR  250



>ref|XP_006662456.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Oryza brachyantha]
Length=656

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+ +E++E     L+ QL+ AV  EDF  A KLK AIA  +  DT+   +  L +AI 
Sbjct  101  QHFALIEESERLVDELQLQLQTAVYREDFRSAHKLKLAIAATSKNDTVGRAISDLNSAIQ  160

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S +  D +G ++ I+   GR++ +
Sbjct  161  EERYMDAAYIRDHAGAGLLGWWSGISGNLSDPYGLIIHISAEHGRYVAK  209



>ref|NP_001159303.1| uncharacterized protein LOC100304395 [Zea mays]
 ref|XP_008643904.1| PREDICTED: uncharacterized protein LOC100304395 isoform X1 [Zea 
mays]
 gb|ACN25728.1| unknown [Zea mays]
 gb|AFW68537.1| hypothetical protein ZEAMMB73_115279 [Zea mays]
 gb|AFW68538.1| hypothetical protein ZEAMMB73_115279 [Zea mays]
Length=699

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 65/109 (60%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+ +E++E     L+ QL+ +V  ED+  A KL+ AIA     DT+   +  L  AI 
Sbjct  148  RHFALIEESERLVDELQLQLQASVYREDYRSAHKLRLAIATIVKNDTVGRAVSDLNMAID  207

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S +  D +G ++RI+   GR++ R
Sbjct  208  EERYKDAAYIRDHAGTGLLGWWSGISGNLSDPYGLIIRISAEHGRYVAR  256



>emb|CDY46102.1| BnaA03g52660D [Brassica napus]
Length=692

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 3/112 (3%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLE---DAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKN  584
            +HF  ++  +   S+LK  L+    AV+ ED+ +AA+LK AIA A++ D +  +M     
Sbjct  125  KHFERIDDQDRLLSLLKRFLKHRNGAVKREDYEDAARLKVAIAAASTNDAVGRVMSSFNR  184

Query  585  AIVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            A++EERY DA  L    G+GLVGWW G S+D  D FG +V+IT    R++ R
Sbjct  185  AVLEERYKDAVYLRDKAGAGLVGWWSGISEDVKDPFGLIVQITAEHRRYVAR  236



>dbj|BAJ87615.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=559

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+ ++++E     L+ QL  AV  ED+  A KLK AIA  +  DT+   + +L  AI 
Sbjct  1    QHFALVQESERLVDELQLQLRTAVCREDYRSAHKLKLAIAATSRNDTVGRAVSELHRAIE  60

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S+   D +G ++RI+   GR++ +
Sbjct  61   EERYLDAAYIRDHAGAGLLGWWSGISESVSDPYGLIIRISAEHGRYVAK  109



>dbj|BAJ92734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=712

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+ ++++E     L+ QL  AV  ED+  A KLK AIA  +  DT+   + +L  AI 
Sbjct  158  QHFALVQESERLVDELQLQLRTAVCREDYRSAHKLKLAIAATSRNDTVGRAVSELHRAIE  217

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S+   D +G ++RI+   GR++ +
Sbjct  218  EERYLDAAYIRDHAGAGLLGWWSGISESVSDPYGLIIRISAEHGRYVAK  266



>dbj|BAJ89988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=712

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 66/109 (61%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF+ ++++E     L+ QL  AV  ED+  A KLK AIA  +  DT+   + +L  AI 
Sbjct  158  QHFALVQESERLVDELQLQLRTAVCREDYRSAHKLKLAIAATSRNDTVGRAVSELHRAIE  217

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S+   D +G ++RI+   GR++ +
Sbjct  218  EERYLDAAYIRDHAGAGLLGWWSGISESVSDPYGLIIRISAEHGRYVAK  266



>ref|XP_008664851.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 ref|XP_008664852.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 ref|XP_008664853.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 ref|XP_008664854.1| PREDICTED: protein EXECUTER 1, chloroplastic-like [Zea mays]
 tpg|DAA49566.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49567.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49568.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49569.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
 tpg|DAA49570.1| TPA: hypothetical protein ZEAMMB73_501466 [Zea mays]
Length=701

