BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig12028

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006352682.1|  PREDICTED: galacturonosyltransferase 8-like        242   2e-72   Solanum tuberosum [potatoes]
ref|XP_009775386.1|  PREDICTED: galacturonosyltransferase 8             235   1e-69   Nicotiana sylvestris
ref|XP_006443554.1|  hypothetical protein CICLE_v10020276mg             231   1e-69   
ref|XP_006479231.1|  PREDICTED: galacturonosyltransferase 8-like        231   3e-68   Citrus sinensis [apfelsine]
gb|KDO65983.1|  hypothetical protein CISIN_1g008561mg                   227   2e-67   Citrus sinensis [apfelsine]
ref|XP_009614844.1|  PREDICTED: galacturonosyltransferase 8             229   2e-67   Nicotiana tomentosiformis
gb|KDO65982.1|  hypothetical protein CISIN_1g008561mg                   227   1e-66   Citrus sinensis [apfelsine]
ref|XP_004242412.1|  PREDICTED: galacturonosyltransferase 8-like        224   1e-65   Solanum lycopersicum
ref|XP_002532733.1|  Glycosyltransferase QUASIMODO1, putative           223   4e-65   Ricinus communis
ref|XP_007201169.1|  hypothetical protein PRUPE_ppa003603mg             220   5e-64   Prunus persica
ref|XP_008235436.1|  PREDICTED: galacturonosyltransferase 8             217   4e-63   Prunus mume [ume]
ref|XP_011089660.1|  PREDICTED: galacturonosyltransferase 8-like        217   8e-63   Sesamum indicum [beniseed]
gb|KJB08803.1|  hypothetical protein B456_001G104800                    214   1e-62   Gossypium raimondii
gb|KHG16505.1|  Galacturonosyltransferase 8 -like protein               216   1e-62   Gossypium arboreum [tree cotton]
gb|KJB08802.1|  hypothetical protein B456_001G104800                    214   7e-62   Gossypium raimondii
ref|XP_007049694.1|  Nucleotide-diphospho-sugar transferases supe...    214   8e-62   
ref|XP_012085051.1|  PREDICTED: galacturonosyltransferase 8             213   1e-61   Jatropha curcas
ref|XP_011024611.1|  PREDICTED: galacturonosyltransferase 8             213   2e-61   Populus euphratica
ref|XP_002301803.1|  hypothetical protein POPTR_0002s24790g             212   3e-61   Populus trichocarpa [western balsam poplar]
gb|ABK92560.1|  unknown                                                 210   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_004290178.1|  PREDICTED: galacturonosyltransferase 8             209   9e-60   Fragaria vesca subsp. vesca
ref|XP_009372229.1|  PREDICTED: galacturonosyltransferase 8-like        209   9e-60   Pyrus x bretschneideri [bai li]
ref|XP_010527263.1|  PREDICTED: galacturonosyltransferase 8             207   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_008372509.1|  PREDICTED: galacturonosyltransferase 8             206   5e-59   
ref|XP_008382600.1|  PREDICTED: galacturonosyltransferase 8-like        206   1e-58   Malus domestica [apple tree]
gb|KHG21596.1|  Galacturonosyltransferase 8 -like protein               203   1e-57   Gossypium arboreum [tree cotton]
emb|CBI25666.3|  unnamed protein product                                201   2e-57   Vitis vinifera
ref|XP_009372029.1|  PREDICTED: galacturonosyltransferase 8-like        201   5e-57   Pyrus x bretschneideri [bai li]
emb|CDY00812.1|  BnaCnng00120D                                          199   5e-57   
ref|XP_002273962.2|  PREDICTED: galacturonosyltransferase 8             201   6e-57   Vitis vinifera
ref|XP_010696262.1|  PREDICTED: galacturonosyltransferase 8             200   1e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010246719.1|  PREDICTED: galacturonosyltransferase 8             200   2e-56   Nelumbo nucifera [Indian lotus]
gb|KJB10195.1|  hypothetical protein B456_001G188500                    198   4e-56   Gossypium raimondii
gb|KJB10201.1|  hypothetical protein B456_001G188500                    197   1e-55   Gossypium raimondii
gb|KJB10198.1|  hypothetical protein B456_001G188500                    197   2e-55   Gossypium raimondii
gb|KJB10199.1|  hypothetical protein B456_001G188500                    197   2e-55   Gossypium raimondii
gb|KJB10200.1|  hypothetical protein B456_001G188500                    197   2e-55   Gossypium raimondii
emb|CDX77366.1|  BnaA07g05040D                                          196   5e-55   
ref|XP_009102430.1|  PREDICTED: galacturonosyltransferase 8-like        196   8e-55   Brassica rapa
ref|XP_003552108.1|  PREDICTED: galacturonosyltransferase 8-like        192   9e-54   Glycine max [soybeans]
ref|XP_004149774.1|  PREDICTED: galacturonosyltransferase 8             192   1e-53   Cucumis sativus [cucumbers]
emb|CDP03909.1|  unnamed protein product                                191   4e-53   Coffea canephora [robusta coffee]
ref|XP_010532909.1|  PREDICTED: galacturonosyltransferase 8-like        191   5e-53   Tarenaya hassleriana [spider flower]
gb|EYU40627.1|  hypothetical protein MIMGU_mgv1a003761mg                191   5e-53   Erythranthe guttata [common monkey flower]
ref|XP_006418657.1|  hypothetical protein EUTSA_v10002465mg             190   6e-53   Eutrema salsugineum [saltwater cress]
ref|XP_009136103.1|  PREDICTED: galacturonosyltransferase 8             190   8e-53   Brassica rapa
ref|XP_010104168.1|  Galacturonosyltransferase 8                        190   8e-53   Morus notabilis
ref|XP_006297348.1|  hypothetical protein CARUB_v10013367mg             190   9e-53   Capsella rubella
ref|XP_010513952.1|  PREDICTED: galacturonosyltransferase 8-like        190   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010036787.1|  PREDICTED: galacturonosyltransferase 8             189   2e-52   Eucalyptus grandis [rose gum]
ref|XP_010488624.1|  PREDICTED: galacturonosyltransferase 8-like        189   2e-52   Camelina sativa [gold-of-pleasure]
ref|NP_189150.1|  Galacturonosyltransferase 8                           189   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466934.1|  PREDICTED: galacturonosyltransferase 8             189   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002863088.1|  hypothetical protein ARALYDRAFT_497166             187   8e-52   Arabidopsis lyrata subsp. lyrata
emb|CDX93049.1|  BnaA03g37710D                                          187   8e-52   
emb|CDY61593.1|  BnaC03g74220D                                          186   2e-51   Brassica napus [oilseed rape]
ref|NP_001242612.1|  uncharacterized protein LOC100817076               185   3e-51   
ref|XP_006584621.1|  PREDICTED: uncharacterized protein LOC100817...    185   4e-51   
ref|XP_008364684.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    182   4e-51   
ref|XP_008357519.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    181   9e-51   
ref|XP_004515038.1|  PREDICTED: galacturonosyltransferase 8-like        184   1e-50   Cicer arietinum [garbanzo]
ref|XP_008458050.1|  PREDICTED: galacturonosyltransferase 8             183   3e-50   Cucumis melo [Oriental melon]
ref|XP_007142473.1|  hypothetical protein PHAVU_008G283600g             182   5e-50   Phaseolus vulgaris [French bean]
ref|XP_008346857.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    178   3e-49   
ref|XP_007140673.1|  hypothetical protein PHAVU_008G132200g             179   5e-49   Phaseolus vulgaris [French bean]
gb|EPS62489.1|  hypothetical protein M569_12298                         166   1e-44   Genlisea aurea
ref|XP_008457595.1|  PREDICTED: galacturonosyltransferase 8-like        160   9e-42   Cucumis melo [Oriental melon]
ref|XP_006841268.1|  PREDICTED: galacturonosyltransferase 8             159   1e-41   Amborella trichopoda
ref|XP_010257858.1|  PREDICTED: probable galacturonosyltransferase 9    155   4e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010694564.1|  PREDICTED: probable galacturonosyltransferase 9    147   4e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007151434.1|  hypothetical protein PHAVU_004G045900g             145   1e-36   Phaseolus vulgaris [French bean]
ref|XP_006430887.1|  hypothetical protein CICLE_v10011396mg             145   1e-36   Citrus clementina [clementine]
ref|XP_006482345.1|  PREDICTED: probable galacturonosyltransferas...    144   2e-36   Citrus sinensis [apfelsine]
gb|KHN02656.1|  Putative galacturonosyltransferase 9                    144   5e-36   Glycine soja [wild soybean]
ref|XP_006593710.1|  PREDICTED: probable galacturonosyltransferas...    143   5e-36   
ref|XP_006603944.1|  PREDICTED: probable galacturonosyltransferas...    141   3e-35   Glycine max [soybeans]
ref|XP_011099072.1|  PREDICTED: probable galacturonosyltransferase 9    140   5e-35   Sesamum indicum [beniseed]
gb|KHG03994.1|  putative galacturonosyltransferase 9 -like protein      140   7e-35   Gossypium arboreum [tree cotton]
ref|XP_002530802.1|  Glycosyltransferase QUASIMODO1, putative           140   9e-35   Ricinus communis
ref|XP_008455575.1|  PREDICTED: probable galacturonosyltransferase 9    140   9e-35   Cucumis melo [Oriental melon]
ref|XP_003635905.1|  Glycosyltransferase                                139   1e-34   
ref|XP_004507267.1|  PREDICTED: probable galacturonosyltransferas...    139   1e-34   Cicer arietinum [garbanzo]
ref|XP_009378304.1|  PREDICTED: probable galacturonosyltransferase 9    139   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_007032945.1|  Glycosyltransferase isoform 3                      139   2e-34   
ref|XP_004304175.1|  PREDICTED: probable galacturonosyltransferase 9    139   2e-34   Fragaria vesca subsp. vesca
emb|CDP02368.1|  unnamed protein product                                139   2e-34   Coffea canephora [robusta coffee]
ref|XP_010029444.1|  PREDICTED: probable galacturonosyltransferase 9    139   2e-34   Eucalyptus grandis [rose gum]
ref|XP_007032943.1|  Glycosyltransferase isoform 1                      139   2e-34   
ref|XP_012088081.1|  PREDICTED: probable galacturonosyltransferase 9    138   4e-34   Jatropha curcas
gb|KJB10519.1|  hypothetical protein B456_001G205700                    138   5e-34   Gossypium raimondii
ref|XP_010908797.1|  PREDICTED: galacturonosyltransferase 8-like        137   7e-34   Elaeis guineensis
ref|XP_011085570.1|  PREDICTED: probable galacturonosyltransferase 9    137   9e-34   Sesamum indicum [beniseed]
ref|XP_008230332.1|  PREDICTED: probable galacturonosyltransferase 9    136   2e-33   Prunus mume [ume]
ref|XP_010100891.1|  putative galacturonosyltransferase 9               137   2e-33   
ref|XP_007215330.1|  hypothetical protein PRUPE_ppa005253mg             136   2e-33   
ref|XP_007032944.1|  Glycosyltransferase isoform 2                      135   2e-33   
ref|XP_004137150.1|  PREDICTED: probable galacturonosyltransferase 9    135   3e-33   Cucumis sativus [cucumbers]
ref|XP_009603685.1|  PREDICTED: probable galacturonosyltransferase 9    135   6e-33   Nicotiana tomentosiformis
gb|KJB10520.1|  hypothetical protein B456_001G205700                    134   7e-33   Gossypium raimondii
ref|XP_009373741.1|  PREDICTED: probable galacturonosyltransferase 9    134   8e-33   Pyrus x bretschneideri [bai li]
ref|XP_009792003.1|  PREDICTED: probable galacturonosyltransferase 9    134   1e-32   Nicotiana sylvestris
gb|EYU39355.1|  hypothetical protein MIMGU_mgv1a003891mg                134   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_010549955.1|  PREDICTED: probable galacturonosyltransferas...    133   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_010549958.1|  PREDICTED: probable galacturonosyltransferas...    133   3e-32   Tarenaya hassleriana [spider flower]
gb|AID53187.1|  galacturonosyltransferase 8-like protein                132   3e-32   Dendrobium officinale
ref|XP_006338312.1|  PREDICTED: probable galacturonosyltransferas...    132   3e-32   Solanum tuberosum [potatoes]
ref|XP_011012259.1|  PREDICTED: probable galacturonosyltransferase 9    132   4e-32   Populus euphratica
ref|XP_008341825.1|  PREDICTED: probable galacturonosyltransferase 9    132   4e-32   
ref|XP_006384242.1|  hypothetical protein POPTR_0004s10980g             132   5e-32   Populus trichocarpa [western balsam poplar]
gb|KHG26626.1|  putative galacturonosyltransferase 9 -like protein      131   1e-31   Gossypium arboreum [tree cotton]
ref|XP_008803497.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    131   1e-31   Phoenix dactylifera
ref|XP_009379995.1|  PREDICTED: galacturonosyltransferase 8-like        130   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778166.1|  PREDICTED: galacturonosyltransferase 8-like        130   2e-31   Phoenix dactylifera
gb|KJB48243.1|  hypothetical protein B456_008G059800                    130   3e-31   Gossypium raimondii
ref|XP_010913084.1|  PREDICTED: galacturonosyltransferase 8             129   4e-31   Elaeis guineensis
gb|KJB48245.1|  hypothetical protein B456_008G059800                    129   6e-31   Gossypium raimondii
ref|XP_004232120.1|  PREDICTED: probable galacturonosyltransferase 9    129   7e-31   
ref|XP_009404224.1|  PREDICTED: galacturonosyltransferase 8-like        128   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010485478.1|  PREDICTED: probable galacturonosyltransferase 9    127   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010476066.1|  PREDICTED: probable galacturonosyltransferase 9    127   5e-30   Camelina sativa [gold-of-pleasure]
emb|CAN73730.1|  hypothetical protein VITISV_022574                     126   5e-30   Vitis vinifera
ref|XP_010660537.1|  PREDICTED: probable galacturonosyltransferase 9    126   6e-30   Vitis vinifera
ref|XP_006408424.1|  hypothetical protein EUTSA_v10020416mg             126   9e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010463640.1|  PREDICTED: probable galacturonosyltransferase 9    125   2e-29   Camelina sativa [gold-of-pleasure]
gb|ABD96904.1|  hypothetical protein                                    124   2e-29   Tarenaya spinosa
ref|XP_002882224.1|  hypothetical protein ARALYDRAFT_477468             124   3e-29   
ref|XP_006297346.1|  hypothetical protein CARUB_v10013365mg             124   3e-29   
ref|XP_010558537.1|  PREDICTED: probable galacturonosyltransferase 9    124   3e-29   Tarenaya hassleriana [spider flower]
gb|KFK37701.1|  hypothetical protein AALP_AA3G017600                    124   4e-29   Arabis alpina [alpine rockcress]
gb|AHL38785.1|  glycosyltransferase                                     124   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566170.1|  putative galacturonosyltransferase 9                  124   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117942.1|  PREDICTED: probable galacturonosyltransferase 9    122   3e-28   
gb|EPS65125.1|  glycosyltransferase                                     119   2e-27   Genlisea aurea
emb|CDY34723.1|  BnaA01g33020D                                          117   8e-27   Brassica napus [oilseed rape]
ref|XP_006373520.1|  hypothetical protein POPTR_0017s144802g            117   1e-26   
ref|XP_011021133.1|  PREDICTED: probable galacturonosyltransferase 9    117   2e-26   Populus euphratica
ref|XP_002980055.1|  Quasimodo1-like protein                            114   1e-25   
ref|XP_002987448.1|  Quasimodo1-like protein                            110   2e-24   
ref|XP_009134660.1|  PREDICTED: probable galacturonosyltransferas...    107   3e-23   Brassica rapa
emb|CDX74263.1|  BnaA03g27840D                                          107   3e-23   
ref|XP_009134662.1|  PREDICTED: probable galacturonosyltransferas...    107   3e-23   Brassica rapa
emb|CDX91987.1|  BnaC03g32890D                                          107   6e-23   
ref|XP_003622860.1|  Glycosyltransferase CAZy family GT8                105   1e-22   
ref|XP_006575730.1|  PREDICTED: galacturonosyltransferase 8-like      94.0    6e-20   
ref|XP_011033002.1|  PREDICTED: galacturonosyltransferase 8-like      95.9    5e-19   Populus euphratica
ref|XP_009381434.1|  PREDICTED: probable galacturonosyltransferase 9  94.7    9e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409999.1|  PREDICTED: probable galacturonosyltransferase 9  93.6    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002310951.2|  hypothetical protein POPTR_0008s01050g           94.0    2e-18   
ref|XP_008784292.1|  PREDICTED: probable galacturonosyltransferase 9  89.4    8e-17   Phoenix dactylifera
ref|XP_008802618.1|  PREDICTED: probable galacturonosyltransferase 9  84.7    3e-15   Phoenix dactylifera
ref|XP_008379476.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...  82.0    2e-14   
ref|XP_010939506.1|  PREDICTED: probable galacturonosyltransferase 9  79.7    1e-13   Elaeis guineensis
ref|XP_010937117.1|  PREDICTED: probable galacturonosyltransferase 9  79.0    2e-13   Elaeis guineensis
ref|XP_004965039.1|  PREDICTED: probable galacturonosyltransferas...  67.0    2e-09   Setaria italica
gb|AFW85243.1|  hypothetical protein ZEAMMB73_225769                  65.1    8e-09   
ref|XP_003564052.1|  PREDICTED: probable galacturonosyltransferase 9  65.1    8e-09   Brachypodium distachyon [annual false brome]
ref|XP_002438104.1|  hypothetical protein SORBIDRAFT_10g008060        62.8    5e-08   Sorghum bicolor [broomcorn]
ref|XP_006656804.1|  PREDICTED: probable galacturonosyltransferas...  61.6    1e-07   Oryza brachyantha
gb|EAZ36348.1|  hypothetical protein OsJ_20674                        60.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD37314.1|  glycosyl transferase protein A-like                  60.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454284.1|  hypothetical protein SORBIDRAFT_04g028010        55.1    2e-05   Sorghum bicolor [broomcorn]
ref|XP_004953865.1|  PREDICTED: probable galacturonosyltransferas...  54.7    2e-05   Setaria italica
gb|KJB08801.1|  hypothetical protein B456_001G104800                  54.3    3e-05   Gossypium raimondii
gb|KJB10196.1|  hypothetical protein B456_001G188500                  54.3    3e-05   Gossypium raimondii
ref|XP_008679311.1|  PREDICTED: probable galacturonosyltransferase 9  53.5    6e-05   Zea mays [maize]
gb|EAZ24604.1|  hypothetical protein OsJ_08366                        50.4    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048110.1|  Os02g0745400                                     50.4    6e-04   
gb|EAY87516.1|  hypothetical protein OsI_08922                        50.1    8e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006647884.1|  PREDICTED: probable galacturonosyltransferas...  50.1    9e-04   Oryza brachyantha



>ref|XP_006352682.1| PREDICTED: galacturonosyltransferase 8-like [Solanum tuberosum]
Length=557

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +2

Query  185  RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPL  364
            R  F LF S LT+AVFL L LS  YTSS+DP+DL VGI  D  GVG +RRSVLALKSDPL
Sbjct  15   RLTFNLFVSFLTVAVFLLLALSSLYTSSADPSDLGVGITRDFRGVGSLRRSVLALKSDPL  74

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            KPR D I+KQA+DHR+L LAYASYARKLKLENSKLVRVFAELSRN++DL SKP YR LF+
Sbjct  75   KPRLDQIKKQADDHRSLVLAYASYARKLKLENSKLVRVFAELSRNFSDLTSKPLYRTLFD  134

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             D NS++ESVLRQFEKEVKERIK TRQVVAEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  135  SDGNSMNESVLRQFEKEVKERIKATRQVVAEAKESFDNQLKIQKLKDTIFAVNEQ  189



>ref|XP_009775386.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana sylvestris]
Length=566

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 167/197 (85%), Gaps = 6/197 (3%)
 Frame = +2

Query  125  SYRSA-TDRTSGGLFGRSAAG-RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGI  298
            SYR+  +DR+       S  G R  FKLFAS LT++VFL L LS  +TSSSDP+DL+VG 
Sbjct  6    SYRTPFSDRS----IAVSGTGIRLTFKLFASFLTVSVFLLLALSFLFTSSSDPSDLSVGN  61

Query  299  LHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRV  478
             HD Y  G +RRSVLALKSDPLKPR D I+KQA+DHRALALAYASYARKLKLENSKLVRV
Sbjct  62   SHDLYRGGSLRRSVLALKSDPLKPRLDQIKKQADDHRALALAYASYARKLKLENSKLVRV  121

Query  479  FAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDN  658
            FAELSRN+TDLISKP+YR LF+ D NS++ESVLRQFEKEVKERIKVTRQVVAEAKESFDN
Sbjct  122  FAELSRNFTDLISKPSYRTLFDSDGNSMNESVLRQFEKEVKERIKVTRQVVAEAKESFDN  181

Query  659  QLKIQKLKDTIFAVNDQ  709
            QLKIQKLKDTIFAVN+Q
Sbjct  182  QLKIQKLKDTIFAVNEQ  198



>ref|XP_006443554.1| hypothetical protein CICLE_v10020276mg [Citrus clementina]
 gb|ESR56794.1| hypothetical protein CICLE_v10020276mg [Citrus clementina]
Length=424

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  307
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTARA--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSHSHSRDLYSSGLNSG  59

Query  308  AYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAE  487
             YG+G +RRSVLALKSDPLKPR D IRKQA+DHRALA+AYASYARKLKLENSKLVR+FA+
Sbjct  60   TYGLGSMRRSVLALKSDPLKPRLDQIRKQADDHRALAMAYASYARKLKLENSKLVRIFAD  119

Query  488  LSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLK  667
            LSRNYTDLI+KP YRAL E DS ++DES+LRQFEKEVKERIK+TRQ++AEAKESFDNQLK
Sbjct  120  LSRNYTDLITKPTYRALMESDSLTIDESILRQFEKEVKERIKLTRQIIAEAKESFDNQLK  179

Query  668  IQKLKDTIFAVNDQ  709
            IQKLKDTIFAVN+Q
Sbjct  180  IQKLKDTIFAVNEQ  193



>ref|XP_006479231.1| PREDICTED: galacturonosyltransferase 8-like [Citrus sinensis]
Length=561

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  307
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTARA--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSHSHSRDLYSSGLNSG  59

Query  308  AYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAE  487
             YG+G +RRSVLALKSDPLKPR D IRKQA+DHRALA+AYASYARKLKLENSKLVR+FA+
Sbjct  60   TYGLGSMRRSVLALKSDPLKPRLDQIRKQADDHRALAMAYASYARKLKLENSKLVRIFAD  119

Query  488  LSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLK  667
            LSRNYTDLI+KP YRAL E DS ++DES+LRQFEKEVKERIK+TRQ++AEAKESFDNQLK
Sbjct  120  LSRNYTDLITKPTYRALMESDSLTIDESILRQFEKEVKERIKLTRQIIAEAKESFDNQLK  179

Query  668  IQKLKDTIFAVNDQ  709
            IQKLKDTIFAVN+Q
Sbjct  180  IQKLKDTIFAVNEQ  193



>gb|KDO65983.1| hypothetical protein CISIN_1g008561mg [Citrus sinensis]
Length=481