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 64/109 (59%), Gaps = 0/109 (0%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            RHF+ +E++      L+ QL+ AV  ED+  A KL+ AIA  +  D +   +  L  AI 
Sbjct  148  RHFALIEESGRLVDELQLQLQAAVYREDYRTAHKLRLAIAATSKNDAVGRAISDLNMAID  207

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            EERY DA+ +    G+GL+GWW G S +  D +G ++RI+   GR++ R
Sbjct  208  EERYKDAAYIRDHAGAGLLGWWSGISGNLSDPYGLIIRISAEHGRYVAR  256



>gb|EMS51015.1| hypothetical protein TRIUR3_01679 [Triticum urartu]
Length=588

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +3

Query  510  AKLK-TAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRSTGSGLVGWWVGYSKDSGD  686
            A+LK ++I     +     ++L  ++AI E+RY DASRL +  G+ LVGWWVGY+KD+ D
Sbjct  2    AELKVSSICPPRPRRLRIPMLLIPRSAIEEQRYQDASRLTKLAGTSLVGWWVGYAKDTDD  61

Query  687  LFGRLVRITPGMGRFIGR  740
              GR+VRITPG+GR++ +
Sbjct  62   SIGRIVRITPGVGRYVAK  79



>emb|CAA20576.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80080.1| hypothetical protein [Arabidopsis thaliana]
Length=750

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 69/137 (50%), Gaps = 28/137 (20%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQL-----  578
            +HF +++  +   SVLK QL  A++ ED+ +AA+LK AIA   + D + ++M        
Sbjct  165  KHFDQVDDQDRLLSVLKSQLNRAIKREDYEDAARLKVAIAATATNDAVGKVMSTFYVITR  224

Query  579  --------KNAIVEERYHDASRLCRSTGSGL---------------VGWWVGYSKDSGDL  689
                      A++EERY DA  L    G+GL               VGWW G S+D  D 
Sbjct  225  VVIIVSNNTRALLEERYKDAVYLRDKAGAGLVSSLFVFFLVSFITVVGWWSGISEDVKDP  284

Query  690  FGRLVRITPGMGRFIGR  740
            FG +V+IT   GR++ R
Sbjct  285  FGLIVQITAEHGRYVAR  301



>gb|EMT14990.1| hypothetical protein F775_08039 [Aegilops tauschii]
Length=157

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  579  KNAIVEERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            K+AI E+RY DASRL +   + LVGWWVGY+KD+ D  GR+VR+ PG+GR++ +
Sbjct  5    KSAIEEQRYQDASRLTKLARTSLVGWWVGYAKDTDDSIGRIVRMNPGVGRYVAK  58



>gb|EMT28755.1| hypothetical protein F775_09989 [Aegilops tauschii]
Length=575

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 3/98 (3%)
 Frame = +3

Query  456  VLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRST  635
            VLK QL  AV  ED+  A KLK AIA  +  DT+   + +L  AI EERY DA+ +    
Sbjct  46   VLKLQLRTAVCREDYRSAHKLKLAIAATSRNDTVGRAISELHRAIEEERYVDAAYIRDQA  105

Query  636  GSGL---VGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            G+GL   +GWW G S    D +G ++RI+   GR++ +
Sbjct  106  GAGLHMQLGWWSGISGSLSDPYGLIIRISAEHGRYVAK  143



>ref|XP_002500729.1| hypothetical protein MICPUN_57395 [Micromonas sp. RCC299]
 gb|ACO61987.1| hypothetical protein MICPUN_57395 [Micromonas sp. RCC299]
Length=1030

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 4/111 (4%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R F  ++  E     L+ QLEDAV  EDF  AA +K  IA    +D I  +    + A+ 
Sbjct  140  RRFDRVDSEEGILVALQAQLEDAVAKEDFTAAASIKKTIASMRDEDPITAVERGYRAAVE  199