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  307
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTART--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSRSHSRDLYSSGLNSG  59

Query  308  AYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAE  487
             YG+G +RRSVLALKSDPLKPR D IRKQA+DHRALA+AYASYARKLKLENSKLVR+FA+
Sbjct  60   TYGLGSMRRSVLALKSDPLKPRLDQIRKQADDHRALAMAYASYARKLKLENSKLVRIFAD  119

Query  488  LSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLK  667
            LSRNYTDLI+KP Y+AL + DS ++DES+LRQFEKEVKERIK+TRQ++AEAKESFDNQLK
Sbjct  120  LSRNYTDLITKPTYQALMQSDSLTIDESILRQFEKEVKERIKLTRQIIAEAKESFDNQLK  179

Query  668  IQKLKDTIFAVNDQ  709
            IQKLKDTIFAVN+Q
Sbjct  180  IQKLKDTIFAVNEQ  193



>ref|XP_009614844.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana tomentosiformis]
Length=564

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 166/197 (84%), Gaps = 7/197 (4%)
 Frame = +2

Query  125  SYRSA-TDRTSGGLFGRSAAG-RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGI  298
            SYR+  +DR+       S  G R  FKLFAS L++AVFL L LS  +TSSSDP+DL+VG 
Sbjct  6    SYRTPFSDRS----IAVSGTGIRLTFKLFASFLSVAVFLLLALSFLFTSSSDPSDLSVGN  61

Query  299  LHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRV  478
             HD Y  G +RRSVLALKSDPLKPR D I+KQA+DHRALALAYASYARKLKLENSKLVRV
Sbjct  62   SHDLYR-GGLRRSVLALKSDPLKPRLDQIKKQADDHRALALAYASYARKLKLENSKLVRV  120

Query  479  FAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDN  658
            FAELSRN+TDLISKP+YR LF+ D NS++E VLRQFEKEVKERIKVTRQVVAEAKESFDN
Sbjct  121  FAELSRNFTDLISKPSYRTLFDSDGNSMNEPVLRQFEKEVKERIKVTRQVVAEAKESFDN  180

Query  659  QLKIQKLKDTIFAVNDQ  709
            QLKIQKLKDTIFAVN+Q
Sbjct  181  QLKIQKLKDTIFAVNEQ  197



>gb|KDO65982.1| hypothetical protein CISIN_1g008561mg [Citrus sinensis]
Length=561

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHD  307
            AT RT+    G    GRF F  +L AS +T AVFLF T SL +TS S   DL + G+   
Sbjct  2    ATHRTART--GAPVTGRFTFIMRLLASFITFAVFLFFTSSLLFTSRSHSRDLYSSGLNSG  59

Query  308  AYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAE  487
             YG+G +RRSVLALKSDPLKPR D IRKQA+DHRALA+AYASYARKLKLENSKLVR+FA+
Sbjct  60   TYGLGSMRRSVLALKSDPLKPRLDQIRKQADDHRALAMAYASYARKLKLENSKLVRIFAD  119

Query  488  LSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLK  667
            LSRNYTDLI+KP Y+AL + DS ++DES+LRQFEKEVKERIK+TRQ++AEAKESFDNQLK
Sbjct  120  LSRNYTDLITKPTYQALMQSDSLTIDESILRQFEKEVKERIKLTRQIIAEAKESFDNQLK  179

Query  668  IQKLKDTIFAVNDQ  709
            IQKLKDTIFAVN+Q
Sbjct  180  IQKLKDTIFAVNEQ  193



>ref|XP_004242412.1| PREDICTED: galacturonosyltransferase 8-like [Solanum lycopersicum]
Length=557

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +2

Query  185  RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPL  364
            RF FKLFAS +T+AV L L LS  YTSS+DP+DL VGI  D   VG +RRSVLALKSDPL
Sbjct  15   RFTFKLFASFITVAVLLSLALSSLYTSSADPSDLGVGISRDFRVVGSLRRSVLALKSDPL  74

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            KPR D I+KQA+DHR+L LAYASYARKLKLENSKLVRVFAELSRN++DL SKP+YR LF+
Sbjct  75   KPRLDQIKKQADDHRSLVLAYASYARKLKLENSKLVRVFAELSRNFSDLTSKPSYRQLFD  134

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             D NS++ESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  135  SDGNSMNESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNEQ  189



>ref|XP_002532733.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF29635.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=566

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTS-SSDPADL--NVGILHDAYGVGPVRRSVLALKSDPL  364
            F++  S +TIAV +F T++  +TS S  P+DL  N G+ +  YG G  RRSVLALKSDPL
Sbjct  24   FRVLGSAITIAVLVFFTVAFLFTSDSHSPSDLHRNFGLGNVPYGFGSGRRSVLALKSDPL  83

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            KPR D IRKQA+DHR+LALAYASYARKLKLENSKLVRVFA+LSRNYTDLI+KPAYRALFE
Sbjct  84   KPRLDQIRKQADDHRSLALAYASYARKLKLENSKLVRVFADLSRNYTDLINKPAYRALFE  143

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             DS S++ES LRQFEKEVKERIKVTRQ++AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  144  SDSLSIEESTLRQFEKEVKERIKVTRQIIAEAKESFDNQLKIQKLKDTIFAVNEQ  198



>ref|XP_007201169.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
 gb|EMJ02368.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
Length=562

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 4/189 (2%)
 Frame = +2

Query  146  RTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHDAYGVG  322
             + GG    S A    F++ A  + +AV  F++LS  +TS +D +DL ++G    +YG+G
Sbjct  9    HSRGGAMRSSTAS---FRVLAMTIAVAVVFFISLSFVFTSQTDTSDLTDLGFNSGSYGLG  65

Query  323  PVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNY  502
              RR+VLALKSDPLKPR D IRKQA+DHR LALAYASYARKLKLENSKLVRVFA+LSRNY
Sbjct  66   STRRTVLALKSDPLKPRLDQIRKQADDHRTLALAYASYARKLKLENSKLVRVFADLSRNY  125

Query  503  TDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLK  682
            +DL++KPAYRALF+ D+ ++DESVLRQFEKEVKERIKVTRQV+AEAKESFDNQLKIQKLK
Sbjct  126  SDLMNKPAYRALFDSDALNIDESVLRQFEKEVKERIKVTRQVIAEAKESFDNQLKIQKLK  185

Query  683  DTIFAVNDQ  709
            DTIF VN+Q
Sbjct  186  DTIFQVNEQ  194



>ref|XP_008235436.1| PREDICTED: galacturonosyltransferase 8 [Prunus mume]
Length=562

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 153/189 (81%), Gaps = 4/189 (2%)
 Frame = +2

Query  146  RTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHDAYGVG  322
             + GG    S A    F + A  + +AV  F++LS   TS +D +DL ++G    +YG+G
Sbjct  9    HSRGGAMRSSTAS---FSVLAMTIAVAVVFFISLSFVITSQTDTSDLTDLGFNSGSYGLG  65

Query  323  PVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNY  502
              RR+VLALKSDPLKPR D IRKQA+DHR LALAYASYARKLKLENSKLVRVFA+LSRNY
Sbjct  66   STRRTVLALKSDPLKPRLDQIRKQADDHRTLALAYASYARKLKLENSKLVRVFADLSRNY  125

Query  503  TDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLK  682
            +DL++KPAYRALF+ D+ ++DESVLRQFEKEVKERIKVTRQV+AEAKESFDNQLKIQKLK
Sbjct  126  SDLMNKPAYRALFDSDALNIDESVLRQFEKEVKERIKVTRQVIAEAKESFDNQLKIQKLK  185

Query  683  DTIFAVNDQ  709
            DTIF VN+Q
Sbjct  186  DTIFQVNEQ  194



>ref|XP_011089660.1| PREDICTED: galacturonosyltransferase 8-like [Sesamum indicum]
Length=570

 Score =   217 bits (552),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 162/199 (81%), Gaps = 6/199 (3%)
 Frame = +2

Query  122  RSYRSAT-DRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGI  298
            R +RSA  DR SG  F  +  G   F+ FA  LTIAV LFL+LS  +T+SS PADL  G 
Sbjct  7    RIHRSAAPDRVSGHAFRLNTLG---FRSFAGFLTIAVSLFLSLSFLFTASSAPADLKFGF  63

Query  299  LHDAYGV--GPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLV  472
             +   G     +RRS+LALKSDPL+PR D +RKQAEDHR LALAYASYARKLKLENSKLV
Sbjct  64   PYSFSGSKSASMRRSILALKSDPLRPRLDQLRKQAEDHRGLALAYASYARKLKLENSKLV  123

Query  473  RVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESF  652
            R+FA+LSRNYTDLISKP+YRALF+ D+NS+DESVLR+FEKEVKERIK+TRQV+AEAKESF
Sbjct  124  RIFADLSRNYTDLISKPSYRALFDADANSIDESVLRRFEKEVKERIKLTRQVIAEAKESF  183

Query  653  DNQLKIQKLKDTIFAVNDQ  709
            DNQLKI KLKDTIFA+N+Q
Sbjct  184  DNQLKIHKLKDTIFALNEQ  202



>gb|KJB08803.1| hypothetical protein B456_001G104800 [Gossypium raimondii]
Length=488

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 157/208 (75%), Gaps = 12/208 (6%)
 Frame = +2

Query  101  MAIAPTVRS---YRSATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLR--YTS  265
            MAI  T R+          T GG FG      F  +L AS +T+A+  F  LS    Y S
Sbjct  1    MAIHRTARNSGVGVGGAGATIGG-FG------FTVRLLASAITVAICFFFALSFFFIYHS  53

Query  266  SSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyark  445
             S     N+G   D+YG+G  RRSVLALKSDPLKPR D IRKQA+DHR+L LAYASYARK
Sbjct  54   HSPHLQTNLGFSTDSYGIGSTRRSVLALKSDPLKPRLDQIRKQADDHRSLVLAYASYARK  113

Query  446  lklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQ  625
            LKLENSKLVRVFA+LSRNY+DLI+KP+YRALFE DS S+DESVLRQFEKEVKERIK TRQ
Sbjct  114  LKLENSKLVRVFADLSRNYSDLINKPSYRALFETDSLSIDESVLRQFEKEVKERIKATRQ  173

Query  626  VVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            +++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  174  MISEAKESFDNQLKIQKLKDTIFAVNEQ  201



>gb|KHG16505.1| Galacturonosyltransferase 8 -like protein [Gossypium arboreum]
Length=569

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 157/198 (79%), Gaps = 4/198 (2%)
 Frame = +2

Query  128  YRSATDRTSG-GLFGRSAAG-RFIFKLFASVLTIAVFLFLTLSLR--YTSSSDPADLNVG  295
            +R+A +  SG G+ G +  G  F  +L AS +T+A+  F  LS    Y S S     N+G
Sbjct  4    HRTARNSGSGVGVAGATIGGFGFTVRLLASAITVAICFFFALSFFFTYHSLSPHLQTNLG  63

Query  296  ILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVR  475
               D+YG+G  RRSVLALKSDPLKPR D IRKQA DHR+L LAYASYARKLKLENSKLVR
Sbjct  64   FSTDSYGIGSTRRSVLALKSDPLKPRLDQIRKQAGDHRSLVLAYASYARKLKLENSKLVR  123

Query  476  VFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFD  655
            VFA+LSRNY+DLI+KP+YRALFE DS S+DESVLRQFEKEVKERIK TRQ+++EAKESFD
Sbjct  124  VFADLSRNYSDLINKPSYRALFETDSLSIDESVLRQFEKEVKERIKATRQMISEAKESFD  183

Query  656  NQLKIQKLKDTIFAVNDQ  709
            NQLKIQKLKDTIFAVN+Q
Sbjct  184  NQLKIQKLKDTIFAVNEQ  201



>gb|KJB08802.1| hypothetical protein B456_001G104800 [Gossypium raimondii]
Length=569

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 157/208 (75%), Gaps = 12/208 (6%)
 Frame = +2

Query  101  MAIAPTVRS---YRSATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLR--YTS  265
            MAI  T R+          T GG FG      F  +L AS +T+A+  F  LS    Y S
Sbjct  1    MAIHRTARNSGVGVGGAGATIGG-FG------FTVRLLASAITVAICFFFALSFFFIYHS  53

Query  266  SSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyark  445
             S     N+G   D+YG+G  RRSVLALKSDPLKPR D IRKQA+DHR+L LAYASYARK
Sbjct  54   HSPHLQTNLGFSTDSYGIGSTRRSVLALKSDPLKPRLDQIRKQADDHRSLVLAYASYARK  113

Query  446  lklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQ  625
            LKLENSKLVRVFA+LSRNY+DLI+KP+YRALFE DS S+DESVLRQFEKEVKERIK TRQ
Sbjct  114  LKLENSKLVRVFADLSRNYSDLINKPSYRALFETDSLSIDESVLRQFEKEVKERIKATRQ  173

Query  626  VVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            +++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  174  MISEAKESFDNQLKIQKLKDTIFAVNEQ  201



>ref|XP_007049694.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOX93851.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=568

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 153/192 (80%), Gaps = 3/192 (2%)
 Frame = +2

Query  140  TDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL--NVGILHDAY  313
            + R+ GG+      G F  +L AS +T+A+  F  LS  +TS S    L  N G    +Y
Sbjct  7    SSRSGGGVPMLGGFG-FTVRLLASAITVAICFFFALSFFFTSHSHSPHLQTNFGFATGSY  65

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G+G  RRSVLALKSDPLKPR D IRKQA+DHR+L LAYASYARKLKLENSKLVRVFA+LS
Sbjct  66   GLGSTRRSVLALKSDPLKPRLDQIRKQADDHRSLVLAYASYARKLKLENSKLVRVFADLS  125

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            RNY+DLI+KP+YRALFE DS S+DESVLRQFEKEVKERIK TRQ+++EAKESFDNQLKIQ
Sbjct  126  RNYSDLINKPSYRALFETDSLSIDESVLRQFEKEVKERIKTTRQMISEAKESFDNQLKIQ  185

Query  674  KLKDTIFAVNDQ  709
            KLKDTIFAVN+Q
Sbjct  186  KLKDTIFAVNEQ  197



>ref|XP_012085051.1| PREDICTED: galacturonosyltransferase 8 [Jatropha curcas]
 gb|KDP26352.1| hypothetical protein JCGZ_17510 [Jatropha curcas]
Length=560

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 148/176 (84%), Gaps = 6/176 (3%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTS----SSDPADLNVGILHDAYGVGPVRRSVLALKSDP  361
            F++ AS +TIAVFLF T+S  +TS    S+D        +   +G G  RRSVLALKSDP
Sbjct  19   FRVLASAITIAVFLFFTVSFLFTSHSHSSTDLHHFGFKSIPSRFGSG--RRSVLALKSDP  76

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALF  541
            LKPR D IRKQA+DHR+LALAYASYARKLKLENSKLVRVFA+LSRNYTDLI+KP+YRALF
Sbjct  77   LKPRLDQIRKQADDHRSLALAYASYARKLKLENSKLVRVFADLSRNYTDLINKPSYRALF  136

Query  542  ELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            E DS S++ES LRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  137  ESDSLSIEESTLRQFEKEVKERIKLTRQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  192



>ref|XP_011024611.1| PREDICTED: galacturonosyltransferase 8 [Populus euphratica]
Length=554

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 151/191 (79%), Gaps = 6/191 (3%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYG  316
            AT R+S    G S      F++  S +++AVFL LT+SL +T+ S       G  +  YG
Sbjct  2    ATHRSSRSGIGVS------FRVLGSAVSLAVFLCLTVSLLFTAHSHSTTDTHGFSNVGYG  55

Query  317  VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
            +G  RRSVLA+KSDPLK R D IRKQA+DHR+LA AYASYARKLKLENSKLVRVFA+LSR
Sbjct  56   LGSGRRSVLAMKSDPLKSRLDQIRKQADDHRSLAHAYASYARKLKLENSKLVRVFADLSR  115

Query  497  NYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQK  676
            NYTDLI+KPAYRAL E DS S+DE+ LR FEKEVKERIKVTRQV+AEAKESFDNQLKIQK
Sbjct  116  NYTDLINKPAYRALSESDSLSIDEATLRLFEKEVKERIKVTRQVIAEAKESFDNQLKIQK  175

Query  677  LKDTIFAVNDQ  709
            LKDTIFAVN+Q
Sbjct  176  LKDTIFAVNEQ  186



>ref|XP_002301803.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa]
 gb|EEE81076.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa]
Length=554

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 152/191 (80%), Gaps = 6/191 (3%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYG  316
            AT R+S     RS  G   F++  S +++AVFL LT+SL +T+ S       G  +  YG
Sbjct  2    ATHRSS-----RSGVG-VSFRVLGSAVSLAVFLCLTVSLLFTAHSHSTTDTHGFSNVGYG  55

Query  317  VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
            +G  RRSVLA+KSDPLK R D IRKQA+DHR+LA AYASYARKLKLENSKLVRVFA+LSR
Sbjct  56   LGSGRRSVLAMKSDPLKSRLDQIRKQADDHRSLAHAYASYARKLKLENSKLVRVFADLSR  115

Query  497  NYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQK  676
            NYTDLI+KP+YRAL E DS S+DE+ LR FEKEVKERIKVTRQV+AEAKESFDNQLKIQK
Sbjct  116  NYTDLINKPSYRALSESDSLSIDEATLRLFEKEVKERIKVTRQVIAEAKESFDNQLKIQK  175

Query  677  LKDTIFAVNDQ  709
            LKDTIFAVN+Q
Sbjct  176  LKDTIFAVNEQ  186



>gb|ABK92560.1| unknown [Populus trichocarpa]
Length=554

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 151/191 (79%), Gaps = 6/191 (3%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYG  316
            AT R+S     RS  G   F++  S +++AVFL LT+S  +T+ S       G  +  YG
Sbjct  2    ATHRSS-----RSGVG-VSFRVLGSAVSLAVFLCLTVSHLFTAHSHSTTDTHGFSNVGYG  55

Query  317  VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
            +G  RRSVLA+KSDPLK R D IRKQA+DHR+LA AYASYARKLKLENSKLVRVFA+LSR
Sbjct  56   LGSGRRSVLAMKSDPLKSRLDQIRKQADDHRSLAHAYASYARKLKLENSKLVRVFADLSR  115

Query  497  NYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQK  676
            NYTDLI+KP+YRAL E DS S+DE+ LR FEKEVKERIKVTRQV+AEAKESFDNQLKIQK
Sbjct  116  NYTDLINKPSYRALSESDSLSIDEATLRLFEKEVKERIKVTRQVIAEAKESFDNQLKIQK  175

Query  677  LKDTIFAVNDQ  709
            LKDTIFAVN+Q
Sbjct  176  LKDTIFAVNEQ  186



>ref|XP_004290178.1| PREDICTED: galacturonosyltransferase 8 [Fragaria vesca subsp. 
vesca]
Length=562

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 151/193 (78%), Gaps = 2/193 (1%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYT-SSSDPADLN-VGILHDA  310
            A  R SG      A+  F     A   +  +F F +L+  +T S+ D +DL+ +G    +
Sbjct  2    AYPRLSGTATRGGASSSFRLLALAITASAVIFFFSSLTFVFTPSTGDSSDLDSLGFNSGS  61

Query  311  YGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAEL  490
            +G+G  RRSVLALKSDPLKPR D IRKQAEDHR LALAYASYARKLKLEN+KLVR+FA+L
Sbjct  62   FGLGSTRRSVLALKSDPLKPRLDQIRKQAEDHRTLALAYASYARKLKLENAKLVRIFADL  121

Query  491  SRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
            SRNY+DL++KP+YRALFE D  S+DESVLRQFEKEVKERIKVTRQV+AEAKESFDNQLKI
Sbjct  122  SRNYSDLMNKPSYRALFESDGLSIDESVLRQFEKEVKERIKVTRQVIAEAKESFDNQLKI  181

Query  671  QKLKDTIFAVNDQ  709
            QKLKDTIF VN+Q
Sbjct  182  QKLKDTIFQVNEQ  194



>ref|XP_009372229.1| PREDICTED: galacturonosyltransferase 8-like [Pyrus x bretschneideri]
Length=563

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 154/194 (79%), Gaps = 3/194 (2%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGRFI-FKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHDA  310
            A  R SG   G +A    + F++ A  + +AV    +LS  +TS +D +DL + G    +
Sbjct  2    ANLRFSGSSRGAAARSSVVSFRVLAMAIAVAVVFVFSLSFVFTSRTDSSDLGDSGFDSGS  61

Query  311  YG-VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAE  487
            +G  G  RR+VLALKSDPLKPR D IRKQA+DHR LALAYASYARKLKLENSKLVRVFA+
Sbjct  62   FGGFGSTRRTVLALKSDPLKPRLDQIRKQADDHRTLALAYASYARKLKLENSKLVRVFAD  121

Query  488  LSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLK  667
            LSRNY+DL++KPAYRALFE D+ ++DESVLRQFEKEVKERIKVTRQ++AEAKESFDNQLK
Sbjct  122  LSRNYSDLMNKPAYRALFESDALNIDESVLRQFEKEVKERIKVTRQIIAEAKESFDNQLK  181

Query  668  IQKLKDTIFAVNDQ  709
            IQKLKDTIF VN+Q
Sbjct  182  IQKLKDTIFQVNEQ  195



>ref|XP_010527263.1| PREDICTED: galacturonosyltransferase 8 [Tarenaya hassleriana]
Length=563

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = +2

Query  173  SAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLN-VGILHDAYGVGPVRRSVLAL  349
            +  G    +  A V ++AV  F  +S  + S  D  DL+  G+  +AYG G  RRS+L +
Sbjct  16   TCGGGGTIRRLAFVTSVAVLFFFGISFLFASEYDSTDLHGSGVDSNAYGFGSTRRSILDV  75

Query  350  KSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAY  529
            KSDPLKPR   IRKQA+DHR+LALAYASYARKLKLENSKLVRVFA+LSRNYTDLI+KP+Y
Sbjct  76   KSDPLKPRLIQIRKQADDHRSLALAYASYARKLKLENSKLVRVFADLSRNYTDLINKPSY  135

Query  530  RALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RAL+E D  S+DE+VLRQFEKEVKERIK+TRQV+ EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  136  RALYESDGASIDETVLRQFEKEVKERIKMTRQVIGEAKESFDNQLKIQKLKDTIFAVNEQ  195



>ref|XP_008372509.1| PREDICTED: galacturonosyltransferase 8 [Malus domestica]
Length=563

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 151/193 (78%), Gaps = 7/193 (4%)
 Frame = +2

Query  146  RTSGGLFGRSAAGR---FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHDAY  313
            R SG   GR  A R     F++ A  + +AV    +LS  + S +D +D+ + G+   ++
Sbjct  5    RISGS--GRGGAARSSVASFRVLAMAIAVAVVFVFSLSFVFASRTDSSDVGDSGLDSGSF  62

Query  314  G-VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAEL  490
            G  G  RR+VLALKSDPLKPR D IRKQA+DHR LALAYASYARKLKLENSKLVRVFA+L
Sbjct  63   GGFGSTRRTVLALKSDPLKPRLDQIRKQADDHRTLALAYASYARKLKLENSKLVRVFADL  122

Query  491  SRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
            SRNY DL++KPAYRALFE D  ++DESVLRQFEKEVKERIKVTRQV+AEAKESFDNQLKI
Sbjct  123  SRNYWDLMNKPAYRALFESDGLNIDESVLRQFEKEVKERIKVTRQVIAEAKESFDNQLKI  182

Query  671  QKLKDTIFAVNDQ  709
            QKLKDTIF VN+Q
Sbjct  183  QKLKDTIFQVNEQ  195



>ref|XP_008382600.1| PREDICTED: galacturonosyltransferase 8-like [Malus domestica]
Length=561

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 155/196 (79%), Gaps = 9/196 (5%)
 Frame = +2

Query  137  ATDRTSGGLFGRSAAGR---FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILH  304
            A  R SG   GR AA R     F++ A  + +AV    +LS  +TS +D +DL + G   
Sbjct  2    ANLRFSGS--GRGAAARSSVASFRVLA--IAVAVVFVFSLSFVFTSRTDSSDLGDSGFDS  57

Query  305  DAYG-VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVF  481
             ++G  G  RR+VLALKSDPLKPR D IRKQA+DHR LALAYASYARKLKLENSKLVRVF
Sbjct  58   GSFGGFGSTRRTVLALKSDPLKPRLDQIRKQADDHRTLALAYASYARKLKLENSKLVRVF  117

Query  482  AELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQ  661
            A+LSRNY+DL++KPAYRALFE D+ ++DESVLRQFEKEVKERIKVTRQ++AEAKESFDNQ
Sbjct  118  ADLSRNYSDLMNKPAYRALFESDALNIDESVLRQFEKEVKERIKVTRQIIAEAKESFDNQ  177

Query  662  LKIQKLKDTIFAVNDQ  709
            LKIQKLKDTIF VN+Q
Sbjct  178  LKIQKLKDTIFQVNEQ  193



>gb|KHG21596.1| Galacturonosyltransferase 8 -like protein [Gossypium arboreum]
Length=564

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 153/198 (77%), Gaps = 10/198 (5%)
 Frame = +2

Query  128  YRSATDRTSGG--LFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADL--NVG  295
            +R++     GG  +FG      F  +L AS +T+A+  F  LS  +TS S    L  N G
Sbjct  5    HRTSRIGVGGGSPMFGGFG---FTVRLLASAITVALCFFFLLSFFFTSHSHSPHLQTNFG  61

Query  296  ILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVR  475
                + G+G  RRSVLALKSDPLKPR D IRKQA+DHR+L LAYASYARKLKLENSKLVR
Sbjct  62   F---STGIGSTRRSVLALKSDPLKPRLDQIRKQADDHRSLVLAYASYARKLKLENSKLVR  118

Query  476  VFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFD  655
            VFA+LSRNY+DLISKP+YRALFE DS S+DE +LRQFEKEVKERIK TRQV++EAKESFD
Sbjct  119  VFADLSRNYSDLISKPSYRALFETDSLSIDEPLLRQFEKEVKERIKATRQVISEAKESFD  178

Query  656  NQLKIQKLKDTIFAVNDQ  709
            NQLKIQKLKDTIFAVN+Q
Sbjct  179  NQLKIQKLKDTIFAVNEQ  196



>emb|CBI25666.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  308  AYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAE  487
            +YG G  RRSVLA+KSDPLKPR D IRKQAEDH++LALAYASYARKLKLENSKLVRVFA+
Sbjct  28   SYGFGSTRRSVLAVKSDPLKPRLDQIRKQAEDHKSLALAYASYARKLKLENSKLVRVFAD  87

Query  488  LSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLK  667
            LSRNYTDLISKP+YRAL+E DS  +DESVLRQFEKEVKERIKVTRQV++EAKESFDNQLK
Sbjct  88   LSRNYTDLISKPSYRALYEPDSLVIDESVLRQFEKEVKERIKVTRQVISEAKESFDNQLK  147

Query  668  IQKLKDTIFAVNDQ  709
            IQKLKDTIFAVN+Q
Sbjct  148  IQKLKDTIFAVNEQ  161



>ref|XP_009372029.1| PREDICTED: galacturonosyltransferase 8-like [Pyrus x bretschneideri]
Length=575

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 144/174 (83%), Gaps = 2/174 (1%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPADL-NVGILHDAYG-VGPVRRSVLALKSDPLK  367
            F++ A    +AV    +LS  + S +D +D+ + G+   ++G  G  RR+VLALKSDPLK
Sbjct  34   FRVLAMATAVAVVFVFSLSFVFASRTDSSDVGDSGLDSGSFGGFGSTRRTVLALKSDPLK  93

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
            PR D IRKQA+DHR LALAYASYARKLKLENSKLVRVFA+LSRNY DL++KPAYR+LFE 
Sbjct  94   PRLDQIRKQADDHRTLALAYASYARKLKLENSKLVRVFADLSRNYWDLMNKPAYRSLFES  153

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            D+ ++DESVLRQFEKEVKERIKVTRQV+AEAKESFDNQLKIQKLKDTIF VN+Q
Sbjct  154  DALNIDESVLRQFEKEVKERIKVTRQVIAEAKESFDNQLKIQKLKDTIFQVNEQ  207



>emb|CDY00812.1| BnaCnng00120D [Brassica napus]
Length=460

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 148/180 (82%), Gaps = 9/180 (5%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPA-DLNV-------GILHDAYGVGPVRRSVLAL  349
            F+L A   TIA+  F TLS  +TS S+ + DL++        ++  + GVG +RRS+L +
Sbjct  23   FRLTALAATIAL-SFFTLSFVFTSESNHSPDLHLPVSSQSLNLIRHSNGVGSIRRSILDI  81

Query  350  KSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAY  529
            KSDPLKPR   IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTDLISKP Y
Sbjct  82   KSDPLKPRLLQIRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTDLISKPTY  141

Query  530  RALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RAL++ D +S++ES LRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  142  RALYDSDGSSIEESTLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  201



>ref|XP_002273962.2| PREDICTED: galacturonosyltransferase 8 [Vitis vinifera]
Length=558

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  308  AYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAE  487
            +YG G  RRSVLA+KSDPLKPR D IRKQAEDH++LALAYASYARKLKLENSKLVRVFA+
Sbjct  57   SYGFGSTRRSVLAVKSDPLKPRLDQIRKQAEDHKSLALAYASYARKLKLENSKLVRVFAD  116

Query  488  LSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLK  667
            LSRNYTDLISKP+YRAL+E DS  +DESVLRQFEKEVKERIKVTRQV++EAKESFDNQLK
Sbjct  117  LSRNYTDLISKPSYRALYEPDSLVIDESVLRQFEKEVKERIKVTRQVISEAKESFDNQLK  176

Query  668  IQKLKDTIFAVNDQ  709
            IQKLKDTIFAVN+Q
Sbjct  177  IQKLKDTIFAVNEQ  190



>ref|XP_010696262.1| PREDICTED: galacturonosyltransferase 8 [Beta vulgaris subsp. 
vulgaris]
Length=551

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = +2

Query  164  FGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNV-GILHDAYGVGPVRRSV  340
              R       +KL AS + + + LF +LSL +T ++D + +   G        G +RRSV
Sbjct  1    MARRGVSVITYKLLASSMAVVLTLFFSLSLFFTDNADYSAIAASGYSTQLLSGGAIRRSV  60

Query  341  LALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISK  520
            LALKSDPLKPR D I+KQA+DHR L LAYASYARKLKLENSK++R+FA+LSRNYTDL++K
Sbjct  61   LALKSDPLKPRVDQIKKQADDHRNLVLAYASYARKLKLENSKMLRIFADLSRNYTDLLNK  120

Query  521  PAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAV  700
             AYRALFE D+ S+DE VLRQFEKEVKERIKVTRQV+AEAKESFDNQLKIQKLKDTIF +
Sbjct  121  SAYRALFESDALSIDEYVLRQFEKEVKERIKVTRQVIAEAKESFDNQLKIQKLKDTIFGL  180

Query  701  NDQ  709
            N+Q
Sbjct  181  NEQ  183



>ref|XP_010246719.1| PREDICTED: galacturonosyltransferase 8 [Nelumbo nucifera]
Length=569

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 158/201 (79%), Gaps = 9/201 (4%)
 Frame = +2

Query  119  VRSYRSATDRTSGGLFGRSAAGRFIF--KLFASVLTIAVFLFLTLSLRYTSSSDP-ADLN  289
            +RS R+ ++R +GG     AA   +F  +LF   + ++VFLF+      +S+SD  A+ +
Sbjct  6    LRSSRAISERNNGG-----AAQSLLFPNRLFLFAIAVSVFLFVIAFTFLSSTSDSRAETD  60

Query  290  VGILHDAYGVGP-VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSK  466
            +G++   +  G   RRSVLA+KSDPLKPR D IRKQA+DHR LALAYAS+ARKLKLEN+K
Sbjct  61   LGVVASGFNGGLFARRSVLAVKSDPLKPRVDQIRKQADDHRTLALAYASFARKLKLENTK  120

Query  467  LVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKE  646
            LVR FA+L+RNYTDL+S+P+YR+LF  D  S+DESVLRQFEKEVKERIKVTRQV+AE+KE
Sbjct  121  LVRGFADLARNYTDLMSRPSYRSLFSSDDVSIDESVLRQFEKEVKERIKVTRQVIAESKE  180

Query  647  SFDNQLKIQKLKDTIFAVNDQ  709
            SFDNQLKIQKLKDTIFAVN+ 
Sbjct  181  SFDNQLKIQKLKDTIFAVNEH  201



>gb|KJB10195.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=504

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +2

Query  197  KLFASVLTIAVFLFLTLSLRYTSSSDPADL--NVGILHDAYGVGPVRRSVLALKSDPLKP  370
            +L AS +T+A+  F  LS  +TS S    L  N G    + G+G  RRSVLALKSDPLKP
Sbjct  27   RLLASAITVALCFFFLLSFFFTSHSHSPHLQTNFGF---STGIGSTRRSVLALKSDPLKP  83

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R D IRKQA+DHR+L LAYASYARKLKLENSK+VRVFA+LSRNY+DLISKP+Y+ALFE D
Sbjct  84   RLDQIRKQADDHRSLVLAYASYARKLKLENSKIVRVFADLSRNYSDLISKPSYQALFETD  143

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            S S+DE +LRQFEKEVKERIK TRQ+++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  144  SLSIDEPLLRQFEKEVKERIKATRQMISEAKESFDNQLKIQKLKDTIFAVNEQ  196



>gb|KJB10201.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=555

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +2

Query  197  KLFASVLTIAVFLFLTLSLRYTSSSDPADL--NVGILHDAYGVGPVRRSVLALKSDPLKP  370
            +L AS +T+A+  F  LS  +TS S    L  N G    + G+G  RRSVLALKSDPLKP
Sbjct  27   RLLASAITVALCFFFLLSFFFTSHSHSPHLQTNFGF---STGIGSTRRSVLALKSDPLKP  83

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R D IRKQA+DHR+L LAYASYARKLKLENSK+VRVFA+LSRNY+DLISKP+Y+ALFE D
Sbjct  84   RLDQIRKQADDHRSLVLAYASYARKLKLENSKIVRVFADLSRNYSDLISKPSYQALFETD  143

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            S S+DE +LRQFEKEVKERIK TRQ+++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  144  SLSIDEPLLRQFEKEVKERIKATRQMISEAKESFDNQLKIQKLKDTIFAVNEQ  196



>gb|KJB10198.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=564

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +2

Query  197  KLFASVLTIAVFLFLTLSLRYTSSSDPADL--NVGILHDAYGVGPVRRSVLALKSDPLKP  370
            +L AS +T+A+  F  LS  +TS S    L  N G    + G+G  RRSVLALKSDPLKP
Sbjct  27   RLLASAITVALCFFFLLSFFFTSHSHSPHLQTNFGF---STGIGSTRRSVLALKSDPLKP  83

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R D IRKQA+DHR+L LAYASYARKLKLENSK+VRVFA+LSRNY+DLISKP+Y+ALFE D
Sbjct  84   RLDQIRKQADDHRSLVLAYASYARKLKLENSKIVRVFADLSRNYSDLISKPSYQALFETD  143

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            S S+DE +LRQFEKEVKERIK TRQ+++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  144  SLSIDEPLLRQFEKEVKERIKATRQMISEAKESFDNQLKIQKLKDTIFAVNEQ  196



>gb|KJB10199.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=571

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +2

Query  197  KLFASVLTIAVFLFLTLSLRYTSSSDPADL--NVGILHDAYGVGPVRRSVLALKSDPLKP  370
            +L AS +T+A+  F  LS  +TS S    L  N G    + G+G  RRSVLALKSDPLKP
Sbjct  27   RLLASAITVALCFFFLLSFFFTSHSHSPHLQTNFGF---STGIGSTRRSVLALKSDPLKP  83

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R D IRKQA+DHR+L LAYASYARKLKLENSK+VRVFA+LSRNY+DLISKP+Y+ALFE D
Sbjct  84   RLDQIRKQADDHRSLVLAYASYARKLKLENSKIVRVFADLSRNYSDLISKPSYQALFETD  143

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            S S+DE +LRQFEKEVKERIK TRQ+++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  144  SLSIDEPLLRQFEKEVKERIKATRQMISEAKESFDNQLKIQKLKDTIFAVNEQ  196



>gb|KJB10200.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=591

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +2

Query  197  KLFASVLTIAVFLFLTLSLRYTSSSDPADL--NVGILHDAYGVGPVRRSVLALKSDPLKP  370
            +L AS +T+A+  F  LS  +TS S    L  N G    + G+G  RRSVLALKSDPLKP
Sbjct  27   RLLASAITVALCFFFLLSFFFTSHSHSPHLQTNFGF---STGIGSTRRSVLALKSDPLKP  83

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R D IRKQA+DHR+L LAYASYARKLKLENSK+VRVFA+LSRNY+DLISKP+Y+ALFE D
Sbjct  84   RLDQIRKQADDHRSLVLAYASYARKLKLENSKIVRVFADLSRNYSDLISKPSYQALFETD  143

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            S S+DE +LRQFEKEVKERIK TRQ+++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  144  SLSIDEPLLRQFEKEVKERIKATRQMISEAKESFDNQLKIQKLKDTIFAVNEQ  196



>emb|CDX77366.1| BnaA07g05040D [Brassica napus]
Length=536

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 9/187 (5%)
 Frame = +2

Query  152  SGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPA-DLNVGILHDAYGVGPV  328
             GG    S +G   F+L A   TIA+  F TLS  +TS S+ + DL++ +      +G +
Sbjct  10   GGGSPAISVSG-IRFRLTALAATIALSFF-TLSFLFTSESNHSPDLHLPV------IGSI  61

Query  329  RRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTD  508
            RRS+L +KSDPLKPR   IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTD
Sbjct  62   RRSILDIKSDPLKPRLLQIRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTD  121

Query  509  LISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
            LI+KP YRAL++ D +S++ES LRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDT
Sbjct  122  LINKPTYRALYDSDGSSIEESTLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDT  181

Query  689  IFAVNDQ  709
            IFAVN+Q
Sbjct  182  IFAVNEQ  188



>ref|XP_009102430.1| PREDICTED: galacturonosyltransferase 8-like [Brassica rapa]
Length=569

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 9/180 (5%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPA-DLNV-------GILHDAYGVGPVRRSVLAL  349
            F+L A   TIA+  F TLS  +TS S+ + DL++        ++  + GVG +RRS+L +
Sbjct  23   FRLTALAATIAL-SFFTLSFLFTSESNHSPDLHLPVSSQSLNLIRYSNGVGSIRRSMLDI  81

Query  350  KSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAY  529
            KSDPLKPR   I+KQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTDLISKP Y
Sbjct  82   KSDPLKPRLLQIQKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTDLISKPTY  141

Query  530  RALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RAL++ D +S++ES LRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  142  RALYDSDGSSIEESTLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  201



>ref|XP_003552108.1| PREDICTED: galacturonosyltransferase 8-like [Glycine max]
 gb|KHN41703.1| Galacturonosyltransferase 8 [Glycine soja]
Length=556

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 3/175 (2%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHD---AYGVGPVRRSVLALKSDPL  364
            F  F S ++IA+ +F  LSL +TS SD +        D   A+G   +RRS+LALK+DPL
Sbjct  14   FTPFTSAISIALCIFFVLSLLFTSHSDSSHQYHHTGSDGGVAHGFESIRRSILALKTDPL  73

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            KPR D IRKQA+DHR+LAL Y+SYARKLKLE+SKLVR+FAELSRN++DL++KP YR LF 
Sbjct  74   KPRLDQIRKQADDHRSLALVYSSYARKLKLESSKLVRIFAELSRNFSDLMNKPQYRTLFS  133

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             D++  DES LRQ EKEVKERIK TRQV+ +AKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  134  NDASPADESALRQLEKEVKERIKTTRQVIGDAKESFDNQLKIQKLKDTIFAVNEQ  188



>ref|XP_004149774.1| PREDICTED: galacturonosyltransferase 8 [Cucumis sativus]
 gb|KGN44629.1| hypothetical protein Csa_7G352420 [Cucumis sativus]
Length=566

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +2

Query  140  TDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDA--Y  313
            T R   G F ++    F F+   S ++IA  LFL+ S  +T S+  +DL     +D+  Y
Sbjct  7    TTRAVNGGFLQTLLRFFSFRALLSAISIAFLLFLSFSFVFTPSTHSSDLITLPGYDSVPY  66

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
             +    R  LA+KSDPLKPRFD IRKQA+DHR L  AYASYAR+LKLE SKLVRVFA+LS
Sbjct  67   RINSRTRLPLAVKSDPLKPRFDQIRKQADDHRTLLHAYASYARRLKLEYSKLVRVFADLS  126

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            +NYTDL +KP YR+LFE ++ S+DE++LRQFEKEVKERIKVTRQV+AEAKESFDNQLKIQ
Sbjct  127  QNYTDLNNKPGYRSLFEPETASIDEALLRQFEKEVKERIKVTRQVIAEAKESFDNQLKIQ  186

Query  674  KLKDTIFAVND  706
            KLKDTIF+VN+
Sbjct  187  KLKDTIFSVNE  197



>emb|CDP03909.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G G  RRSVLALKSDPLKPR D IRKQA+DHR+L LAYASYARKLKLENSKLVRVFA+LS
Sbjct  67   GGGRSRRSVLALKSDPLKPRLDQIRKQADDHRSLVLAYASYARKLKLENSKLVRVFADLS  126

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            RNYTDLISKP YR+LF +D++S+DESVLRQFEKE+KERIK+TRQV++EAKESFDNQLKIQ
Sbjct  127  RNYTDLISKPFYRSLFGMDADSIDESVLRQFEKELKERIKMTRQVISEAKESFDNQLKIQ  186

Query  674  KLKDTIFAVNDQ  709
            KLKD IFAVN+Q
Sbjct  187  KLKDNIFAVNEQ  198



>ref|XP_010532909.1| PREDICTED: galacturonosyltransferase 8-like [Tarenaya hassleriana]
Length=556

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = +2

Query  167  GRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNV-GILHDAYGVGPVRRSVL  343
            G    GR  F     V + AV LF + S  + S  DP+DL+V G    + G G  RRS+L
Sbjct  12   GSPVIGRLAF-----VTSAAVLLFFSFSFLFASEYDPSDLHVSGADSKSNGFGFTRRSIL  66

Query  344  ALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKP  523
             +KSDPLKPR   IRKQA+DHR+LALAYASYARKLKLENSKLVRVFA+LSRNYTDLI+KP
Sbjct  67   DVKSDPLKPRLIQIRKQADDHRSLALAYASYARKLKLENSKLVRVFADLSRNYTDLINKP  126

Query  524  AYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVN  703
            +YRAL++ D  S+DE+VLR+FEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN
Sbjct  127  SYRALYDSDGASMDETVLRKFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIFAVN  186

Query  704  DQ  709
            +Q
Sbjct  187  EQ  188



>gb|EYU40627.1| hypothetical protein MIMGU_mgv1a003761mg [Erythranthe guttata]
Length=565

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 154/198 (78%), Gaps = 9/198 (5%)
 Frame = +2

Query  122  RSYRSATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGIL  301
            R YR+A      G         F F+ FA  LTIAV LF+ +S   T+SS PADL  G  
Sbjct  7    RIYRNAASNWVSG-------NPFRFRYFAGFLTIAVSLFIAVSFLSTASSGPADLKFGFS  59

Query  302  HDAYGVGP--VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVR  475
              + G     +RR++LALKSDPLKPR D IRKQAEDHR LALAYASYARKLKLENSKLVR
Sbjct  60   DSSSGSESGSLRRTILALKSDPLKPRLDQIRKQAEDHRGLALAYASYARKLKLENSKLVR  119

Query  476  VFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFD  655
            +FA+LS+NYT+L+SKP YRALF+ DS+S+DESVLR++EKEVKERIK+TRQV+AEAKESFD
Sbjct  120  IFADLSQNYTNLVSKPIYRALFDSDSSSVDESVLRRYEKEVKERIKLTRQVIAEAKESFD  179

Query  656  NQLKIQKLKDTIFAVNDQ  709
            NQLKI KLKDTIFA+N+Q
Sbjct  180  NQLKIHKLKDTIFALNEQ  197



>ref|XP_006418657.1| hypothetical protein EUTSA_v10002465mg [Eutrema salsugineum]
 gb|ESQ37093.1| hypothetical protein EUTSA_v10002465mg [Eutrema salsugineum]
Length=562

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = +2

Query  203  FASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDL  382
            FAS  TIA+FLF    L  + S+D  DL +  +  + GVG +RRS+L +KSDPLKPR   
Sbjct  28   FAS--TIALFLFTLSFLFASESNDSPDLLLPGVGYSNGVGSIRRSILDIKSDPLKPRLIQ  85

Query  383  IRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSL  562
            IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTDLI+KP Y+AL++ D +S+
Sbjct  86   IRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTDLINKPLYKALYDSDGSSI  145

Query  563  DESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            +ESVLRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  146  EESVLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  194



>ref|XP_009136103.1| PREDICTED: galacturonosyltransferase 8 [Brassica rapa]
Length=558

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 149/191 (78%), Gaps = 12/191 (6%)
 Frame = +2

Query  146  RTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSS--DPADLNVGILHDAYGV  319
            R  G     S+ GR   +L A V TIA+ LF TLS  + S S  D  DL +       G+
Sbjct  9    RGGGSPAISSSGGRI--RLTAFVATIALSLF-TLSFLFASESNNDSPDLLLP------GI  59

Query  320  GPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRN  499
            G +RRS+L +K DPLKPR   IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRN
Sbjct  60   GSIRRSMLDIKPDPLKPRLLQIRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRN  119

Query  500  YTDLISKPAYRALFELD-SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQK  676
            YTDLI+KP+YR+L + D S+S+DES LRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQK
Sbjct  120  YTDLINKPSYRSLHDSDGSSSIDESTLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQK  179