Query  594  EERYHDASRLCRSTGSGLVGWWVG---YSKDSGDLFGRLVRITPGMGRFIG  737
             E Y  A+   R  G+GLVGWW G     ++ G  +G ++++T   GR++G
Sbjct  200  NEDYAAAATF-RDLGAGLVGWWAGRGATEEEPGGAYGVMMQVTAQHGRYVG  249



>ref|XP_002954035.1| hypothetical protein VOLCADRAFT_106212 [Volvox carteri f. nagariensis]
 gb|EFJ44752.1| hypothetical protein VOLCADRAFT_106212 [Volvox carteri f. nagariensis]
Length=1401

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 3/110 (3%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  M++    A+  + +L  AV  E + +AA+ K  + E  S DT+A +  QL+ A+ 
Sbjct  316  KHFDTMDELAEDAAHYQIELNTAVRQEQYGDAARFKRKLQEIQSSDTVASVQRQLQEALA  375

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLF-GRLVRITPGMGRFIGR  740
             E+Y  A+ L      GL GWW G  KD  + F G L+ + P  GR+ GR
Sbjct  376  TEQYGAAADLRDRGLVGLAGWWAG--KDGPEDFQGHLLHVKPEFGRWTGR  423



>ref|XP_005849264.1| hypothetical protein CHLNCDRAFT_51231 [Chlorella variabilis]
 gb|EFN57162.1| hypothetical protein CHLNCDRAFT_51231 [Chlorella variabilis]
Length=975

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 2/107 (2%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R+F  M+        L  +L +AVE ED+  AA L     +  + D + E +  L+ A+ 
Sbjct  213  RYFYAMDDVVHDLESLHTELAEAVEAEDYRAAAALAAQRRQLEACDCVGEALGALEAAVA  272

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFI  734
            EER+ DA+RL      GL+GWWVG  +  GD  G L+R+T   GR++
Sbjct  273  EERFGDAARLRDECCVGLLGWWVG--RGDGDPTGHLLRMTTDFGRYV  317



>gb|KDO53999.1| hypothetical protein CISIN_1g0056621mg, partial [Citrus sinensis]
Length=233

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  417  HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
            HF E++  E   S+LK QL +AV  E++ +AA+LK AIA A + D +  +M  L  A+V+
Sbjct  120  HFDEVDDQERLVSILKSQLGNAVFKEEYDDAARLKVAIAAAATNDAVGRVMSNLNRAVVQ  179

Query  597  ERYHDASRLCRSTGSGL  647
            ERY DA+ L  + G+GL
Sbjct  180  ERYEDAALLRDNAGAGL  196



>gb|KDO69693.1| hypothetical protein CISIN_1g0061461mg, partial [Citrus sinensis]
Length=362

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  648  VGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            VGWWVGYSKDS D FGRL++I PG+GRF+ R
Sbjct  26   VGWWVGYSKDSDDPFGRLIQIKPGVGRFVAR  56



>ref|XP_001422141.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00458.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=590

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 16/108 (15%)
 Frame = +3

Query  459  LKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRSTG  638
            L+ QLEDA+E+ED+  AA LK A     + D   ++      AI E+R+ DA RL R  G
Sbjct  4    LEAQLEDAIESEDYASAASLKRAADALRASDDTGQMCEAYAKAIAEDRFEDAVRL-RDAG  62

Query  639  SGLVGWWVGY-----SKDSGDL----------FGRLVRITPGMGRFIG  737
             GL GWW G       +D G+            G ++RI+   GR +G
Sbjct  63   VGLCGWWAGMEEVPQGEDDGERAEGDEAREHPTGVIMRISREHGRLVG  110



>ref|XP_006439803.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
 gb|ESR53043.1| hypothetical protein CICLE_v10019209mg [Citrus clementina]
Length=506