Query  677  LKDTIFAVNDQ  709
            LKDTIFAVN+Q
Sbjct  180  LKDTIFAVNEQ  190



>ref|XP_010104168.1| Galacturonosyltransferase 8 [Morus notabilis]
 gb|EXB99100.1| Galacturonosyltransferase 8 [Morus notabilis]
Length=562

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = +2

Query  260  TSSSDPADL-NVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasy  436
            TS ++ + L + G+   +YG+G  RR++LALKSDPLKPR D IRKQAEDH+ALAL YA +
Sbjct  44   TSRTESSHLSHFGLGSGSYGIGTTRRTMLALKSDPLKPRLDQIRKQAEDHKALALTYAVF  103

Query  437  arklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKV  616
            ARKLKLENSKLVRVFAELSR+Y DLI+KP+Y+AL   D+ S+DESVLRQFEKEVKERIKV
Sbjct  104  ARKLKLENSKLVRVFAELSRSYNDLINKPSYQALLPSDALSIDESVLRQFEKEVKERIKV  163

Query  617  TRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            TRQV++EAKESFDNQLKIQKLKDTIF VN+
Sbjct  164  TRQVISEAKESFDNQLKIQKLKDTIFQVNE  193



>ref|XP_006297348.1| hypothetical protein CARUB_v10013367mg [Capsella rubella]
 gb|EOA30246.1| hypothetical protein CARUB_v10013367mg [Capsella rubella]
Length=561

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +2

Query  260  TSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasya  439
            + S D  DL +  +  + GVG +RRS+L +KSDPL+PR   IRKQA+DHR+LALAYASYA
Sbjct  44   SESHDSPDLLLPGVEYSNGVGSMRRSILDIKSDPLRPRLIQIRKQADDHRSLALAYASYA  103

Query  440  rklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVT  619
            RKLKLENSKLVR+FA+LSRNYTDLI+KP YRAL++ D  S++ESVLRQFEKEVKERIK+T
Sbjct  104  RKLKLENSKLVRIFADLSRNYTDLINKPTYRALYDSDGTSIEESVLRQFEKEVKERIKMT  163

Query  620  RQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  164  RQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  193



>ref|XP_010513952.1| PREDICTED: galacturonosyltransferase 8-like [Camelina sativa]
Length=561

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  260  TSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasya  439
            + S+D +DL +  +  + GVG +RRS+L +KSDPL+PR   IRKQA+DHR+LALAYASYA
Sbjct  44   SESNDSSDLLLPGVEYSNGVGSMRRSMLDIKSDPLRPRLIQIRKQADDHRSLALAYASYA  103

Query  440  rklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVT  619
            RKLKLENSKLVR+FA+LSRNYTDLI+KP YRAL++ D  S++ESVLRQFEKEVKERIK+T
Sbjct  104  RKLKLENSKLVRIFADLSRNYTDLINKPTYRALYDSDGASIEESVLRQFEKEVKERIKMT  163

Query  620  RQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  164  RQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  193



>ref|XP_010036787.1| PREDICTED: galacturonosyltransferase 8 [Eucalyptus grandis]
 gb|KCW48431.1| hypothetical protein EUGRSUZ_K02133 [Eucalyptus grandis]
Length=555

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = +2

Query  248  SLRYTSSSDPADLN-VGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralala  424
            SL  TS SD + L+ +GI   ++G G VRRS+LA+KSDPLKPR D ++KQA+DHRALALA
Sbjct  33   SLTVTSRSDASRLHRLGISSASHGYGSVRRSILAMKSDPLKPRLDQLQKQADDHRALALA  92

Query  425  yasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKE  604
            YASYARKLKLE SKLVR+FA+LS+NY+DL+ KP Y ALF  DS S+DE+VLRQFEKEVKE
Sbjct  93   YASYARKLKLEYSKLVRIFADLSKNYSDLVKKPGYHALFASDSLSIDETVLRQFEKEVKE  152

Query  605  RIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RIKVTRQ V+E+KESFDNQLKIQKLKDTIFAVN+Q
Sbjct  153  RIKVTRQAVSESKESFDNQLKIQKLKDTIFAVNEQ  187



>ref|XP_010488624.1| PREDICTED: galacturonosyltransferase 8-like [Camelina sativa]
Length=561

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +2

Query  260  TSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasya  439
            + S+D  DL +  +  + GVG +RRS+L +KSDPL+PR   IRKQA+DHR+LALAYASYA
Sbjct  44   SESNDSPDLLLPGVEYSNGVGSMRRSMLDIKSDPLRPRLIQIRKQADDHRSLALAYASYA  103

Query  440  rklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVT  619
            RKLKLENSKLVR+FA+LSRNYTDLI+KP YRAL++ D  S++ESVLRQFEKEVKERIK+T
Sbjct  104  RKLKLENSKLVRIFADLSRNYTDLINKPTYRALYDSDGASIEESVLRQFEKEVKERIKMT  163

Query  620  RQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  164  RQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  193



>ref|NP_189150.1| Galacturonosyltransferase 8 [Arabidopsis thaliana]
 sp|Q9LSG3.1|GAUT8_ARATH RecName: Full=Galacturonosyltransferase 8; AltName: Full=Glycosyltransferase 
QUASIMODO1 [Arabidopsis thaliana]
 dbj|BAB02072.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20426.1| glycosyl transferase, putative [Arabidopsis thaliana]
 gb|AAQ56836.1| At3g25140 [Arabidopsis thaliana]
 gb|AEE76983.1| Galacturonosyltransferase 8 [Arabidopsis thaliana]
 gb|AHL38751.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=559

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = +2

Query  179  AGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSD  358
             GR     FAS  TIA+FLF       + S+D  DL +  +  + GVG  RRS+L +KSD
Sbjct  18   GGRITLTAFAS--TIALFLFTLSFFFASDSNDSPDLLLPGVEYSNGVGS-RRSMLDIKSD  74

Query  359  PLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRAL  538
            PLKPR   IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTDLI+KP YRAL
Sbjct  75   PLKPRLIQIRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTDLINKPTYRAL  134

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            ++ D  S++ESVLRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  135  YDSDGASIEESVLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  191



>ref|XP_010466934.1| PREDICTED: galacturonosyltransferase 8 [Camelina sativa]
Length=561

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +2

Query  260  TSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasya  439
            + S+D  DL +  +  + GVG +RRS+L +KSDPL+PR   IRKQA+DHR+LALAYASYA
Sbjct  44   SESNDSPDLLLPGVEYSNGVGSMRRSMLDIKSDPLRPRLIQIRKQADDHRSLALAYASYA  103

Query  440  rklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVT  619
            RKLKLENSKLVR+FA+LSRNYTDLI+KP YRAL++ D  S++ESVLRQFEKEVKERIK+T
Sbjct  104  RKLKLENSKLVRIFADLSRNYTDLINKPTYRALYDSDGASIEESVLRQFEKEVKERIKMT  163

Query  620  RQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            RQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  164  RQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  193



>ref|XP_002863088.1| hypothetical protein ARALYDRAFT_497166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39347.1| hypothetical protein ARALYDRAFT_497166 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 145/185 (78%), Gaps = 3/185 (2%)
 Frame = +2

Query  155  GGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRR  334
            GG  G  A      +L A   TIA+FLF       + S+D  DL +  +  + GVG  RR
Sbjct  10   GG--GSPAINGVKIRLTAFASTIALFLFTLSFFFVSDSNDSPDLLLPGVEYSNGVGS-RR  66

Query  335  SVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLI  514
            S+L +KSDPLKPR   IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTDLI
Sbjct  67   SMLDIKSDPLKPRLIQIRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTDLI  126

Query  515  SKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIF  694
            +KP YRAL++ D  S++ESVLRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIF
Sbjct  127  NKPTYRALYDSDGGSIEESVLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIF  186

Query  695  AVNDQ  709
            AVN+Q
Sbjct  187  AVNEQ  191



>emb|CDX93049.1| BnaA03g37710D [Brassica napus]
Length=553

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 10/175 (6%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSS--DPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
             +L A V TIA+ LF TLS  + S S  D  DL +       GVG +RRS+L +K DPLK
Sbjct  18   LRLTAFVATIALSLF-TLSFLFASESNNDSPDLLLP------GVGFIRRSMLDIKPDPLK  70

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
            PR   IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTDLI+KP+YR+L + 
Sbjct  71   PRLLQIRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTDLINKPSYRSLHDS  130

Query  548  D-SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            D S+S+DES LRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  131  DGSSSIDESTLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  185



>emb|CDY61593.1| BnaC03g74220D [Brassica napus]
Length=553

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 141/173 (82%), Gaps = 8/173 (5%)
 Frame = +2

Query  197  KLFASVLTIAVFLF-LTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPR  373
            +L   V TIA+ LF L+      S++D  DL +       GVG +RRS+L +K DPLKPR
Sbjct  19   RLTGFVATIALSLFALSFLFASESNNDSPDLLLP------GVGSIRRSMLDIKPDPLKPR  72

Query  374  FDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD-  550
               IRKQA+DHR+LALAYASYARKLKLENSKLVR+FA+LSRNYTDLI+KP+YRAL + D 
Sbjct  73   LLQIRKQADDHRSLALAYASYARKLKLENSKLVRIFADLSRNYTDLINKPSYRALHDSDG  132

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            S+S+DES LRQFEKEVKERIK+TRQV+AEAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  133  SSSIDESTLRQFEKEVKERIKMTRQVIAEAKESFDNQLKIQKLKDTIFAVNEQ  185



>ref|NP_001242612.1| uncharacterized protein LOC100817076 [Glycine max]
 gb|ACU20809.1| unknown [Glycine max]
Length=547

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHD---AYGVGPVRRSVLALKSDPL  364
            F LF S ++I + +F  LS  +T+ S  +  +     D   A+G   +RRSVLALK+DPL
Sbjct  14   FTLFTSAISIVLCIFFVLSFLFTAHSYSSHQHHNAGSDGGVAHGFESIRRSVLALKTDPL  73

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            KPR D IRK  +DHR+LAL Y+SYARKLKLE+SKLVR+FAELSRN++DL++KP YR LF 
Sbjct  74   KPRLDQIRKLTDDHRSLALVYSSYARKLKLESSKLVRIFAELSRNFSDLMNKPQYRTLFS  133

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             D++ +DES LRQ EKEVKERIK TRQV+ +AKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  134  NDASPVDESALRQLEKEVKERIKTTRQVIGDAKESFDNQLKIQKLKDTIFAVNEQ  188



>ref|XP_006584621.1| PREDICTED: uncharacterized protein LOC100817076 isoform X1 [Glycine 
max]
 gb|KHN10961.1| Galacturonosyltransferase 8 [Glycine soja]
Length=556

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHD---AYGVGPVRRSVLALKSDPL  364
            F LF S ++I + +F  LS  +T+ S  +  +     D   A+G   +RRSVLALK+DPL
Sbjct  14   FTLFTSAISIVLCIFFVLSFLFTAHSYSSHQHHNAGSDGGVAHGFESIRRSVLALKTDPL  73

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            KPR D IRK  +DHR+LAL Y+SYARKLKLE+SKLVR+FAELSRN++DL++KP YR LF 
Sbjct  74   KPRLDQIRKLTDDHRSLALVYSSYARKLKLESSKLVRIFAELSRNFSDLMNKPQYRTLFS  133

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             D++ +DES LRQ EKEVKERIK TRQV+ +AKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  134  NDASPVDESALRQLEKEVKERIKTTRQVIGDAKESFDNQLKIQKLKDTIFAVNEQ  188



>ref|XP_008364684.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8-like 
[Malus domestica]
Length=418

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G G  RR+VLALKSDPL PR D IRKQA+DHR LALAYAS ARKLKLE SKLVRVF +LS
Sbjct  28   GFGSTRRTVLALKSDPLMPRLDHIRKQADDHRTLALAYASCARKLKLEKSKLVRVFVDLS  87

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            RNY+DL++KPAYRALFE D+ ++DESVLRQFEKEV ERIKVTRQ++AEAKESFDNQLKIQ
Sbjct  88   RNYSDLMNKPAYRALFESDALNIDESVLRQFEKEVNERIKVTRQIIAEAKESFDNQLKIQ  147

Query  674  KLKDTIFAVNDQ  709
            KL DTIF VN+Q
Sbjct  148  KLXDTIFQVNEQ  159



>ref|XP_008357519.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8-like 
[Malus domestica]
Length=410

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G G  R +VLALKSDPLKPR D IRKQA+DHR LALAYAS ARKLKLE SKLV+VF +LS
Sbjct  28   GFGSTRMTVLALKSDPLKPRLDQIRKQADDHRTLALAYASCARKLKLEKSKLVQVFTDLS  87

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            RNY+DL++KPAYRALFE D+ ++DESVLRQFE EV ERIKVTRQ++AEAKESFDNQLKIQ
Sbjct  88   RNYSDLMNKPAYRALFESDALTIDESVLRQFENEVNERIKVTRQIIAEAKESFDNQLKIQ  147

Query  674  KLKDTIFAVNDQ  709
            KLKDTIF VN+Q
Sbjct  148  KLKDTIFQVNEQ  159



>ref|XP_004515038.1| PREDICTED: galacturonosyltransferase 8-like [Cicer arietinum]
Length=555

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 135/175 (77%), Gaps = 9/175 (5%)
 Frame = +2

Query  203  FASVLTIAVFLFLTLSLRYT----SSSDPADLNV--GILHDAYGVGPVRRSVLALKSDPL  364
            F+  L IA+ +F TLS  +T    SS  P  L+   G+ H    +G   RSVLALK+DPL
Sbjct  16   FSFTLIIALCIFFTLSFLFTAHSFSSHQPHHLDSDGGVGHGYESIG---RSVLALKTDPL  72

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            KPR D IRKQA+DH++LAL YASYARKLKLE+SKLVR+FAELSRN++DL+ KP Y+ LF 
Sbjct  73   KPRLDQIRKQADDHKSLALMYASYARKLKLESSKLVRIFAELSRNFSDLMGKPQYKTLFS  132

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             D+  +DE V+RQ EKEVKERIK TRQVV EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  133  NDAVPVDELVVRQLEKEVKERIKTTRQVVGEAKESFDNQLKIQKLKDTIFAVNEQ  187



>ref|XP_008458050.1| PREDICTED: galacturonosyltransferase 8 [Cucumis melo]
Length=566

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 147/191 (77%), Gaps = 2/191 (1%)
 Frame = +2

Query  140  TDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDA--Y  313
            T RT  G F +++   F F+   S ++IA  LFL+ S  +T S+  +DL     +D+  Y
Sbjct  7    TTRTVNGGFLQTSLRFFSFRALLSAISIAFLLFLSFSFFFTPSTHSSDLTSLPGYDSVPY  66

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
             +    R  LA+KSDPLKPRFD IRKQA+DHR L  AYASYAR+LKLE SKLVRVFA+LS
Sbjct  67   RINSRTRLPLAVKSDPLKPRFDQIRKQADDHRTLLHAYASYARRLKLEYSKLVRVFADLS  126

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            +NYTDL +KP YR+LFE ++ S+DE++LRQFEKEVKERIKVTRQV+AEAKESFDNQLKIQ
Sbjct  127  QNYTDLNNKPGYRSLFEPETASIDEALLRQFEKEVKERIKVTRQVIAEAKESFDNQLKIQ  186

Query  674  KLKDTIFAVND  706
            KLKDTIF+VN+
Sbjct  187  KLKDTIFSVNE  197



>ref|XP_007142473.1| hypothetical protein PHAVU_008G283600g [Phaseolus vulgaris]
 gb|ESW14467.1| hypothetical protein PHAVU_008G283600g [Phaseolus vulgaris]
Length=547

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = +2

Query  215  LTIAVFLFLTLS--LRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIR  388
            L+IA  + L LS  + ++ SS   D N G+   A+G    RR +LALK DPL PR D IR
Sbjct  16   LSIAFCIVLALSFLVTHSDSSHHTDANGGV---AHGFESTRRHILALKKDPLNPRLDQIR  72

Query  389  KQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDE  568
            KQA+DHR+LAL YASYARKLKLE+SKLVRVFAELSRN+ DL+SKP YR LF  D + +DE
Sbjct  73   KQADDHRSLALVYASYARKLKLESSKLVRVFAELSRNFMDLMSKPQYRPLFGNDVSHIDE  132

Query  569  SVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            SVLRQ EKEVKERIK TRQV+ +AKESFDNQLKIQKLKDTIF+VN+Q
Sbjct  133  SVLRQLEKEVKERIKTTRQVIGDAKESFDNQLKIQKLKDTIFSVNEQ  179



>ref|XP_008346857.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8-like 
[Malus domestica]
Length=433

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G G  RR+VLALKSDPL PR D IRKQA+DH  LALAYAS ARKLKLE SKLVRVF +LS
Sbjct  28   GFGSTRRTVLALKSDPLXPRLDHIRKQADDHXTLALAYASCARKLKLEKSKLVRVFXDLS  87

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            RNY+DL++KPAY ALFE D+ ++DES LRQ EKEV ERIKVTRQ++AEAKESFDNQLKIQ
Sbjct  88   RNYSDLMNKPAYXALFESDAXNIDESXLRQXEKEVXERIKVTRQIIAEAKESFDNQLKIQ  147

Query  674  KLKDTIFAVNDQ  709
            KLKDTIF VN+Q
Sbjct  148  KLKDTIFQVNEQ  159



>ref|XP_007140673.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris]
 gb|ESW12667.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris]
Length=556

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 137/178 (77%), Gaps = 9/178 (5%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPADLNV------GILHDAYGVGPVRRSVLALKS  355
            F LF S +++A+  F  LS  +T+ S  +  +       GI   A G   +RRS+LALK+
Sbjct  14   FTLFTSAMSLALCTFFLLSFLFTTHSYSSHQHHFTGSEGGI---ADGFESIRRSILALKT  70

Query  356  DPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA  535
            DPLKPR D IRKQ++DHR+LAL YASYARKLKLE+SKLVR+FAELS N++DL+ KP YR 
Sbjct  71   DPLKPRLDQIRKQSDDHRSLALVYASYARKLKLESSKLVRIFAELSVNFSDLMKKPQYRT  130

Query  536  LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            LF  D++ +DESV+RQ EKEVKERIK TRQV+ +AKESFDNQLKIQKLKDTIF+VN+Q
Sbjct  131  LFSSDASPVDESVVRQLEKEVKERIKTTRQVIGDAKESFDNQLKIQKLKDTIFSVNEQ  188



>gb|EPS62489.1| hypothetical protein M569_12298, partial [Genlisea aurea]
Length=445

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 133/176 (76%), Gaps = 9/176 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPV--RRSVLALKSDP  361
            F F  FA +L +A+ +FLT+S        P   ++ ++    G   +   RS+L  ++DP
Sbjct  2    FNFSAFACLLALAIIVFLTIS------PFPTSPDLAVVKPRGGSRSILGGRSILVSRTDP  55

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALF  541
            LKPR D I KQA+DHR L  AYASYARKLKLENSKLVR+FAELS+NYT+L+SKP+YR+LF
Sbjct  56   LKPRLDQILKQADDHRTLVSAYASYARKLKLENSKLVRMFAELSQNYTELLSKPSYRSLF  115

Query  542  ELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            E+DS  ++ESVL+Q EKEVKERIK TR+VV +AKESFDN LKI KLKDTIFA+N+Q
Sbjct  116  EVDS-VIEESVLKQLEKEVKERIKYTRKVVTDAKESFDNLLKIHKLKDTIFALNEQ  170



>ref|XP_008457595.1| PREDICTED: galacturonosyltransferase 8-like [Cucumis melo]
Length=567

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +2

Query  311  YGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAEL  490
            Y +   RR  L +KSDPLK R D IRKQA+DHR L  AYASYAR+LKLE SKLVRVFA+L
Sbjct  67   YRINYGRRFPLGVKSDPLKQRLDQIRKQADDHRNLLHAYASYARRLKLEYSKLVRVFADL  126

Query  491  SRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
            S+NYTDL +K  YR+LFE ++ S+DE++LRQFEKEVKERIKVTRQ ++EAKESFDNQLKI
Sbjct  127  SQNYTDLNNKATYRSLFERETPSMDEALLRQFEKEVKERIKVTRQAISEAKESFDNQLKI  186

Query  671  QKLKDTIFAVND  706
            QKLKDTIFA N+
Sbjct  187  QKLKDTIFAANE  198



>ref|XP_006841268.1| PREDICTED: galacturonosyltransferase 8 [Amborella trichopoda]
 gb|ERN02943.1| hypothetical protein AMTR_s00135p00111710 [Amborella trichopoda]
Length=561

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = +2

Query  326  VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYT  505
            V R+ LALKSDP K R DLI +QA DH AL  AY ++ARKLKLENSK +R FA+L RNYT
Sbjct  68   VSRTFLALKSDPFKARLDLIHRQANDHVALVTAYEAFARKLKLENSKQLRFFADLRRNYT  127

Query  506  DLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKD  685
            DL++KP+YR+L + D+  ++E +LRQFEKEVKERIK+TRQV++EAKESFDNQLKIQKLKD
Sbjct  128  DLMAKPSYRSLLDSDA-PIEEDILRQFEKEVKERIKLTRQVISEAKESFDNQLKIQKLKD  186

Query  686  TIFAVNDQ  709
            TIFAVN+Q
Sbjct  187  TIFAVNEQ  194



>ref|XP_010257858.1| PREDICTED: probable galacturonosyltransferase 9 [Nelumbo nucifera]
Length=569

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 132/181 (73%), Gaps = 14/181 (8%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAY--GVGP-----VRRSVLA  346
            F +++F S +   +FL +TLS+ +T++           HD+     GP     V R+ LA
Sbjct  29   FSYRIFVSAMFTLLFL-VTLSVLFTTNPSTNH------HDSVLPSTGPPVQAYVHRTFLA  81

Query  347  LKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPA  526
            LKSDPL+ R DLIRKQA DH AL  AYA+YAR+LKL+NSK +RVF +L+RN++DL+++P 
Sbjct  82   LKSDPLRTRVDLIRKQANDHIALVNAYAAYARRLKLDNSKQLRVFEDLARNFSDLLTRPT  141

Query  527  YRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            YRA       +++E+VLRQFEKEVK+++K+ RQ++ EAK+SFDNQLKIQKLKDTIFAVN+
Sbjct  142  YRAALLEPVGAIEENVLRQFEKEVKDKVKIARQLIGEAKDSFDNQLKIQKLKDTIFAVNE  201

Query  707  Q  709
            Q
Sbjct  202  Q  202



>ref|XP_010694564.1| PREDICTED: probable galacturonosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=560

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G   + RS LALKSDPLK R DLI KQA DH  L  AYA+YARKLKL+NS+ ++++ +L+
Sbjct  62   GNAYIHRSFLALKSDPLKTRLDLIHKQAHDHIMLVNAYAAYARKLKLDNSRQLKLYDDLA  121

Query  494  RNYTDLISKPAYR-ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
            +N+T+++SKPAYR ALFE +  ++DE VLRQFEKEVK+++KV R ++AEAKES+DNQLKI
Sbjct  122  QNFTEMLSKPAYRGALFETEG-TVDEDVLRQFEKEVKDKVKVARLMIAEAKESYDNQLKI  180

Query  671  QKLKDTIFAVNDQ  709
            QKLKDTIFAV++Q
Sbjct  181  QKLKDTIFAVHEQ  193



>ref|XP_007151434.1| hypothetical protein PHAVU_004G045900g [Phaseolus vulgaris]
 gb|ESW23428.1| hypothetical protein PHAVU_004G045900g [Phaseolus vulgaris]
Length=546

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 133/191 (70%), Gaps = 13/191 (7%)
 Frame = +2

Query  149  TSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTS----SSDPADLNVGILHDAYG  316
            T G   G +  G F F++F S +   +F+  TLS+ +TS    S+D +DL         G
Sbjct  5    TRGSRGGSTFRGLFSFRIFISAMFSLLFI-ATLSVLFTSNPSTSNDESDLPTT------G  57

Query  317  VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
               V+R+ LALKSDPL+ R DLI +QA+DH AL  AY +YARKLKL+ SK ++ F EL+R
Sbjct  58   NAYVQRTFLALKSDPLRTRVDLIHQQAKDHIALVNAYGAYARKLKLDISKQLKTFDELAR  117

Query  497  NYTDLISKPAY-RALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            N++D+  KP Y ++LFE D   +DE VL+QFEKEVKER+K+ R ++ EAKE++DNQLKIQ
Sbjct  118  NFSDIALKPVYQKSLFESDG-PIDEDVLKQFEKEVKERVKIARLIIVEAKENYDNQLKIQ  176

Query  674  KLKDTIFAVND  706
            KLKDTIFAV++
Sbjct  177  KLKDTIFAVHE  187



>ref|XP_006430887.1| hypothetical protein CICLE_v10011396mg [Citrus clementina]
 gb|ESR44127.1| hypothetical protein CICLE_v10011396mg [Citrus clementina]
Length=559

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 128/186 (69%), Gaps = 5/186 (3%)
 Frame = +2

Query  152  SGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVR  331
             G   G      F +++F S +   +FL  TLS+  TS    +  + G+   + G   V+
Sbjct  10   GGTAVGPGLRSLFAYRIFVSAMFSLLFL-ATLSVILTSHPSTSHHDPGL--PSSGNAYVQ  66

Query  332  RSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDL  511
            R+ LALKSDPLK R DLI+KQA DH  L   YA+YARKLKL+ S+ +R+F +L+ N++DL
Sbjct  67   RTFLALKSDPLKTRLDLIQKQANDHITLVNTYAAYARKLKLDISRQLRMFDDLAHNFSDL  126

Query  512  ISKPAYR-ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
            + KP Y+ ALFE    ++DE VLRQFEKEVK+++KV R ++ E+KES+DNQLKIQKLKDT
Sbjct  127  LMKPGYKSALFE-SEGAVDEDVLRQFEKEVKDKVKVARLMIGESKESYDNQLKIQKLKDT  185

Query  689  IFAVND  706
            IFAVN+
Sbjct  186  IFAVNE  191



>ref|XP_006482345.1| PREDICTED: probable galacturonosyltransferase 9-like [Citrus 
sinensis]
Length=559

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 128/186 (69%), Gaps = 5/186 (3%)
 Frame = +2

Query  152  SGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVR  331
             G   G      F +++F S +   +FL  TLS+  TS    +  + G+   + G   V+
Sbjct  10   GGTAVGPGLRSLFSYRIFVSAMFSLLFL-ATLSVILTSHPSTSHHDPGL--PSSGNAYVQ  66

Query  332  RSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDL  511
            R+ LALKSDPLK R DLI+KQA DH  L   YA+YARKLKL+ S+ +R+F +L+ N++DL
Sbjct  67   RTFLALKSDPLKTRLDLIQKQANDHITLVNTYAAYARKLKLDISRQLRMFDDLAHNFSDL  126

Query  512  ISKPAYR-ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
            + KP Y+ ALFE    ++DE VLRQFEKEVK+++KV R ++ E+KES+DNQLKIQKLKDT
Sbjct  127  LMKPGYKSALFE-SEGAVDEDVLRQFEKEVKDKVKVARLMIGESKESYDNQLKIQKLKDT  185

Query  689  IFAVND  706
            IFAVN+
Sbjct  186  IFAVNE  191



>gb|KHN02656.1| Putative galacturonosyltransferase 9 [Glycine soja]
Length=552

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 132/191 (69%), Gaps = 13/191 (7%)
 Frame = +2

Query  149  TSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTS----SSDPADLNVGILHDAYG  316
            T G   G S    F F++F S +   +F+  TLS+ +T+    S+D +DL         G
Sbjct  5    TRGARGGSSFRSLFSFRIFISAIFSLLFV-ATLSVLFTTNPSTSNDDSDLPTT------G  57

Query  317  VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
               V R+ LALKSDPL+ R DLI +QA+DH AL  AY +YARKLKL+ SK +++F EL+ 
Sbjct  58   NAYVHRTFLALKSDPLRTRMDLIHQQAKDHIALVNAYGAYARKLKLDISKQLKMFDELAH  117

Query  497  NYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            N++D++ KP Y+A LF+ D   +DE VLRQFEKEVK+R+K+ R ++ EAKE++DNQLKIQ
Sbjct  118  NFSDIVLKPTYKASLFDSDG-PIDEDVLRQFEKEVKDRVKIARMIIVEAKENYDNQLKIQ  176

Query  674  KLKDTIFAVND  706
            KLKDTIFAV++
Sbjct  177  KLKDTIFAVHE  187



>ref|XP_006593710.1| PREDICTED: probable galacturonosyltransferase 9-like [Glycine 
max]
Length=552

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 132/191 (69%), Gaps = 13/191 (7%)
 Frame = +2

Query  149  TSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTS----SSDPADLNVGILHDAYG  316
            T G   G S    F F++F S +   +F+  TLS+ +T+    S+D +DL         G
Sbjct  5    TRGARGGSSFRSLFSFRIFISAIFSLLFV-ATLSVLFTTNPSTSNDDSDLPTT------G  57

Query  317  VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
               V R+ LALKSDPL+ R DLI +QA+DH AL  AY +YARKLKL+ SK +++F EL+ 
Sbjct  58   NAYVHRTFLALKSDPLRTRMDLIHQQAKDHIALVNAYGAYARKLKLDISKQLKMFDELAH  117

Query  497  NYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            N++D++ KP Y+A LF+ D   +DE VLRQFEKEVK+R+K+ R ++ EAKE++DNQLKIQ
Sbjct  118  NFSDIVLKPTYKASLFDSDG-PIDEDVLRQFEKEVKDRVKIARMIIVEAKENYDNQLKIQ  176

Query  674  KLKDTIFAVND  706
            KLKDTIFAV++
Sbjct  177  KLKDTIFAVHE  187



>ref|XP_006603944.1| PREDICTED: probable galacturonosyltransferase 9-like [Glycine 
max]
 gb|KHN30760.1| Putative galacturonosyltransferase 9 [Glycine soja]
Length=552

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 129/190 (68%), Gaps = 11/190 (6%)
 Frame = +2

Query  149  TSGGLFGRSAAGRFIFKLFASVLTIAVF---LFLTLSLRYTSSSDPADLNVGILHDAYGV  319
            T G   G S    F F++F S +   +F   L + L+   ++S+D  DL         G 
Sbjct  5    TRGARGGSSFRSLFSFRIFISAMFSLLFVATLSVLLTTNPSTSNDDPDLPTT------GN  58

Query  320  GPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRN  499
              V R+ LALKSDPLK R DLI +QA+DH AL  AY +YARKLKL+ SK +++F EL+RN
Sbjct  59   AYVHRTFLALKSDPLKTRVDLIHQQAKDHIALVNAYGAYARKLKLDISKQLKMFDELARN  118

Query  500  YTDLISKPAYR-ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQK  676
            ++D+ SK  Y+ +LFE D   +DE VLRQFEKEVK+R+K+ R ++ EAKE++DNQLKIQK
Sbjct  119  FSDIASKTTYKTSLFESDG-PIDEDVLRQFEKEVKDRVKIARMIIVEAKENYDNQLKIQK  177

Query  677  LKDTIFAVND  706
            LKDTIFAV++
Sbjct  178  LKDTIFAVHE  187



>ref|XP_011099072.1| PREDICTED: probable galacturonosyltransferase 9 [Sesamum indicum]
Length=557

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 7/174 (4%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++FAS +   +FL  TLS+ ++S     D  V    +AY    V RS LA +SDP K
Sbjct  22   FSYRIFASAMFTLLFL-ATLSVFFSSHPSQDDPVVETTGNAY----VHRSFLAWQSDPPK  76

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-ALFE  544
             R DLI  QA +H AL  AY  YARKLKLE SKL+++F +L++N++DL  KP YR ALFE
Sbjct  77   TRLDLIHNQANNHIALVNAYGGYARKLKLETSKLLKMFDDLAKNFSDLQLKPTYRTALFE  136

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
                 +DE VLRQFEKEVK+++K+ R ++AE+KES+DNQLKIQKLKDTIFAV++
Sbjct  137  -SGGPVDEDVLRQFEKEVKDKVKIARIIIAESKESYDNQLKIQKLKDTIFAVHE  189



>gb|KHG03994.1| putative galacturonosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=557

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 123/173 (71%), Gaps = 7/173 (4%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S L   +F+ +T+S+  TS   P   +  +   A     + R+ LAL SDPLK
Sbjct  24   FSYRIFISALFSLLFI-VTVSVLLTSRPPPTHHHSSLPSGANAY--MHRTFLALNSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L   YA+YARKLKLENSK +++F +L++N++DL SKP+   LFE 
Sbjct  81   TRLDLIYKQANDHITLVKTYAAYARKLKLENSKQLKMFDDLAKNFSDLTSKPS---LFET  137

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            D N LDE VLRQFEKEVK+R+K  R +VAE+KE++DNQLKIQKLKDTIF+V++
Sbjct  138  DGN-LDEDVLRQFEKEVKDRVKFARLMVAESKENYDNQLKIQKLKDTIFSVSE  189



>ref|XP_002530802.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF31570.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=563

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 9/176 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSS--SDPADLNVGILHDAYGVGPVRRSVLALKSDP  361
            F +++  S +   +FL  TLS+  T+   + P + ++    DAY    V+R+ LAL SDP
Sbjct  26   FSYRILVSAMFTLLFL-ATLSVLLTTHPPTSPHESSLPSSGDAY----VQRTFLALNSDP  80

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-AL  538
            LK R DLI KQA DH  L  AYA+YARKLKL+ S+ +R+F +L++N+TD+ SKP Y+ +L
Sbjct  81   LKTRLDLIYKQASDHMTLVNAYAAYARKLKLDISRQLRMFDDLAKNFTDITSKPNYKISL  140

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            FE    ++DE +LRQFEKE+KER+KV R ++AE KES+DNQ+KIQKLKDTIFAVN+
Sbjct  141  FE-SEGAIDEDILRQFEKEIKERVKVARLMIAETKESYDNQIKIQKLKDTIFAVNE  195



>ref|XP_008455575.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis melo]
 ref|XP_008455576.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis melo]
Length=550

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 138/205 (67%), Gaps = 16/205 (8%)
 Frame = +2

Query  101  MAIAPTVRSYRSATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTS--SSD  274
            MA+A  VR  R A++   GG   R+    F +++F S L   +F+  TLS+ +T+  S+ 
Sbjct  1    MAVA--VRGSRGASN--FGGFNPRNF---FSYRIFISALFSLLFI-ATLSVIFTTNPSTP  52

Query  275  PADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklkl  454
              D  +    +AY    VRR+ L L SDPLK R DLI KQA DH  L  AYA+YARKLKL
Sbjct  53   HHDSALPTTGNAY----VRRTFLTLNSDPLKTRLDLIYKQASDHITLVNAYAAYARKLKL  108

Query  455  ENSKLVRVFAELSRNYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVV  631
            E SK +++F +L++N++D+  KP YR  LFE  +  LDE VLRQFEKEVK+R+K  R ++
Sbjct  109  EMSKQLKMFDDLAQNFSDIQMKPNYRGTLFE-STGPLDEDVLRQFEKEVKDRVKTARMMI  167

Query  632  AEAKESFDNQLKIQKLKDTIFAVND  706
             E+KE++DNQLKIQKLKDTIFAVN+
Sbjct  168  VESKENYDNQLKIQKLKDTIFAVNE  192



>ref|XP_003635905.1| Glycosyltransferase [Medicago truncatula]
 gb|KEH25211.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
Length=555

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 133/187 (71%), Gaps = 9/187 (5%)
 Frame = +2

Query  155  GGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTS--SSDPADLNVGILHDAYGVGPV  328
            G   G +  G F +++F S +   +F+  TLS+ +T+  S++  D ++    +AY    V
Sbjct  7    GSRGGSTLRGFFSYRIFISAMFSLLFI-ATLSVLFTTNPSTENDDSDLPTTGNAY----V  61

Query  329  RRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTD  508
             R+ LALKSDPL+ R DLI +QA+DH +L  AYA+YARKLKL+ S+ +++F EL+ N++D
Sbjct  62   HRTFLALKSDPLRTRVDLIHQQAKDHISLVNAYAAYARKLKLDISRQLKMFDELAGNFSD  121

Query  509  LISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKD  685
            +  KP YRA LFE D   +DE VLRQFEKE+K+R+K+ R ++ EAKE++D QLKIQKLKD
Sbjct  122  IALKPTYRASLFESDG-PIDEDVLRQFEKEIKDRVKIARMMIVEAKENYDTQLKIQKLKD  180

Query  686  TIFAVND  706
            TIFAVN+
Sbjct  181  TIFAVNE  187



>ref|XP_004507267.1| PREDICTED: probable galacturonosyltransferase 9-like [Cicer arietinum]
Length=555

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 136/196 (69%), Gaps = 15/196 (8%)
 Frame = +2

Query  134  SATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSS----SDPADLNVGIL  301
            + + R S G  G +  G F +++F S +   +F+  TLS+ +T++    +D +DL     
Sbjct  2    AVSSRGSRG--GSTLRGFFSYRIFISAMFSLLFI-ATLSVLFTTNPSTENDISDLPTT--  56

Query  302  HDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVF  481
                G   V+R+ LALKSDPL+ R DLI +QA+DH +L  AYA+YARKLKL+ S+ +++F
Sbjct  57   ----GNAYVQRTFLALKSDPLRTRVDLIHQQAKDHISLVNAYAAYARKLKLDISRQLKMF  112

Query  482  AELSRNYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDN  658
             EL+ N++D+  KP YRA LFE D   LDE VLRQFEKEVK+R+K+ R ++ EAKE++D 
Sbjct  113  DELAGNFSDIALKPTYRASLFESDG-LLDEDVLRQFEKEVKDRVKIARMMIVEAKENYDT  171

Query  659  QLKIQKLKDTIFAVND  706
            QLKIQKLKDTIFAVN+
Sbjct  172  QLKIQKLKDTIFAVNE  187



>ref|XP_009378304.1| PREDICTED: probable galacturonosyltransferase 9 [Pyrus x bretschneideri]
Length=561

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 124/174 (71%), Gaps = 5/174 (3%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +F+  TLS+  T+  +P+  +        G G +RR+ LAL SDPLK
Sbjct  24   FSYRIFVSAMFSLLFI-ATLSVILTT--NPSTPHPDSALPTTGNGYMRRTFLALNSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-ALFE  544
             R DLI KQA DH  L  AYA+YARKLKLE S+ +R+F +L+ N++DL  KP YR ALFE
Sbjct  81   TRLDLIYKQANDHVTLVNAYAAYARKLKLEISRQMRMFDDLASNFSDLQMKPGYRTALFE  140

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             D   LDE VLR FEKEVK+++K+ R ++AE+KE++DNQLKIQKLKDTIFAVN+
Sbjct  141  SDG-PLDEDVLRHFEKEVKDKVKIARLMIAESKENYDNQLKIQKLKDTIFAVNE  193



>ref|XP_007032945.1| Glycosyltransferase isoform 3 [Theobroma cacao]
 gb|EOY03871.1| Glycosyltransferase isoform 3 [Theobroma cacao]
Length=465

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 125/174 (72%), Gaps = 5/174 (3%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +F+  TLS+  TS   P+  +      + G   + R+ LAL SDPLK
Sbjct  24   FSYRIFVSAMFSLLFV-ATLSVLLTSH--PSTTHHHSRLPSGGNAYMHRTFLALNSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH  L  AY++YARKLKLE S+ +++F +L++N++DL SKP+Y++ LFE
Sbjct  81   TRLDLIHKQANDHITLVKAYSAYARKLKLEISRQLKMFDDLAKNFSDLTSKPSYKSSLFE  140

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
               N LDE VLRQFEKEVK+R+K  R ++AE+KE++DNQLKIQKLKDTIFAVN+
Sbjct  141  TSGN-LDEDVLRQFEKEVKDRVKFARLLIAESKENYDNQLKIQKLKDTIFAVNE  193



>ref|XP_004304175.1| PREDICTED: probable galacturonosyltransferase 9 [Fragaria vesca 
subsp. vesca]
Length=542

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 126/192 (66%), Gaps = 13/192 (7%)
 Frame = +2

Query  146  RTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDA----Y  313
            R   G  G S    F +++F S +   +F+     L  T+ S P        HD+     
Sbjct  9    RAGSGFGGFSLRSFFSYRIFVSAMFSLLFIATLSVLLTTNPSTPH-------HDSALPTT  61

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G   +RRS LAL SDPLK R DLI KQA DH  L  AYA+YARKLKLE S+ +++F +L+
Sbjct  62   GNTYMRRSFLALNSDPLKTRLDLIYKQANDHVTLVNAYAAYARKLKLEISRQMKMFDDLA  121

Query  494  RNYTDLISKPAYR-ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
             N+++L +KP+YR +LFE D   LDE VLRQFEKEVK+++K  R ++ E+KE++DNQLKI
Sbjct  122  SNFSELQTKPSYRTSLFESDG-PLDEDVLRQFEKEVKDKVKTARLMITESKENYDNQLKI  180

Query  671  QKLKDTIFAVND  706
            QKLKDTIFAVN+
Sbjct  181  QKLKDTIFAVNE  192



>emb|CDP02368.1| unnamed protein product [Coffea canephora]
Length=565

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  TLS+ ++S     D +  ++  + G   V+R+ LAL SDPLK
Sbjct  27   FSYRVFVSAMFTLLFL-ATLSVLFSSHPSHHDDDDSVILTS-GNAYVQRTFLALNSDPLK  84

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-ALFE  544
             R D+I +QA DH AL  AYA+YAR LKLE SK +++F +L+ N+ +L  KP YR ALFE
Sbjct  85   TRVDMIYRQANDHIALVNAYAAYARNLKLEISKQLKMFDDLANNFAELQLKPNYRNALFE  144

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             D   +DE VLRQFEKEVK++IKV R ++AE+KES+DNQLKIQKLKDTIFAVN+
Sbjct  145  SDG-PIDEDVLRQFEKEVKDKIKVARSMIAESKESYDNQLKIQKLKDTIFAVNE  197



>ref|XP_010029444.1| PREDICTED: probable galacturonosyltransferase 9 [Eucalyptus grandis]
 gb|KCW56357.1| hypothetical protein EUGRSUZ_I02091 [Eucalyptus grandis]
Length=554

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 123/174 (71%), Gaps = 12/174 (7%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  T+S+ ++S  D      G +H          ++LAL SDPLK
Sbjct  24   FSYRIFVSAVFSLLFL-ATVSVLFSSRHDSTPTEKGYVH---------HTILALNSDPLK  73

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH  L  AYA+YARKLKLE S+ +R+F +L++N++DL  KP YRA LFE
Sbjct  74   TRVDLIYKQANDHVTLVNAYAAYARKLKLEISRQLRMFDDLAKNFSDLPMKPNYRASLFE  133

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             +  ++DE VLRQFEKEVK+R+K  R ++AEAKE++DNQ+KIQKLKDTIFAV+D
Sbjct  134  PEG-AVDEDVLRQFEKEVKDRVKFARLMIAEAKENYDNQMKIQKLKDTIFAVHD  186



>ref|XP_007032943.1| Glycosyltransferase isoform 1 [Theobroma cacao]
 gb|EOY03869.1| Glycosyltransferase isoform 1 [Theobroma cacao]
Length=554

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 125/174 (72%), Gaps = 5/174 (3%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +F+  TLS+  TS   P+  +      + G   + R+ LAL SDPLK
Sbjct  24   FSYRIFVSAMFSLLFV-ATLSVLLTSH--PSTTHHHSRLPSGGNAYMHRTFLALNSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH  L  AY++YARKLKLE S+ +++F +L++N++DL SKP+Y++ LFE
Sbjct  81   TRLDLIHKQANDHITLVKAYSAYARKLKLEISRQLKMFDDLAKNFSDLTSKPSYKSSLFE  140

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
               N LDE VLRQFEKEVK+R+K  R ++AE+KE++DNQLKIQKLKDTIFAVN+
Sbjct  141  TSGN-LDEDVLRQFEKEVKDRVKFARLLIAESKENYDNQLKIQKLKDTIFAVNE  193



>ref|XP_012088081.1| PREDICTED: probable galacturonosyltransferase 9 [Jatropha curcas]
 gb|KDP24309.1| hypothetical protein JCGZ_25605 [Jatropha curcas]
Length=562

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 127/176 (72%), Gaps = 9/176 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSS--SDPADLNVGILHDAYGVGPVRRSVLALKSDP  361
            F +++  S +   +FL  TLS+  T+   + P D ++    +AY    V+R+ LAL SDP
Sbjct  25   FSYRILVSAMFTLLFL-ATLSVLLTTHPPTSPHDSSLPSTGNAY----VQRTFLALNSDP  79

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-L  538
             K R DLI KQA DH  L  AYA+YARKLKL+ S+ +R+F +L++N++D+ +KP Y++ L
Sbjct  80   FKTRLDLIYKQASDHMTLVNAYAAYARKLKLDISRQLRMFDDLAKNFSDITAKPNYKSSL  139

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            FE    ++DE VLRQFEKEVKER+K+ R ++AEAKES+DNQ+KIQKLKDTIFAVN+
Sbjct  140  FE-SEGAVDEDVLRQFEKEVKERVKIARLMIAEAKESYDNQIKIQKLKDTIFAVNE  194



>gb|KJB10519.1| hypothetical protein B456_001G205700 [Gossypium raimondii]
Length=557

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 7/173 (4%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S L   +F+  T+S+  TS   P   +  +   A     + R+ LAL SDPLK
Sbjct  24   FSYRIFISALFSLLFI-ATVSVLLTSRPPPTHHHSRLPSGANAY--MHRTFLALNSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L   YA+YARKLKLENSK +++F +L++N++DL SKP+   LFE 
Sbjct  81   TRLDLIYKQANDHITLVKTYAAYARKLKLENSKQLKMFDDLAKNFSDLTSKPS---LFET  137

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            D N LDE VLRQFEKEVK+R+K  R +VAE+KE++DNQLKIQKLKDTIF+V++
Sbjct  138  DGN-LDEDVLRQFEKEVKDRMKFARLMVAESKENYDNQLKIQKLKDTIFSVSE  189



>ref|XP_010908797.1| PREDICTED: galacturonosyltransferase 8-like [Elaeis guineensis]
Length=557

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 123/161 (76%), Gaps = 5/161 (3%)
 Frame = +2