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  648  VGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
            VGWWVGYSKDS D FGRL++I PG+GRF+ R
Sbjct  26   VGWWVGYSKDSDDPFGRLIQIKPGVGRFVAR  56



>emb|CEG00751.1| Protein of unknown function DUF3506 [Ostreococcus tauri]
Length=749

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 11/118 (9%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R F E+E   S    ++ Q+EDAV  EDF  AA LK A     + D   ++  +  +AI 
Sbjct  175  RRFYEIECEASALQAIEAQMEDAVAEEDFASAASLKRAADALRATDETGKLCDRYADAIK  234

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGD----------LFGRLVRITPGMGRFIG  737
             ER+ +A  L R  G G+ GWW G  + S              G ++RI+   GR +G
Sbjct  235  NERFEEAVAL-RDAGVGMCGWWAGVEERSTQGEDDEEPTTAATGVIMRISREHGRLVG  291



>emb|CAN67006.1| hypothetical protein VITISV_020408 [Vitis vinifera]
Length=830

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +3

Query  483  VENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVEERYHDASRLCRSTGSGLV--GW  656
            V+ ED+ +AA+LK AIA A + DT+  +M  L  AI EERY DA+ +  S G+GLV  G+
Sbjct  164  VKKEDYEDAARLKVAIAAAATNDTVGRVMSLLNRAIAEERYDDAAFIRDSAGAGLVIAGF  223

Query  657  WVGYSKD---SGDLFGRLVRI  710
             +G   D   SGD F  +  +
Sbjct  224  HIGCLDDCMESGDSFAAIYVV  244



>ref|XP_003084183.1| unnamed protein product [Ostreococcus tauri]
Length=580

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 11/118 (9%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            R F E+E   S    ++ Q+EDAV  EDF  AA LK A     + D   ++  +  +AI 
Sbjct  6    RRFYEIECEASALQAIEAQMEDAVAEEDFASAASLKRAADALRATDETGKLCDRYADAIK  65

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGD----------LFGRLVRITPGMGRFIG  737
             ER+ +A  L R  G G+ GWW G  + S              G ++RI+   GR +G
Sbjct  66   NERFEEAVAL-RDAGVGMCGWWAGVEERSTQGEDDEEPTTAATGVIMRISREHGRLVG  122



>ref|XP_001703381.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06063.1| predicted protein [Chlamydomonas reinhardtii]
Length=745

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = +3

Query  414  RHFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIV  593
            +HF  M++    A+  + +L  AV  E + +AA+ K  + E  + DT+A +  QL++A+ 
Sbjct  107  KHFDAMDELAEDAAHYQVELNSAVRTERYADAARFKKRLGEVAAADTVAAVQRQLQSALA  166

Query  594  EERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRFIGR  740
             E+Y +A+ L      GL GWW G  KD  + F    ++ P  GR+ GR
Sbjct  167  GEQYTEAAELRDRGLVGLAGWWAG--KDGPEDF----QVKPEFGRWTGR  209



>ref|XP_005650349.1| RNB-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25805.1| RNB-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=1751

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 2/105 (2%)
 Frame = +3

Query  417   HFSEMEQAESYASVLKFQLEDAVENEDFLEAAKLKTAIAEATSKDTIAEIMLQLKNAIVE  596
             +F++M+    +A  ++  +E A   E + EAAKLK    E   KD +  ++ +L  A+ E
Sbjct  1174  YFNDMDDMYEHACEMESDIELAAAAEQYEEAAKLKKEYDELRKKDLVDALLTELNTAVDE  1233

Query  597   ERYHDASRLCRSTGSGLVGWWVGYSKDSGDLFGRLVRITPGMGRF  731
             E Y  A+ L     +GL+GWW  +S+   D  G L+R  P  GR+
Sbjct  1234  EDYGTAAELRDRGCAGLIGWW--HSRTENDPCGHLLRFAPDFGRY  1276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1400076157675