Query  233  LFLTLSLRYTSSSDPADLNVGILHDAY--GVGPVRRSVLALKSDPLKPRFDLIRKQAEDH  406
            LFL  +  ++S++   D    I  D Y  G+  +RRSVLA++SDPL+ R +LIRKQA DH
Sbjct  33   LFLLPTTTFSSTAAATDGATEISSDPYFSGIPSIRRSVLAVRSDPLRERANLIRKQASDH  92

Query  407  ralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQF  586
             A+A AYASYARKLKLENSK VR+FAELSRN++ L+   A+R L +  +  LDE+ L +F
Sbjct  93   AAVAAAYASYARKLKLENSKQVRLFAELSRNFSALLV--AHRPLLD-TAAPLDEAGLFRF  149

Query  587  EKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            E+E+K+RI+  RQ++A+AK++FDNQLKIQKLKDTIFAVN+Q
Sbjct  150  ERELKDRIRAARQLIADAKDAFDNQLKIQKLKDTIFAVNEQ  190



>ref|XP_011085570.1| PREDICTED: probable galacturonosyltransferase 9 [Sesamum indicum]
Length=557

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 124/174 (71%), Gaps = 7/174 (4%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  TLS+  +S     D  V    +A G   VRRS LA +SDP+K
Sbjct  22   FSYRIFVSAMFTLLFL-ATLSVLLSSHPSHKDAVV----EAAGNAHVRRSFLAWQSDPVK  76

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-ALFE  544
             R +LI  QA +H AL  AYA+YARKLKLE SK +++F +L++N+ DL  K  YR ALFE
Sbjct  77   TRLELIHNQANNHIALVNAYATYARKLKLEISKQLKMFDDLAKNFLDLQLKQTYRTALFE  136

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             +  ++DE VLRQFEKEVK+++K+ R ++AEAKES+DNQLKIQKLKDTIFAVN+
Sbjct  137  TEG-AVDEDVLRQFEKEVKDKVKIARSMIAEAKESYDNQLKIQKLKDTIFAVNE  189



>ref|XP_008230332.1| PREDICTED: probable galacturonosyltransferase 9 [Prunus mume]
Length=562

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 9/176 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTS--SSDPADLNVGILHDAYGVGPVRRSVLALKSDP  361
            F +++F S +   +F+  TLS+ +T+  S+   D  +    +AY    +RR+ LAL SDP
Sbjct  25   FSYRIFVSAMFSLLFI-ATLSVLFTTNPSTPHHDSALPTTGNAY----MRRTFLALNSDP  79

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-AL  538
            LK R DLI KQA DH  L  AYA+YARKLKLE S+ +R+F +L+ N++DL  KP+YR AL
Sbjct  80   LKTRLDLIYKQANDHVTLVNAYAAYARKLKLEISRQMRMFDDLASNFSDLQMKPSYRSAL  139

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            F  D   LDE VLR FEKE+K+++KV R ++AE+KE++DNQLKIQKLKDTIFAVN+
Sbjct  140  FGSDG-PLDEDVLRHFEKEIKDKVKVARLMIAESKENYDNQLKIQKLKDTIFAVNE  194



>ref|XP_010100891.1| putative galacturonosyltransferase 9 [Morus notabilis]
 gb|EXB85815.1| putative galacturonosyltransferase 9 [Morus notabilis]
Length=612

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 119/174 (68%), Gaps = 10/174 (6%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F+  +F S+L IA    L  +  YT   D A    G   +AY    V R+ LALKSDPLK
Sbjct  31   FVSAMF-SLLFIATLSVLLSTNPYTPHHDSALPTTG---NAY----VHRTFLALKSDPLK  82

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-ALFE  544
             R DLI KQA DH  L  +YA+YARKLKLE SK +R+F +L+   +DL  KP YR +LFE
Sbjct  83   TRLDLIYKQANDHMTLVNSYAAYARKLKLEISKQLRMFNDLASEISDLQMKPGYRTSLFE  142

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             D   +DE VLRQFEKEVK+++K  R +VAE+KE++DNQLKIQKLKDTIFAVN+
Sbjct  143  SDG-PVDEDVLRQFEKEVKDKVKTARAMVAESKENYDNQLKIQKLKDTIFAVNE  195



>ref|XP_007215330.1| hypothetical protein PRUPE_ppa005253mg [Prunus persica]
 gb|EMJ16529.1| hypothetical protein PRUPE_ppa005253mg [Prunus persica]
Length=470

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 9/176 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTS--SSDPADLNVGILHDAYGVGPVRRSVLALKSDP  361
            F +++F S +   +F+  TLS+ +T+  S+   D  +    +AY    +RR+ LAL SDP
Sbjct  25   FSYRIFVSAMFSLLFI-ATLSVLFTTNPSTPHHDSALPTTGNAY----MRRTFLALNSDP  79

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-AL  538
            LK R DLI KQA DH  L  AYA+YARKLKLE S+ +R+F +L+ N ++L  KP+YR AL
Sbjct  80   LKTRLDLIYKQANDHVTLVNAYAAYARKLKLEISRQMRMFDDLASNISNLQMKPSYRSAL  139

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            FE D   LDE VLR FEKE+K+++KV R ++AE+KE++DNQLKIQKLKDTIFAVN+
Sbjct  140  FESDG-PLDEDVLRHFEKEIKDKVKVARLMIAESKENYDNQLKIQKLKDTIFAVNE  194



>ref|XP_007032944.1| Glycosyltransferase isoform 2 [Theobroma cacao]
 gb|EOY03870.1| Glycosyltransferase isoform 2 [Theobroma cacao]
Length=488

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +2

Query  326  VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYT  505
            + R+ LAL SDPLK R DLI KQA DH  L  AY++YARKLKLE S+ +++F +L++N++
Sbjct  1    MHRTFLALNSDPLKTRLDLIHKQANDHITLVKAYSAYARKLKLEISRQLKMFDDLAKNFS  60

Query  506  DLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLK  682
            DL SKP+Y++ LFE   N LDE VLRQFEKEVK+R+K  R ++AE+KE++DNQLKIQKLK
Sbjct  61   DLTSKPSYKSSLFETSGN-LDEDVLRQFEKEVKDRVKFARLLIAESKENYDNQLKIQKLK  119

Query  683  DTIFAVND  706
            DTIFAVN+
Sbjct  120  DTIFAVNE  127



>ref|XP_004137150.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis sativus]
 gb|KGN53749.1| hypothetical protein Csa_4G119780 [Cucumis sativus]
Length=550

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 136/205 (66%), Gaps = 16/205 (8%)
 Frame = +2

Query  101  MAIAPTVRSYRSATDRTSGGLFGRSAAGRFIFKLFASVLTIAVFLFLTLSLRYTS--SSD  274
            MA+A  VR  R A++ +     G +    F +++F S L   +F+  TLS+ +T+  S+ 
Sbjct  1    MAVA--VRGSRGASNFS-----GFNPRNFFSYRIFISALFSLLFI-ATLSVIFTTNPSTP  52

Query  275  PADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklkl  454
              D  +    +AY    VRR+ L L SDPLK R DLI KQA DH  L  AYA+YARKLKL
Sbjct  53   HHDSALPTTGNAY----VRRTFLTLNSDPLKTRLDLIYKQASDHITLVNAYAAYARKLKL  108

Query  455  ENSKLVRVFAELSRNYTDLISKPAYR-ALFELDSNSLDESVLRQFEKEVKERIKVTRQVV  631
            E SK +++F +L++N++D+  KP Y   LFE  +  LDE VLRQFEKEVK+R+K  R ++
Sbjct  109  EMSKQLKMFDDLAQNFSDIQMKPNYHETLFE-STGPLDEDVLRQFEKEVKDRVKTARMMI  167

Query  632  AEAKESFDNQLKIQKLKDTIFAVND  706
             ++KE++DNQLKIQKLKDTIFAVN+
Sbjct  168  VDSKENYDNQLKIQKLKDTIFAVNE  192



>ref|XP_009603685.1| PREDICTED: probable galacturonosyltransferase 9 [Nicotiana tomentosiformis]
Length=547

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 121/174 (70%), Gaps = 13/174 (7%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  TLS+ ++S  D             G   V RS +AL SDPLK
Sbjct  19   FSYRIFVSAMFTLLFL-ATLSVLFSSHHDSTT----------GNAYVHRSFVALSSDPLK  67

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH AL  AYA+YARKLKL+ SK +++F +L +N++DL SKP YRA LF+
Sbjct  68   TRLDLIHKQANDHIALVNAYAAYARKLKLDISKQLKMFEDLVQNFSDLQSKPNYRANLFD  127

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             D   LD+  L+QFEKEVK+++K  R ++A++KES+DNQLKIQKLKDTIFAVN+
Sbjct  128  TDG-PLDDDSLKQFEKEVKDKVKFARLLIADSKESYDNQLKIQKLKDTIFAVNE  180



>gb|KJB10520.1| hypothetical protein B456_001G205700 [Gossypium raimondii]
Length=491

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 102/127 (80%), Gaps = 4/127 (3%)
 Frame = +2

Query  326  VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYT  505
            + R+ LAL SDPLK R DLI KQA DH  L   YA+YARKLKLENSK +++F +L++N++
Sbjct  1    MHRTFLALNSDPLKTRLDLIYKQANDHITLVKTYAAYARKLKLENSKQLKMFDDLAKNFS  60

Query  506  DLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKD  685
            DL SKP+   LFE D N LDE VLRQFEKEVK+R+K  R +VAE+KE++DNQLKIQKLKD
Sbjct  61   DLTSKPS---LFETDGN-LDEDVLRQFEKEVKDRMKFARLMVAESKENYDNQLKIQKLKD  116

Query  686  TIFAVND  706
            TIF+V++
Sbjct  117  TIFSVSE  123



>ref|XP_009373741.1| PREDICTED: probable galacturonosyltransferase 9 [Pyrus x bretschneideri]
Length=562

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 122/175 (70%), Gaps = 7/175 (4%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFL-FLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPL  364
            F +++F S +   +F+  L++ L    S+   D  +    +AY    +RR+ LAL SDPL
Sbjct  25   FSYRIFVSAMFSLLFIATLSVILTTNPSTPHHDSALPTTGNAY----MRRTFLALNSDPL  80

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-ALF  541
            K R DLI KQA DH  L  AYA+YARKLKLE S+ +R+F +L+ N++D+  KP YR ALF
Sbjct  81   KTRLDLIYKQANDHVTLVNAYAAYARKLKLEISRQMRMFDDLASNFSDVQMKPGYRTALF  140

Query  542  ELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            E D   LDE VLR FEKEVK+++K+ R ++ E+KE++DNQLKIQKLKDTIFAVN+
Sbjct  141  ESDG-PLDEDVLRHFEKEVKDKVKIARLMIGESKENYDNQLKIQKLKDTIFAVNE  194



>ref|XP_009792003.1| PREDICTED: probable galacturonosyltransferase 9 [Nicotiana sylvestris]
Length=547

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 122/174 (70%), Gaps = 13/174 (7%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  TLS+ ++S  D             G   + RS +AL SDPLK
Sbjct  19   FSYRIFVSAMFTLLFL-ATLSVLFSSHHDYTT----------GNAYMHRSFVALSSDPLK  67

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH AL  AYA+YARKLKL+ SK +++F +L++N++DL SKP YRA LF+
Sbjct  68   TRLDLIHKQANDHIALVNAYAAYARKLKLDISKQLKMFEDLAQNFSDLQSKPNYRANLFD  127

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             D   LD+  L+QFEKEVK+++K  R ++A++KES+DNQLKIQKLKDTIFAVN+
Sbjct  128  TDG-PLDDDSLKQFEKEVKDKVKFARLLIADSKESYDNQLKIQKLKDTIFAVNE  180



>gb|EYU39355.1| hypothetical protein MIMGU_mgv1a003891mg [Erythranthe guttata]
Length=557

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 122/174 (70%), Gaps = 7/174 (4%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +K+F S +   +FL  TLS+  +S     D     + D  G   VRR+ LA +SDPLK
Sbjct  22   FSYKIFVSAMFTLLFL-ATLSVLLSSHQSHND----AVMDTTGNTHVRRTFLAWQSDPLK  76

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R D+I  QA +H AL  AYA+YARKLKLE SK +++F +L+ N++DL  +  YRA LFE
Sbjct  77   TRLDMIYNQANNHIALVNAYATYARKLKLEISKQLKMFDDLASNFSDLQLRQTYRAALFE  136

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             +   +DE VLRQFEKEVK+++K+ R ++AE+KES+DNQLKIQKLKDTIFAVN+
Sbjct  137  ANG-PVDEDVLRQFEKEVKDKVKIARLMIAESKESYDNQLKIQKLKDTIFAVNE  189



>ref|XP_010549955.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549956.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549957.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
Length=557

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 122/179 (68%), Gaps = 11/179 (6%)
 Frame = +2

Query  182  GRFIFKLFASVLTIAVFLFLTLSLRYTSS---SDPADLNVGILHDAYGVGPVRRSVLALK  352
            G F +++F S +   +FL  T S+   SS    DP   N G    AY    + R+ LAL+
Sbjct  19   GLFSYRIFVSAMFSLLFL-ATFSVVLNSSRQHQDPTLPNTG---SAY----MHRTFLALQ  70

Query  353  SDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR  532
            SDPLK R DLI KQA DH  L  AYA+YARKLK++ SK +++F +L+ N++DL SKP  +
Sbjct  71   SDPLKTRVDLIHKQATDHLTLVNAYAAYARKLKVDASKQLKLFEDLAINFSDLQSKPGLK  130

Query  533  ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            ++   + N+++E  LRQ EKEVK+++K  R ++AE+KES+D QLKIQKLKDTIFAV++Q
Sbjct  131  SVLSENGNAVEEDTLRQVEKEVKDKVKTARMMIAESKESYDTQLKIQKLKDTIFAVHEQ  189



>ref|XP_010549958.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Tarenaya 
hassleriana]
 gb|ABD96860.1| hypothetical protein [Cleome spinosa]
Length=556

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 122/179 (68%), Gaps = 11/179 (6%)
 Frame = +2

Query  182  GRFIFKLFASVLTIAVFLFLTLSLRYTSS---SDPADLNVGILHDAYGVGPVRRSVLALK  352
            G F +++F S +   +FL  T S+   SS    DP   N G    AY    + R+ LAL+
Sbjct  19   GLFSYRIFVSAMFSLLFL-ATFSVVLNSSRQHQDPTLPNTG---SAY----MHRTFLALQ  70

Query  353  SDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR  532
            SDPLK R DLI KQA DH  L  AYA+YARKLK++ SK +++F +L+ N++DL SKP  +
Sbjct  71   SDPLKTRVDLIHKQATDHLTLVNAYAAYARKLKVDASKQLKLFEDLAINFSDLQSKPGLK  130

Query  533  ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            ++   + N+++E  LRQ EKEVK+++K  R ++AE+KES+D QLKIQKLKDTIFAV++Q
Sbjct  131  SVLSENGNAVEEDTLRQVEKEVKDKVKTARMMIAESKESYDTQLKIQKLKDTIFAVHEQ  189



>gb|AID53187.1| galacturonosyltransferase 8-like protein [Dendrobium catenatum]
Length=551

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 122/174 (70%), Gaps = 7/174 (4%)
 Frame = +2

Query  191  IFKLFASV-LTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            +F L  S+ LTI  FLF   S   T+       +  + H   GV   RR++L+ KSDP++
Sbjct  18   VFALIISIALTICAFLFFPCS---TAGGGATTFSASLDHYFLGVPVPRRNLLSFKSDPIR  74

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R D IRKQA DH ALA AYASYARKLKLENSK +R+FA++SRN + L+S   +R L + 
Sbjct  75   LRIDQIRKQATDHAALASAYASYARKLKLENSKQLRLFADVSRNLSLLLSD--HRHLLD-  131

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             SN +DES +R+ +++VK+RI+  R ++ +AKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  132  PSNPIDESAIRRLDRKVKDRIRAARSLITDAKESFDNQLKIQKLKDTIFAVNEQ  185



>ref|XP_006338312.1| PREDICTED: probable galacturonosyltransferase 9-like [Solanum 
tuberosum]
Length=547

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 131/186 (70%), Gaps = 14/186 (8%)
 Frame = +2

Query  155  GGLFGRSAAGRFI-FKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVR  331
            GG  G SA   F  +++F S +   +FL  TLS+ ++S  D     +G   +AY    + 
Sbjct  7    GGRGGGSALRNFFSYRIFVSAMFTLLFL-ATLSVLFSSHHDST---IG---NAY----LH  55

Query  332  RSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDL  511
            RS+++L SDPLK R DLI KQA DH AL  AYA+YARKLKLE +K +++F +L++N++DL
Sbjct  56   RSLVSLSSDPLKTRLDLIHKQANDHVALVNAYAAYARKLKLEIAKQLKMFEDLAQNFSDL  115

Query  512  ISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
             SK  YR+ LF+ D   LD+  L+QFEKEVK+++K  R ++A++KES+DNQLKIQKLKDT
Sbjct  116  QSKQNYRSNLFDTDG-PLDDDSLKQFEKEVKDKVKFARLLIADSKESYDNQLKIQKLKDT  174

Query  689  IFAVND  706
            IFAVN+
Sbjct  175  IFAVNE  180



>ref|XP_011012259.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
Length=562

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 4/174 (2%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  T S+ ++S       +   L  + G   V+R+ LA+KSDPLK
Sbjct  24   FSYRIFISAIFTLLFL-ATFSILFSSQHHHHHHDDDSLPSS-GNAYVQRTFLAVKSDPLK  81

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH  L  AYA+YARKLKL+ SK +R+F EL++N TDL  KP+Y++ LFE
Sbjct  82   TRLDLIYKQANDHMTLVNAYAAYARKLKLDISKQLRMFDELAKNLTDLPLKPSYKSSLFE  141

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
              S  +DE VLRQFEKEVK+ +KV R ++ E+KES+DNQ+KIQKLKDTIFAVN+
Sbjct  142  PGS-LVDEDVLRQFEKEVKDIVKVARLMIVESKESYDNQIKIQKLKDTIFAVNE  194



>ref|XP_008341825.1| PREDICTED: probable galacturonosyltransferase 9 [Malus domestica]
Length=562

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 120/175 (69%), Gaps = 7/175 (4%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFL-FLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPL  364
            F +++F S +   +F+  L++ L    S+   D  +    +AY    +RR+ LAL SDPL
Sbjct  25   FSYRIFVSAMFSLLFIATLSVILTTNPSTPHHDSALPTTGNAY----MRRTFLALNSDPL  80

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR-ALF  541
            K R DLI KQA DH  L  AYA+YARKLKLE S+ +R+F +L+ N++DL  KP YR ALF
Sbjct  81   KTRLDLIYKQANDHVTLVNAYAAYARKLKLEISRQMRMFDDLASNFSDLQMKPGYRTALF  140

Query  542  ELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            E D   LDE VLR FEKEVK++ K  R ++ E+KE++DNQLKIQKLKDTIFAVN+
Sbjct  141  ESDG-PLDEDVLRHFEKEVKDKXKFARLMIGESKENYDNQLKIQKLKDTIFAVNE  194



>ref|XP_006384242.1| hypothetical protein POPTR_0004s10980g [Populus trichocarpa]
 gb|ERP62039.1| hypothetical protein POPTR_0004s10980g [Populus trichocarpa]
Length=562

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  T S+ ++S           L  + G   V+R+ LA+KSDPLK
Sbjct  24   FSYRIFISAIFTLLFL-ATFSILFSSHHHHHHHEDDSLPSS-GNAYVQRTFLAVKSDPLK  81

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH  L  AYA+YARKLKL+ SK +R+F EL++N TDL  KP+Y++ LFE
Sbjct  82   TRLDLIYKQANDHMTLVNAYAAYARKLKLDISKQLRMFDELAKNLTDLPLKPSYKSSLFE  141

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
              S  +DE VLRQFEKEVK+ +KV R ++ E+KES+DNQ+KIQKLKDTIFAVN+
Sbjct  142  PGS-PVDEDVLRQFEKEVKDIVKVARLMIVESKESYDNQIKIQKLKDTIFAVNE  194



>gb|KHG26626.1| putative galacturonosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=559

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (69%), Gaps = 10/176 (6%)
 Frame = +2

Query  182  GRFIFKLFASVLTIAVFL---FLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALK  352
            G F +++F S +   +F+    + L+ R +++   +    G      G   + R+ +AL 
Sbjct  22   GFFSYRIFVSAMFSLLFIATATVLLTTRPSTTHQHSRFRSG------GNAYMHRTFVALN  75

Query  353  SDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYR  532
            SDPLK R DLI +QA DH  L  AYA+YARKLKL+ S+ +++F +L++N++D+ SKP   
Sbjct  76   SDPLKTRLDLIYRQANDHITLVKAYAAYARKLKLDISRQLKMFDDLAKNFSDITSKPYKS  135

Query  533  ALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAV  700
            +LFE D N LDE VLRQFEKEVK+R+K  R ++AE+KE++DNQLKIQKLKDTIFAV
Sbjct  136  SLFETDGN-LDEDVLRQFEKEVKDRVKFARLLIAESKENYDNQLKIQKLKDTIFAV  190



>ref|XP_008803497.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8-like 
[Phoenix dactylifera]
Length=556

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = +2

Query  206  ASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAY--GVGPVRRSVLALKSDPLKPRFD  379
            AS+   A  LFL LS    SSS  AD    I  D Y  G+  +RRSVLA++S+P++ R  
Sbjct  24   ASLFFAAAVLFL-LSTTTPSSSAAADGATEISSDPYFSGIPLLRRSVLAVRSEPVRERAK  82

Query  380  LIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELDSNS  559
            LIRKQ  DH ALA AYASYARKLKLENSK VR+FAELSRN++ L++  A+R L +  + S
Sbjct  83   LIRKQTGDHAALAAAYASYARKLKLENSKQVRLFAELSRNFSALLA--AHRPLLD-PAAS  139

Query  560  LDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            LDE  L +FE+EVK+RI+  R ++++AK++F+NQLKIQ+LKDTIFAVN+Q
Sbjct  140  LDEVALLRFEREVKDRIRAARLLISDAKDAFNNQLKIQRLKDTIFAVNEQ  189



>ref|XP_009379995.1| PREDICTED: galacturonosyltransferase 8-like [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 131/187 (70%), Gaps = 13/187 (7%)
 Frame = +2

Query  170  RSAAGRFIFKLFASVLTIAV-FLFLTLSLRYTSSSDPADLNVGILH----DAY--GVGPV  328
            R+AA R   + F  +L ++V  +FL LSL  T+       + G+L     D Y  G+  V
Sbjct  10   RNAAIR---RFFVVLLAVSVAIIFLILSLTDTAPEVSGKEDEGLLSLPPSDLYSSGLHFV  66

Query  329  RRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTD  508
            RRSVLA++SDPL+ R +LIRKQ  DH A+A AYAS+AR+LKLE+SK  R+FAEL+RN + 
Sbjct  67   RRSVLAVRSDPLRSRAELIRKQVGDHAAVAGAYASFARRLKLESSKQARLFAELARNLSL  126

Query  509  LISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
            L++  A+R   E  +  LDE+ +R FE+ VK+RI+  R ++A+AKESFDNQLKIQKLKDT
Sbjct  127  LLA--AHRPFLE-SAAPLDEATVRGFERGVKDRIRAARLLIADAKESFDNQLKIQKLKDT  183

Query  689  IFAVNDQ  709
            IFAVN+Q
Sbjct  184  IFAVNEQ  190



>ref|XP_008778166.1| PREDICTED: galacturonosyltransferase 8-like [Phoenix dactylifera]
Length=559

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 109/132 (83%), Gaps = 3/132 (2%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G+  +RRSVLA++SDPL+ R +LIRKQA DH ALA AYASYARKLKLENSK VR+FAELS
Sbjct  64   GLPLLRRSVLAVRSDPLRERANLIRKQAGDHAALAAAYASYARKLKLENSKQVRLFAELS  123

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
            +N++ L+   A R L +  +  LDE+ LR+FE EVK+RI+ +RQ++ +AK++FDNQLKIQ
Sbjct  124  QNFSALLG--AARPLLD-PAAPLDEASLRRFEHEVKDRIRASRQLITDAKDAFDNQLKIQ  180

Query  674  KLKDTIFAVNDQ  709
            KLKDTIFAVN+Q
Sbjct  181  KLKDTIFAVNEQ  192



>gb|KJB48243.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
 gb|KJB48244.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
Length=560

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 103/130 (79%), Gaps = 2/130 (2%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G   + R+ +AL SDPLK R DLI +QA DH  L  AYA+YARKLKL+ S+ +++F +L+
Sbjct  63   GNAYMHRTFVALNSDPLKTRLDLIYRQANDHITLVKAYAAYARKLKLDISRQLKMFDDLA  122

Query  494  RNYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
            +N++D+ SKP Y++ LFE D N LDE VLRQFEKEVK+R+K  R ++AE+KE++DNQLKI
Sbjct  123  KNFSDITSKPRYKSSLFETDGN-LDEDVLRQFEKEVKDRVKFARLLIAESKENYDNQLKI  181

Query  671  QKLKDTIFAV  700
            QKLKDTIFAV
Sbjct  182  QKLKDTIFAV  191



>ref|XP_010913084.1| PREDICTED: galacturonosyltransferase 8 [Elaeis guineensis]
Length=557

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 106/128 (83%), Gaps = 3/128 (2%)
 Frame = +2

Query  326  VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYT  505
            +RRSVLA++SDPL+ R +LIRKQA DH ALA AYASYARKLKLENSK VR+FAE+SRN++
Sbjct  66   IRRSVLAVRSDPLRERANLIRKQAGDHAALAAAYASYARKLKLENSKQVRLFAEVSRNFS  125

Query  506  DLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKD  685
             L++  + R L +  +  LD+S LR FE EVK+RI+  RQ++ +AK++FDNQLKIQKLKD
Sbjct  126  ALLA--SARPLLD-PATPLDDSSLRHFEHEVKDRIRAARQLITDAKDAFDNQLKIQKLKD  182

Query  686  TIFAVNDQ  709
            TIFAVN+Q
Sbjct  183  TIFAVNEQ  190



>gb|KJB48245.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
Length=494

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 102/126 (81%), Gaps = 2/126 (2%)
 Frame = +2

Query  326  VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYT  505
            + R+ +AL SDPLK R DLI +QA DH  L  AYA+YARKLKL+ S+ +++F +L++N++
Sbjct  1    MHRTFVALNSDPLKTRLDLIYRQANDHITLVKAYAAYARKLKLDISRQLKMFDDLAKNFS  60

Query  506  DLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLK  682
            D+ SKP Y++ LFE D N LDE VLRQFEKEVK+R+K  R ++AE+KE++DNQLKIQKLK
Sbjct  61   DITSKPRYKSSLFETDGN-LDEDVLRQFEKEVKDRVKFARLLIAESKENYDNQLKIQKLK  119

Query  683  DTIFAV  700
            DTIFAV
Sbjct  120  DTIFAV  125



>ref|XP_004232120.1| PREDICTED: probable galacturonosyltransferase 9 [Solanum lycopersicum]
Length=547

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 125/174 (72%), Gaps = 13/174 (7%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            F +++F S +   +FL  TLS+ ++S  D     +G   +AY    + RS++++ SDPLK
Sbjct  19   FSYRIFVSAMFTLLFL-ATLSVLFSSHHDST---IG---NAY----LHRSLVSINSDPLK  67

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA-LFE  544
             R DLI KQA DH AL  AY +YARKLKLE +K +++F +L++N++DL SK  YR+ LF+
Sbjct  68   TRLDLIHKQANDHIALVNAYTAYARKLKLEIAKQLKMFEDLAQNFSDLQSKQNYRSNLFD  127

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             D   LD+  L+QFEKEVK+++K  R ++A++KES+DNQLKIQKLKDTIFAVN+
Sbjct  128  TDG-PLDDDSLKQFEKEVKDKVKFARLLIADSKESYDNQLKIQKLKDTIFAVNE  180



>ref|XP_009404224.1| PREDICTED: galacturonosyltransferase 8-like [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 127/191 (66%), Gaps = 19/191 (10%)
 Frame = +2

Query  167  GRSAAGRFIFKLFASVLTIAVFLFLTLSLRY----------TSSSDPADLNVGILHDAYG  316
            GR+A  R  F L  +V   A+F+ +  +             +SSS P+DL    LH A  
Sbjct  9    GRNAMIRRFFLLCLAVSVAALFILVPSTTSAPVMTRKEEVGSSSSLPSDLYSSGLHYA--  66

Query  317  VGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
                RRSVLA++SDPL+ R DLIRKQ  DH A+A AYAS+AR+LKLE+SK  R+FAEL+R
Sbjct  67   ----RRSVLAVRSDPLRARADLIRKQVGDHAAVAAAYASFARRLKLESSKQTRLFAELAR  122

Query  497  NYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQK  676
            N + L+   A+R L    +  +DE+ +R FE+ VK+RI+  R ++++AK+SFDNQLKIQK
Sbjct  123  NLSLLVG--AHRTLLH-RAGPIDETAVRGFERGVKDRIRAARLLISDAKDSFDNQLKIQK  179

Query  677  LKDTIFAVNDQ  709
            LKDTIFAVN+Q
Sbjct  180  LKDTIFAVNEQ  190



>ref|XP_010485478.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 9/177 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFL-TLSLRYTSS--SDPADLNVGILHDAYGVGPVRRSVLALKSD  358
            F +++F S L    FLFL T S+   SS    P D  +  + +AY    ++R+ LAL+SD
Sbjct  24   FSYRIFISALF--SFLFLATFSVVLNSSRHQPPQDHTLPSMGNAY----MQRTFLALQSD  77

Query  359  PLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRAL  538
            PLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++ 
Sbjct  78   PLKTRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSS  137

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
               +SN+L+E   R  EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  138  VSDNSNALEEDTFRVLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>ref|XP_010476066.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 9/177 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFL-TLSLRYTSS--SDPADLNVGILHDAYGVGPVRRSVLALKSD  358
            F +++F S L    FLFL T S+   SS    P D  +  + +AY    ++R+ LAL+SD
Sbjct  24   FSYRIFISALF--SFLFLATFSVVLNSSRHQPPQDHTLPSMGNAY----MQRTFLALQSD  77

Query  359  PLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRAL  538
            PLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++ 
Sbjct  78   PLKTRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSS  137

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
               +SN+L+E   R  EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  138  VSDNSNALEEDTFRVLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>emb|CAN73730.1| hypothetical protein VITISV_022574 [Vitis vinifera]
Length=543

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 121/176 (69%), Gaps = 12/176 (7%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAY----GVGPVRRSVLALKSDP  361
            +++FAS L   +F+     L  T+ + P+       HD+     G   ++R+ LALKSDP
Sbjct  23   YRIFASALFTILFIATISVLLNTNPAPPS-------HDSVIPSSGNAYMQRTFLALKSDP  75

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALF  541
            L+ R DLI KQA DH  L  AYA+YARKLKL+ S+ +R+F +L+RN++DL ++P  R   
Sbjct  76   LRTRLDLIHKQANDHITLVNAYAAYARKLKLDISRQLRMFDDLARNFSDLAARPGPRTAP  135

Query  542  ELD-SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            E +   + DE ++RQ EKEVK+R+K+ R ++AE+KES+DNQ+KIQKLKDTIF+VN+
Sbjct  136  EDEVEGTGDEDLVRQLEKEVKDRVKIARLMIAESKESYDNQIKIQKLKDTIFSVNE  191



>ref|XP_010660537.1| PREDICTED: probable galacturonosyltransferase 9 [Vitis vinifera]
 emb|CBI16902.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 121/176 (69%), Gaps = 12/176 (7%)
 Frame = +2

Query  194  FKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAY----GVGPVRRSVLALKSDP  361
            +++FAS L   +F+     L  T+ + P+       HD+     G   ++R+ LALKSDP
Sbjct  23   YRIFASALFTILFIATISVLLNTNPAPPS-------HDSVIPSSGNAYMQRTFLALKSDP  75

Query  362  LKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALF  541
            L+ R DLI KQA DH  L  AYA+YARKLKL+ S+ +R+F +L+RN++DL ++P  R   
Sbjct  76   LRTRLDLIHKQANDHITLVNAYAAYARKLKLDISRQLRMFDDLARNFSDLAARPGPRTAP  135

Query  542  ELD-SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            E +   + DE ++RQ EKEVK+R+K+ R ++AE+KES+DNQ+KIQKLKDTIF+VN+
Sbjct  136  EDEVEGTGDEDLVRQLEKEVKDRVKIARLMIAESKESYDNQIKIQKLKDTIFSVNE  191



>ref|XP_006408424.1| hypothetical protein EUTSA_v10020416mg [Eutrema salsugineum]
 gb|ESQ49877.1| hypothetical protein EUTSA_v10020416mg [Eutrema salsugineum]
Length=561

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            FI  LF S L +A F  +  S R+    D    ++G   +AY    ++R+ LAL+SDPLK
Sbjct  29   FISALF-SFLFLATFSVVLNSSRHQPHQDHTLPSMG---NAY----MQRTFLALQSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++    
Sbjct  81   TRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSAVSE  140

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            + N+L+E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  141  NGNALEEDTFRQLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>ref|XP_010463640.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 119/177 (67%), Gaps = 9/177 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFL-TLSLRYTSS--SDPADLNVGILHDAYGVGPVRRSVLALKSD  358
            F +++F S L    FLFL T S+   SS    P D  +  + +AY    ++R+ LAL+SD
Sbjct  24   FSYRIFISALF--SFLFLATFSVVLNSSRHQPPQDHTLPSMGNAY----MQRTFLALQSD  77

Query  359  PLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRAL  538
            PLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++ 
Sbjct  78   PLKTRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSS  137

Query  539  FELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
               + N+L+E   R  EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  138  VSDNGNALEEDTFRVLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>gb|ABD96904.1| hypothetical protein [Cleome spinosa]
Length=528

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G   + R+ LAL+SDPLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L 
Sbjct  65   GSAYMHRTFLALQSDPLKTRLDLIYKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLG  124

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
             N++DL  KP Y+++   + N+++E  LRQ EKEVK+++K  R ++ E+KES+D QLKIQ
Sbjct  125  INFSDLQYKPDYKSVLSENGNAVEEDTLRQLEKEVKDKVKTVRMMIVESKESYDTQLKIQ  184

Query  674  KLKDTIFAVNDQ  709
            KLKDTIFAV++Q
Sbjct  185  KLKDTIFAVHEQ  196



>ref|XP_002882224.1| hypothetical protein ARALYDRAFT_477468 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58483.1| hypothetical protein ARALYDRAFT_477468 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            FI  LF S L +A F  +  S R+    D    ++G   +AY    ++R+ LAL+SDPLK
Sbjct  29   FISALF-SFLFLATFSVVLNSSRHQPHQDHTLPSMG---NAY----MQRTFLALQSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++    
Sbjct  81   TRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSAVSD  140

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            + N+L+E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  141  NGNALEEDSFRQLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>ref|XP_006297346.1| hypothetical protein CARUB_v10013365mg [Capsella rubella]
 gb|EOA30244.1| hypothetical protein CARUB_v10013365mg [Capsella rubella]
Length=561

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 116/174 (67%), Gaps = 8/174 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            FI  LF S L +A F  +  S R+    D    ++G   +AY    ++R+ LAL+SDPLK
Sbjct  29   FISALF-SFLFLATFSVVLNSSRHQPHQDHTLPSMG---NAY----MQRTFLALQSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++    
Sbjct  81   TRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSAVSD  140

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
              N+L+E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  141  TGNALEEDTFRQLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>ref|XP_010558537.1| PREDICTED: probable galacturonosyltransferase 9 [Tarenaya hassleriana]
Length=564

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G   + R+ LAL+SDPLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L 
Sbjct  65   GSAYMHRTFLALQSDPLKTRLDLIYKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLG  124

Query  494  RNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQ  673
             N++DL  KP Y+++   + N+++E  LRQ EKEVK+++K  R ++ E+KES+D QLKIQ
Sbjct  125  INFSDLQYKPDYKSVLSENGNAVEEDTLRQLEKEVKDKVKTVRMMIVESKESYDTQLKIQ  184

Query  674  KLKDTIFAVNDQ  709
            KLKDTIFAV++Q
Sbjct  185  KLKDTIFAVHEQ  196



>gb|KFK37701.1| hypothetical protein AALP_AA3G017600 [Arabis alpina]
Length=560

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            FI  LF S L +A F     S R+    D    ++G   +AY    ++R+ LAL+SDPLK
Sbjct  28   FISALF-SFLFLATFSVFLNSSRHQPHQDHTLPSMG---NAY----MQRTFLALQSDPLK  79

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++    
Sbjct  80   TRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSAVSE  139

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            D N+L+E   R  EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  140  DGNALEEDTFRLLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  193



>gb|AHL38785.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=561

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            FI  LF S L +A F  +  S R+    D    ++G   +AY    ++R+ LAL+SDPLK
Sbjct  29   FISALF-SFLFLATFSVVLNSSRHQPHQDHTLPSMG---NAY----MQRTFLALQSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++    
Sbjct  81   TRLDLIHKQAIDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSAVSD  140

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            + N+L+E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  141  NGNALEEDSFRQLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>ref|NP_566170.1| putative galacturonosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9FWA4.1|GAUT9_ARATH RecName: Full=Probable galacturonosyltransferase 9 [Arabidopsis 
thaliana]
 gb|AAG12603.1|AC068900_9 unknown protein; 9779-11709 [Arabidopsis thaliana]
 gb|AAL84957.1| AT3g02350/F11A12_103 [Arabidopsis thaliana]
 gb|AAM61096.1| glycosyl transferase, putative [Arabidopsis thaliana]
 gb|AAO42776.1| At3g02350/F11A12_103 [Arabidopsis thaliana]
 gb|AEE73795.1| putative galacturonosyltransferase 9 [Arabidopsis thaliana]
Length=561

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLK  367
            FI  LF S L +A F  +  S R+    D    ++G   +AY    ++R+ LAL+SDPLK
Sbjct  29   FISALF-SFLFLATFSVVLNSSRHQPHQDHTLPSMG---NAY----MQRTFLALQSDPLK  80

Query  368  PRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFEL  547
             R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL SKP  ++    
Sbjct  81   TRLDLIHKQAIDHLTLVNAYAAYARKLKLDASKQLKLFEDLAINFSDLQSKPGLKSAVSD  140

Query  548  DSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            + N+L+E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +Q
Sbjct  141  NGNALEEDSFRQLEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQEQ  194



>ref|XP_009117942.1| PREDICTED: probable galacturonosyltransferase 9 [Brassica rapa]
Length=551

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 122/190 (64%), Gaps = 17/190 (9%)
 Frame = +2

Query  155  GGLFGRSAAGR--FIFKLFASVLTIAVFLFL-TLSLRYTSS--SDPADLNVGILHDAYGV  319
            GG  G  +  R  F +++F S L    FLFL T S+   SS    P D  +    +AY  
Sbjct  7    GGCNGVGSGLRSFFSYRIFISALF--SFLFLATFSVFLNSSRHQPPHDHTLPSGGNAY--  62

Query  320  GPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRN  499
              ++R+ LAL+SDPLK R D+I KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N
Sbjct  63   --MQRTFLALQSDPLKTRLDMIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAIN  120

Query  500  YTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKL  679
            ++DL SKP       L+ N+L+E   R  EKEVK+++K  R ++ E+KES+D QLKIQKL
Sbjct  121  FSDLQSKPG------LNGNALEEDAFRLLEKEVKDKVKTARMMIVESKESYDTQLKIQKL  174

Query  680  KDTIFAVNDQ  709
            +DTIFAV +Q
Sbjct  175  RDTIFAVQEQ  184



>gb|EPS65125.1| glycosyltransferase [Genlisea aurea]
Length=557

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = +2

Query  266  SSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyark  445
            +S P   +  I  D  G G VRR+  AL+SDPLK R +LI + A +H AL  AYA+YARK
Sbjct  45   TSHPPRKHTAI--DPPGSGRVRRTFSALQSDPLKTRLELIHETANNHVALVNAYAAYARK  102

Query  446  lklENSKLVRVFAELSRNYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTR  622
            LKLE SK +++F +L+++++D+  K  YRA LFE + N +DE VLRQFEKEVK+++K+ R
Sbjct  103  LKLEISKQLKMFDDLAQSFSDIQLKENYRAALFETE-NPIDEEVLRQFEKEVKDKVKIAR  161

Query  623  QVVAEAKESFDNQLKIQKLKDTIFAV  700
             +V E KE++DNQLKIQKL+DTIFAV
Sbjct  162  LMVVETKEAYDNQLKIQKLRDTIFAV  187



>emb|CDY34723.1| BnaA01g33020D [Brassica napus]
Length=491

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 101/143 (71%), Gaps = 6/143 (4%)
 Frame = +2

Query  281  DLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklEN  460
            D + GI   + G   ++R+ LAL+SDPLK R D+I KQA DH  L  AYA+YARKLKL+ 
Sbjct  7    DESWGITLPSGGNAYMQRTFLALQSDPLKTRLDMIHKQATDHLTLVNAYAAYARKLKLDA  66

Query  461  SKLVRVFAELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEA  640
            SK +++F +L+ N++DL SKP       L+ N+L+E   R  EKEVK+++K  R ++ E+
Sbjct  67   SKQLKLFEDLAINFSDLQSKPG------LNGNALEEDAFRLLEKEVKDKVKTARMMIVES  120

Query  641  KESFDNQLKIQKLKDTIFAVNDQ  709
            KES+D QLKIQKL+DTIFAV +Q
Sbjct  121  KESYDTQLKIQKLRDTIFAVQEQ  143



>ref|XP_006373520.1| hypothetical protein POPTR_0017s144802g, partial [Populus trichocarpa]
 gb|ERP51317.1| hypothetical protein POPTR_0017s144802g, partial [Populus trichocarpa]
Length=504

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G   V+R+ LA+KSDPLK R DLI KQA DH  L  AYA+YARKLKL+ S+ +R+F EL 
Sbjct  6    GNAYVQRTFLAIKSDPLKTRLDLIYKQANDHMTLVNAYAAYARKLKLDISRQLRMFDELD  65

Query  494  RNYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
            +N TDL  KP+Y++ LFE  S+ +DE VLRQFEKEVKE++KV R ++AEAKES+DNQ+KI
Sbjct  66   KNLTDLPLKPSYKSSLFEPGSD-VDEDVLRQFEKEVKEKVKVARLMIAEAKESYDNQIKI  124

Query  671  QKLKDTIFAVND  706
            QKLKDTIFAVN+
Sbjct  125  QKLKDTIFAVNE  136



>ref|XP_011021133.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021134.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021136.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021137.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021138.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
Length=558

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  314  GVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELS  493
            G   V+R+ LA+KSDPLK R DLI KQA DH  L  AYA+YARKLKL+ S+ +R+F EL 
Sbjct  60   GNAYVQRTFLAIKSDPLKTRLDLIYKQANDHMTLVNAYAAYARKLKLDISRQLRMFDELD  119

Query  494  RNYTDLISKPAYRA-LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKI  670
            +N TDL  KP+Y++ LFE  S+ +DE VLRQFEKEVKE++KV R ++AEAKES+DNQ+KI
Sbjct  120  KNLTDLPLKPSYKSSLFEPGSD-VDEDVLRQFEKEVKEKVKVARLMIAEAKESYDNQIKI  178

Query  671  QKLKDTIFAVND  706
            QKLKDTIFAVN+
Sbjct  179  QKLKDTIFAVNE  190



>ref|XP_002980055.1| Quasimodo1-like protein [Selaginella moellendorffii]
 gb|EFJ18925.1| Quasimodo1-like protein [Selaginella moellendorffii]
Length=541

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +2

Query  323  PVRRSVLALKS--DPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSR  496
            P++R++LAL+S  DPL+ R + + KQA+D  A+  AYA+YAR+ KL+ ++ VR+F + +R
Sbjct  44   PMKRTILALRSRQDPLRARAESLVKQAKDQLAVVNAYAAYARRGKLDVARQVRIFTDQAR  103

Query  497  NYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQK  676
            NYT+L+++P  R L + +  ++D   LR FE++++ER++VTRQ++ ++KE FDNQLKIQK
Sbjct  104  NYTELLARPENRGLIDSNGGAVDPEALRAFERDLRERLRVTRQLMMDSKELFDNQLKIQK  163

Query  677  LKDTIFAVNDQ  709
            LKDTIF VN+Q
Sbjct  164  LKDTIFQVNEQ  174



>ref|XP_002987448.1| Quasimodo1-like protein [Selaginella moellendorffii]
 gb|EFJ11535.1| Quasimodo1-like protein [Selaginella moellendorffii]
Length=497

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +2

Query  326  VRRSVLALKS--DPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRN  499
            ++R++LAL+S  DPL+ R + + KQA+D  A+  AYA+YAR+ KL+ ++ VR+F + +RN
Sbjct  1    MKRTILALRSRQDPLRARAESLVKQAKDQLAVVNAYAAYARRGKLDVARQVRIFTDQARN  60

Query  500  YTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKL  679
            YT+L+++P  R L + +  ++D   LR FE++++ER++VTRQ++ ++KE FDNQLKIQKL
Sbjct  61   YTELLARPENRGLIDSNGGAVDPEALRAFERDLRERLRVTRQLMMDSKELFDNQLKIQKL  120

Query  680  KDTIFAVNDQ  709
            KDTIF VN+Q
Sbjct  121  KDTIFQVNEQ  130



>ref|XP_009134660.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
 ref|XP_009134661.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
 ref|XP_009134663.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
Length=539

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 112/187 (60%), Gaps = 24/187 (13%)
 Frame = +2

Query  167  GRSAAGR-----FIFKLFASVLTIAVFLFL-TLSLRYTSSSDPADLNVGILHDAYGVGPV  328
            GR+  G      F +++F S L    FLFL T S+   SS     L+  +          
Sbjct  8    GRNGVGSGLRSFFSYRIFISALF--SFLFLATFSVVLNSSRHQPHLDHTLPR--------  57

Query  329  RRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTD  508
                   +SDPLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++D
Sbjct  58   -----TFQSDPLKTRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAVNFSD  112

Query  509  LISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
            L +KP  +     + N+++E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDT
Sbjct  113  LQAKPGLKLE---NGNAIEEDAFRQIEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDT  169

Query  689  IFAVNDQ  709
            IFAV +Q
Sbjct  170  IFAVQEQ  176



>emb|CDX74263.1| BnaA03g27840D [Brassica napus]
Length=544

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 112/187 (60%), Gaps = 24/187 (13%)
 Frame = +2

Query  167  GRSAAGR-----FIFKLFASVLTIAVFLFL-TLSLRYTSSSDPADLNVGILHDAYGVGPV  328
            GR+  G      F +++F S L    FLFL T S+   SS     L+  +          
Sbjct  8    GRNGVGSGLRSFFSYRIFISALF--SFLFLATFSVVLNSSRHQPHLDHTLPR--------  57

Query  329  RRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTD  508
                   +SDPLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++D
Sbjct  58   -----TFQSDPLKTRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAVNFSD  112

Query  509  LISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
            L +KP  +     + N+++E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDT
Sbjct  113  LQAKPGLKLE---NGNAIEEDAFRQIEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDT  169

Query  689  IFAVNDQ  709
            IFAV +Q
Sbjct  170  IFAVQEQ  176



>ref|XP_009134662.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Brassica 
rapa]
 ref|XP_009134664.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Brassica 
rapa]
Length=534

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = +2

Query  347  LKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPA  526
             +SDPLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++DL +KP 
Sbjct  54   FQSDPLKTRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAVNFSDLQAKPG  113

Query  527  YRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
             +     + N+++E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDTIFAV +
Sbjct  114  LKLE---NGNAIEEDAFRQIEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDTIFAVQE  170

Query  707  Q  709
            Q
Sbjct  171  Q  171



>emb|CDX91987.1| BnaC03g32890D [Brassica napus]
Length=544

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 112/187 (60%), Gaps = 24/187 (13%)
 Frame = +2

Query  167  GRSAAGR-----FIFKLFASVLTIAVFLFL-TLSLRYTSSSDPADLNVGILHDAYGVGPV  328
            GR+  G      F +++F S L    FLFL T S+   SS     L+  +          
Sbjct  8    GRNGVGSGLRSFFSYRIFISALF--SFLFLATFSVVLNSSRHQPHLDHTLPR--------  57

Query  329  RRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTD  508
                   +SDPLK R DLI KQA DH  L  AYA+YARKLKL+ SK +++F +L+ N++D
Sbjct  58   -----TFQSDPLKTRLDLIHKQATDHLTLVNAYAAYARKLKLDASKQLKLFEDLAVNFSD  112

Query  509  LISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
            L +KP  +     + N+++E   RQ EKEVK+++K  R ++ E+KES+D QLKIQKLKDT
Sbjct  113  LQAKPGLKLE---NVNAIEEDAFRQIEKEVKDKVKTARMMIVESKESYDTQLKIQKLKDT  169

Query  689  IFAVNDQ  709
            IFAV +Q
Sbjct  170  IFAVQEQ  176



>ref|XP_003622860.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES79078.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
 gb|KEH22795.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
Length=434

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  512  ISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTI  691
            +SKP YR LF  D+  +DESV+RQ EKEVKERIK TRQV+ EAKESFDNQLKIQKLKDTI
Sbjct  1    MSKPRYRNLFSNDAVPVDESVVRQLEKEVKERIKTTRQVIGEAKESFDNQLKIQKLKDTI  60

Query  692  FAVNDQ  709
            FAVN+Q
Sbjct  61   FAVNEQ  66



>ref|XP_006575730.1| PREDICTED: galacturonosyltransferase 8-like [Glycine max]
 gb|KHN43932.1| Galacturonosyltransferase 8 [Glycine soja]
Length=177

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 91/173 (53%), Gaps = 36/173 (21%)
 Frame = +2

Query  197  KLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPLKPRF  376
            ++FAS + I+  +F      ++ S    D N        GV  +RRS++ALK+DPLKPR 
Sbjct  10   RIFASAIFISFCIFFAT---HSYSPHHTDSN-------GGVESIRRSIIALKTDPLKPRL  59

Query  377  DLIRKQAEDHralalayasyarklklENSKLVRV-FAELSRNYTDLISKPAYR-ALFELD  550
            + IRKQA+DH                    L RV F        +L +   +R A+++L 
Sbjct  60   EQIRKQADDH------------------GSLARVCFLCTQAQAGELKACKDFRGAMWQLG  101

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             +    S+   F++ V       RQVV +AKESFDNQLK QKLKDTIFAVN+Q
Sbjct  102  GSYEQTSIQASFQQSV------LRQVVGDAKESFDNQLKTQKLKDTIFAVNEQ  148



>ref|XP_011033002.1| PREDICTED: galacturonosyltransferase 8-like [Populus euphratica]
Length=554

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 106/181 (59%), Gaps = 18/181 (10%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLR---YTSSSDPADLNVGILHDAYGVGPVRRS----VLA  346
            F FK  AS + +    F T S     +  SS P D      H+  G+    R+     L+
Sbjct  14   FSFKGLASTIAVVGCFFFTCSFLLNVHVGSSSPTD------HEVLGLKQYERNDGRHPLS  67

Query  347  LKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPA  526
            L S+ LK +     +   D++ L L + S ARKLKLENSKLVR FAE+S N+TDLI K +
Sbjct  68   LTSNALKAQLKETVRSMVDYQGLLLMHGSIARKLKLENSKLVRNFAEISINFTDLIKKAS  127

Query  527  YRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            +      D +  + +++ +F KE KER+K  +Q+++++K SFD+QLKIQKLKDTIF + +
Sbjct  128  H-----CDVSDSNTALVHRFLKEAKERVKFAKQLISKSKGSFDSQLKIQKLKDTIFGLEE  182

Query  707  Q  709
            Q
Sbjct  183  Q  183



>ref|XP_009381434.1| PREDICTED: probable galacturonosyltransferase 9 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 106/175 (61%), Gaps = 22/175 (13%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLS-LRYTSSSDPADLNVGILHDAYGVGPVRRSVLALKSDPL  364
            F +K+FAS    AVF  L L+ +    SS P+       H        RRS LA  SDPL
Sbjct  17   FSYKVFAS----AVFTLLCLAAVSVLLSSYPS-------HTTDAAAVPRRSFLA--SDPL  63

Query  365  KPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFE  544
            + R DLI +QA DH A+A AYA+YAR+LKL++S+ + VF  L+  ++DL ++        
Sbjct  64   RARLDLIYRQAADHSAVATAYAAYARRLKLDSSRQLHVFEGLAAAFSDLSAR--------  115

Query  545  LDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            L +   DE   R  EKE K+R+K+ RQ+V E+KE+FD Q+KIQKL DTIFA  +Q
Sbjct  116  LAAPIDDEDAFRPLEKEAKDRVKLARQLVGESKEAFDTQIKIQKLSDTIFAAREQ  170



>ref|XP_009409999.1| PREDICTED: probable galacturonosyltransferase 9 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 90/136 (66%), Gaps = 10/136 (7%)
 Frame = +2

Query  302  HDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVF  481
            H+       RR  LA  SDPL+ R DLI +QA DH ALA AYA+YAR+LKL++S+ + VF
Sbjct  49   HNTASAAVRRRGFLA--SDPLRARLDLIYRQAADHSALATAYAAYARRLKLDSSRQLGVF  106

Query  482  AELSRNYTDLISKPAYRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQ  661
              L+   +DL ++        L +   DE  LR  EKE K+RIK+ RQ+V E+KE+FD Q
Sbjct  107  QGLAATLSDLSTR--------LAAPVDDEDALRPLEKEAKDRIKLARQLVGESKEAFDTQ  158

Query  662  LKIQKLKDTIFAVNDQ  709
            LKIQKL+DTIFAV +Q
Sbjct  159  LKIQKLRDTIFAVREQ  174



>ref|XP_002310951.2| hypothetical protein POPTR_0008s01050g [Populus trichocarpa]
 gb|EEE88318.2| hypothetical protein POPTR_0008s01050g [Populus trichocarpa]
Length=554

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 104/181 (57%), Gaps = 18/181 (10%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLR---YTSSSDPADLNVGILHDAYGVGPVRRS----VLA  346
            F FK  AS + +    F T S     +  SS P D      HD  G+    R+     L+
Sbjct  14   FSFKGLASTIAVMGCFFFTCSFLLNVHVGSSTPTD------HDVLGLKQYERNDGRHPLS  67

Query  347  LKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPA  526
            L S+ LK +     +   D++ L L + S ARKLKLENSKLVR FAE+S N+TDLI K +
Sbjct  68   LTSNALKAQLKETVRSVVDYQGLVLMHGSIARKLKLENSKLVRNFAEISINFTDLIKKAS  127

Query  527  YRALFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
            +      D +  + +++ +F K+ KE++K  +Q+++ +K SFD+QLKIQKLKDTIF +  
Sbjct  128  H-----CDVSDSNTALVHRFLKQAKEKVKFAKQLISNSKGSFDSQLKIQKLKDTIFGLEG  182

Query  707  Q  709
            Q
Sbjct  183  Q  183



>ref|XP_008784292.1| PREDICTED: probable galacturonosyltransferase 9 [Phoenix dactylifera]
Length=531

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 117/197 (59%), Gaps = 22/197 (11%)
 Frame = +2

Query  152  SGGLFGRSAA----GRFIFKLFASVLTIAVFLF-LTLSLRYTSSSDPADLNVGILHDAYG  316
            +GG   R AA    G   +++F S +   +FL  L++ L    SS  A    G   D   
Sbjct  2    AGGRSVRPAATGIRGLCSYRVFVSAMFTLLFLAALSVLLSTNPSSTAATSAAG---DPSV  58

Query  317  VGPV-----RRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVF  481
             G V      R+ LALKSDPL+ R  L+ +QA DH AL  AYA+YAR+LKL+NS+ +R F
Sbjct  59   AGDVLRPYLGRTFLALKSDPLRTRLHLLLRQAADHSALVHAYAAYARRLKLDNSRQLRAF  118

Query  482  AELSRNYTDLISKPAYRALFELDSN-SLDESVLRQFEKEVKERIKVTRQVVAEAKESFDN  658
             +L+ + + L ++        LDS+   DE  LR  EKE K+RIK  R +++E+KESFD 
Sbjct  119  EDLTASLSSLAAR--------LDSDLPSDEDSLRPLEKEAKDRIKFARALISESKESFDT  170

Query  659  QLKIQKLKDTIFAVNDQ  709
            QLKIQKL+DTIFAV +Q
Sbjct  171  QLKIQKLRDTIFAVQEQ  187



>ref|XP_008802618.1| PREDICTED: probable galacturonosyltransferase 9 [Phoenix dactylifera]
Length=536

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 121/202 (60%), Gaps = 27/202 (13%)
 Frame = +2

Query  152  SGGLFGRSAAG---RFIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVG-------IL  301
            +GG  GR A G    F +++F S +   +FL    +L    S++P+            + 
Sbjct  2    AGGRPGRPATGIRGVFGYRVFVSAMLTLIFL---AALSVLLSTNPSSSAATSAAGASFVA  58

Query  302  HDAYGVGP-----VRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSK  466
             D    G      + R+  +LKSDPL+ R DL+ +QA DH AL  AYA+YAR+LKL+NS+
Sbjct  59   GDPSAAGASFRPYLIRTFFSLKSDPLRTRLDLLLRQAADHSALVHAYAAYARRLKLDNSR  118

Query  467  LVRVFAELSRNYTDLISKPAYRALFELDSN-SLDESVLRQFEKEVKERIKVTRQVVAEAK  643
             +RVF +L+ + + L ++        LDSN   DE  LR  EKE K+RIK+ R +++E+K
Sbjct  119  QLRVFEDLAASLSSLAAR--------LDSNLPSDEDSLRPLEKEAKDRIKLARALISESK  170

Query  644  ESFDNQLKIQKLKDTIFAVNDQ  709
            ESFD QLKIQKL+DTIFA+++Q
Sbjct  171  ESFDTQLKIQKLRDTIFAIHEQ  192



>ref|XP_008379476.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
9 [Malus domestica]
Length=553

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 102/177 (58%), Gaps = 19/177 (11%)
 Frame = +2

Query  188  FIFKLFASVLTIAVFLFLTLSLRYTSSSDPADLNVGILHDA----YGVGPVRRSVLALKS  355
            F +++F S +   +F+     +  T+ S P        HD+     G   +RR+ LAL S
Sbjct  24   FSYRIFVSAMFSLLFIATLSVILTTNPSTPH-------HDSALPTTGNAYMRRTFLALNS  76

Query  356  DPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRA  535
            DPLK R DLI KQA DH  L  AYA+YARKLKLE S+ +R+F        DL S  +  +
Sbjct  77   DPLKTRLDLIYKQANDHVTLVNAYAAYARKLKLEISRQMRMF-------DDLASNFSGSS  129

Query  536  LFELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVND  706
                + N   + +  + +   + ++K+ R ++ E+KE++DNQLKIQKLKDTIFAVN+
Sbjct  130  NGSREGNGFLKGIFTR-KGMXRIKVKIVRLMIXESKENYDNQLKIQKLKDTIFAVNE  185



>ref|XP_010939506.1| PREDICTED: probable galacturonosyltransferase 9 [Elaeis guineensis]
Length=536

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 120/205 (59%), Gaps = 33/205 (16%)
 Frame = +2

Query  152  SGGLFGRSAAG---RFIFKLFASVLTIAVFLF-LTLSLRY--------------TSSSDP  277
            +GG  GR A G    F +++F S +   +FL  L++ L                T + DP
Sbjct  2    AGGRPGRPATGIRVVFSYRVFVSAMLTLLFLAALSVLLSANPSSSAATSASSDSTVAGDP  61

Query  278  ADLNVGILHDAYGVGPVRRSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklE  457
            +         AY    + R+ L++KSDPL+ R DL+ +QA DH AL   YA+YAR+LKL+
Sbjct  62   SAAG------AYLRPYLSRTFLSVKSDPLRIRLDLLLRQAADHSALIHTYAAYARRLKLD  115

Query  458  NSKLVRVFAELSRNYTDLISKPAYRALFELDSN-SLDESVLRQFEKEVKERIKVTRQVVA  634
            NS+ +RVF  L+ + + L ++        L+S    DE  LR  EKE K+RIK+ R +++
Sbjct  116  NSRQLRVFEGLAASLSSLAAR--------LNSGLPSDEDSLRPLEKEAKDRIKLARALIS  167

Query  635  EAKESFDNQLKIQKLKDTIFAVNDQ  709
            E+KESFD QLK+QKL+DTIFAV++Q
Sbjct  168  ESKESFDTQLKVQKLRDTIFAVHEQ  192



>ref|XP_010937117.1| PREDICTED: probable galacturonosyltransferase 9 [Elaeis guineensis]
Length=533

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 9/127 (7%)
 Frame = +2

Query  332  RSVLALKSDPLKPRFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDL  511
            R+ L +KSDPL+ R  L+ +QA DH AL  AYA+YAR+LKL+NS+ +R F +LS + + L
Sbjct  71   RTFLTVKSDPLRARLHLLLRQAADHSALVHAYAAYARRLKLDNSRQLRAFEDLSASLSSL  130

Query  512  ISKPAYRALFELDSN-SLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDT  688
             ++        LDS+   DE  LR  EKE K+RIK  R +++E+KESFD QLKIQKL+DT
Sbjct  131  AAR--------LDSDLPSDEDSLRPLEKEAKDRIKFARALISESKESFDTQLKIQKLRDT  182

Query  689  IFAVNDQ  709
            IFAV++Q
Sbjct  183  IFAVHEQ  189



>ref|XP_004965039.1| PREDICTED: probable galacturonosyltransferase 9-like [Setaria 
italica]
Length=502

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  542  ELDSNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             L S+SL E  LR  EKE +ERIK  R + A+AKE FD Q KIQKL DT+FAV + 
Sbjct  103  HLSSSSLPEDALRPLEKEARERIKFARALAADAKEGFDTQSKIQKLSDTVFAVGEH  158



>gb|AFW85243.1| hypothetical protein ZEAMMB73_225769 [Zea mays]
Length=501

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            S+SL E  LR  EKE +ERIK  R + A+AKE FD Q KI KL DT+FAV +Q
Sbjct  105  SSSLPEDALRPLEKEARERIKFARGLAADAKEGFDTQSKIHKLSDTVFAVGEQ  157



>ref|XP_003564052.1| PREDICTED: probable galacturonosyltransferase 9 [Brachypodium 
distachyon]
Length=500

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  554  NSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            +SL E  L+  EKE ++RIKV R + A++KESFD Q KIQKL DT+FAV +Q
Sbjct  105  HSLPEDALKPLEKEARDRIKVARLLAADSKESFDTQSKIQKLSDTVFAVGEQ  156



>ref|XP_002438104.1| hypothetical protein SORBIDRAFT_10g008060 [Sorghum bicolor]
 gb|EER89471.1| hypothetical protein SORBIDRAFT_10g008060 [Sorghum bicolor]
Length=504

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  566  ESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            E  LR  EKE +ERIK  R + A+AKE FD Q KIQKL DT+FAV +Q
Sbjct  113  EDALRPLEKEARERIKFARALAADAKEGFDTQSKIQKLSDTVFAVGEQ  160



>ref|XP_006656804.1| PREDICTED: probable galacturonosyltransferase 9-like, partial 
[Oryza brachyantha]
Length=432

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  557  SLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            SL E  ++  EKE ++RIK+ R + A+AKE FD Q KIQKL DT+FAV +Q
Sbjct  38   SLPEDAVKPLEKEARDRIKLARLLAADAKEGFDTQSKIQKLSDTVFAVGEQ  88



>gb|EAZ36348.1| hypothetical protein OsJ_20674 [Oryza sativa Japonica Group]
Length=504

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  557  SLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            SL E  ++  EKE ++RIK+ R + A+AKE FD Q KIQKL DT+FAV + 
Sbjct  110  SLPEDAVKPLEKEARDRIKLARLLAADAKEGFDTQSKIQKLSDTVFAVGEH  160



>dbj|BAD37314.1| glycosyl transferase protein A-like [Oryza sativa Japonica Group]
 dbj|BAD37465.1| glycosyl transferase protein A-like [Oryza sativa Japonica Group]
 gb|EAZ00235.1| hypothetical protein OsI_22241 [Oryza sativa Indica Group]
Length=504

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  557  SLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            SL E  ++  EKE ++RIK+ R + A+AKE FD Q KIQKL DT+FAV + 
Sbjct  110  SLPEDAVKPLEKEARDRIKLARLLAADAKEGFDTQSKIQKLSDTVFAVGEH  160



>ref|XP_002454284.1| hypothetical protein SORBIDRAFT_04g028010 [Sorghum bicolor]
 gb|EES07260.1| hypothetical protein SORBIDRAFT_04g028010 [Sorghum bicolor]
Length=492

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 59/113 (52%), Gaps = 13/113 (12%)
 Frame = +2

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R  ++++ AEDH A+  AY ++AR L   ++     F  +S   + L ++          
Sbjct  48   RLAVVQRHAEDHAAVLAAYTAHARHLSAASASQTDAFLSISSRLSALAAR----------  97

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
               L  S +   EKE+K ++K  R +   AKE+FD Q KIQKL DT+FAV  Q
Sbjct  98   ---LSLSTVGALEKEIKAQVKRARSLAGGAKEAFDTQSKIQKLSDTVFAVGQQ  147



>ref|XP_004953865.1| PREDICTED: probable galacturonosyltransferase 9-like [Setaria 
italica]
Length=490

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 58/113 (51%), Gaps = 13/113 (12%)
 Frame = +2

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R  ++++ AEDH A+  AY ++AR L   ++     F  +S   + L S+          
Sbjct  46   RLAVVQRHAEDHAAVLAAYTAHARHLSALSASQTDAFLAISSRLSALASR----------  95

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
               L  S +   EKE K ++K  R +   AKE+FD Q KIQKL DT+FAV  Q
Sbjct  96   ---LSVSTVGALEKEAKAQVKRARSLAGGAKEAFDTQSKIQKLSDTVFAVGQQ  145



>gb|KJB08801.1| hypothetical protein B456_001G104800 [Gossypium raimondii]
Length=396

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  626  VVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            +++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  1    MISEAKESFDNQLKIQKLKDTIFAVNEQ  28



>gb|KJB10196.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
 gb|KJB10197.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=396

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  626  VVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
            +++EAKESFDNQLKIQKLKDTIFAVN+Q
Sbjct  1    MISEAKESFDNQLKIQKLKDTIFAVNEQ  28



>ref|XP_008679311.1| PREDICTED: probable galacturonosyltransferase 9 [Zea mays]
 gb|AFW21608.1| hypothetical protein ZEAMMB73_184788 [Zea mays]
Length=490

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 13/113 (12%)
 Frame = +2

Query  371  RFDLIRKQAEDHralalayasyarklklENSKLVRVFAELSRNYTDLISKPAYRALFELD  550
            R  ++++ AEDH A+  AY ++AR L   ++     F  +S   + L ++          
Sbjct  46   RLAIVQRHAEDHAAVLAAYTAHARHLSAASASQTDAFLSISSRLSALAAR----------  95

Query  551  SNSLDESVLRQFEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
               L  S +   EKE+K ++K  R +   AKE+FD Q K QKL DT+FAV  Q
Sbjct  96   ---LSVSTVAALEKEIKAQVKRARSLAGGAKEAFDTQSKTQKLSDTVFAVGQQ  145



>gb|EAZ24604.1| hypothetical protein OsJ_08366 [Oryza sativa Japonica Group]
Length=472

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  584  FEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             EKE + +IK  R +   AKE+FD Q KIQKL DT+FAV+ Q
Sbjct  107  LEKETRGQIKRARSLAGAAKEAFDTQSKIQKLSDTVFAVDQQ  148



>ref|NP_001048110.1| Os02g0745400 [Oryza sativa Japonica Group]
 dbj|BAD15546.1| putative glycosyl transferase protein A [Oryza sativa Japonica 
Group]
 dbj|BAF10024.1| Os02g0745400 [Oryza sativa Japonica Group]
Length=493

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  584  FEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             EKE + +IK  R +   AKE+FD Q KIQKL DT+FAV+ Q
Sbjct  107  LEKETRGQIKRARSLAGAAKEAFDTQSKIQKLSDTVFAVDQQ  148



>gb|EAY87516.1| hypothetical protein OsI_08922 [Oryza sativa Indica Group]
Length=493

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  584  FEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             EKE + +IK  R +   AKE+FD Q KIQKL DT+FAV+ Q
Sbjct  107  LEKETRGQIKRARALAGAAKEAFDTQSKIQKLSDTVFAVDQQ  148



>ref|XP_006647884.1| PREDICTED: probable galacturonosyltransferase 9-like [Oryza brachyantha]
Length=489

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +2

Query  584  FEKEVKERIKVTRQVVAEAKESFDNQLKIQKLKDTIFAVNDQ  709
             EKE +  IK  R +   AKE+FD Q KIQKL DT+FAV  Q
Sbjct  103  LEKETRGHIKRARALAGAAKEAFDTQSKIQKLSDTVFAVGQQ  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1267397107886