BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11993

Length=956
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO58184.1|  hypothetical protein CISIN_1g0453552mg                  472   3e-164   Citrus sinensis [apfelsine]
ref|XP_009623793.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    492   7e-164   Nicotiana tomentosiformis
ref|XP_009802987.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    491   1e-163   Nicotiana sylvestris
ref|XP_009778994.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    490   1e-163   Nicotiana sylvestris
ref|XP_006356169.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    491   2e-163   Solanum tuberosum [potatoes]
ref|XP_009778993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    490   3e-163   Nicotiana sylvestris
ref|XP_004241722.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    488   2e-162   Solanum lycopersicum
ref|XP_011072284.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    486   1e-161   Sesamum indicum [beniseed]
ref|XP_009619830.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    485   2e-161   Nicotiana tomentosiformis
ref|XP_009619829.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    484   6e-161   Nicotiana tomentosiformis
ref|XP_004235695.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    484   7e-161   Solanum lycopersicum
ref|XP_003546283.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    483   2e-160   Glycine max [soybeans]
ref|XP_006343105.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    482   4e-160   Solanum tuberosum [potatoes]
ref|XP_010654709.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    478   9e-160   Vitis vinifera
gb|KHM98779.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    481   1e-159   Glycine soja [wild soybean]
ref|XP_010249876.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    479   4e-159   Nelumbo nucifera [Indian lotus]
gb|KEH39579.1|  amino-terminal acetyltransferase, putative              478   4e-159   Medicago truncatula
ref|XP_002299630.2|  acetyltransferase-related family protein           478   1e-158   Populus trichocarpa [western balsam poplar]
ref|XP_010110300.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    478   1e-158   Morus notabilis
gb|KEH39578.1|  amino-terminal acetyltransferase, putative              478   1e-158   Medicago truncatula
gb|EYU21564.1|  hypothetical protein MIMGU_mgv1a001105mg                478   2e-158   Erythranthe guttata [common monkey flower]
ref|XP_002284882.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    478   2e-158   Vitis vinifera
ref|XP_010654708.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    478   2e-158   Vitis vinifera
gb|KJB70535.1|  hypothetical protein B456_011G078200                    477   3e-158   Gossypium raimondii
ref|XP_003597797.1|  NMDA receptor-regulated protein                    479   4e-158   
ref|XP_012073296.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    476   6e-158   Jatropha curcas
ref|XP_012073295.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    476   6e-158   Jatropha curcas
ref|XP_006465444.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    476   8e-158   Citrus sinensis [apfelsine]
ref|XP_011002722.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    476   1e-157   Populus euphratica
ref|XP_003531689.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    476   1e-157   Glycine max [soybeans]
ref|XP_008228606.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    476   1e-157   Prunus mume [ume]
ref|XP_011000818.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    476   2e-157   Populus euphratica
ref|XP_002517521.1|  NMDA receptor-regulated protein, putative          475   3e-157   Ricinus communis
ref|XP_008373494.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    474   3e-157   
ref|XP_009358220.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    474   4e-157   
ref|XP_009358213.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    474   4e-157   Pyrus x bretschneideri [bai li]
ref|XP_009358212.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    474   4e-157   Pyrus x bretschneideri [bai li]
ref|XP_006427096.1|  hypothetical protein CICLE_v10024839mg             472   6e-157   
ref|XP_003528376.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    474   6e-157   Glycine max [soybeans]
ref|XP_006427095.1|  hypothetical protein CICLE_v10024839mg             472   8e-157   
ref|XP_006583136.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    474   1e-156   Glycine max [soybeans]
ref|XP_006427097.1|  hypothetical protein CICLE_v10024839mg             472   3e-156   Citrus clementina [clementine]
gb|KGN45336.1|  hypothetical protein Csa_7G440577                       454   4e-156   Cucumis sativus [cucumbers]
gb|KHN44136.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    472   4e-156   Glycine soja [wild soybean]
ref|XP_010691269.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    472   4e-156   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007024039.1|  Tetratricopeptide repeat (TPR)-containing pr...    471   6e-156   
ref|XP_007135709.1|  hypothetical protein PHAVU_010G151600g             471   7e-156   Phaseolus vulgaris [French bean]
ref|XP_003543657.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    471   1e-155   Glycine max [soybeans]
ref|NP_001142479.1|  uncharacterized protein LOC100274696               449   1e-155   
gb|KHN01367.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    470   1e-155   Glycine soja [wild soybean]
ref|XP_004506868.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    469   4e-155   Cicer arietinum [garbanzo]
ref|XP_006844401.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    468   1e-154   Amborella trichopoda
ref|XP_007150682.1|  hypothetical protein PHAVU_005G172700g             466   4e-154   Phaseolus vulgaris [French bean]
gb|KEH28765.1|  amino-terminal acetyltransferase, putative              466   5e-154   Medicago truncatula
ref|XP_009339003.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    466   6e-154   Pyrus x bretschneideri [bai li]
ref|XP_010539517.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    466   8e-154   Tarenaya hassleriana [spider flower]
gb|KHG11825.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    466   9e-154   Gossypium arboreum [tree cotton]
ref|XP_004302931.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    465   2e-153   Fragaria vesca subsp. vesca
ref|XP_010532133.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    464   2e-153   Tarenaya hassleriana [spider flower]
ref|XP_006389790.1|  hypothetical protein EUTSA_v10018100mg             464   2e-153   Eutrema salsugineum [saltwater cress]
ref|XP_010254211.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    465   3e-153   Nelumbo nucifera [Indian lotus]
ref|XP_010537937.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    464   5e-153   Tarenaya hassleriana [spider flower]
gb|KJB56693.1|  hypothetical protein B456_009G132500                    464   5e-153   Gossypium raimondii
ref|XP_002887831.1|  EMB2753                                            463   7e-153   Arabidopsis lyrata subsp. lyrata
ref|XP_006301121.1|  hypothetical protein CARUB_v10021530mg             463   9e-153   
gb|KJB56692.1|  hypothetical protein B456_009G132500                    463   9e-153   Gossypium raimondii
gb|KHN47800.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    463   1e-152   Glycine soja [wild soybean]
ref|XP_010417709.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    461   4e-152   Camelina sativa [gold-of-pleasure]
ref|XP_010429971.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    461   7e-152   Camelina sativa [gold-of-pleasure]
ref|XP_009416095.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    459   4e-151   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98079.1|  unnamed protein product                                459   6e-151   Coffea canephora [robusta coffee]
ref|XP_008792977.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    458   7e-151   Phoenix dactylifera
ref|NP_178157.2|  protein EMBRYO DEFECTIVE 2753                         458   9e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011659551.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    458   1e-150   Cucumis sativus [cucumbers]
gb|KFK42434.1|  hypothetical protein AALP_AA2G256000                    457   2e-150   Arabis alpina [alpine rockcress]
ref|NP_001185448.1|  protein EMBRYO DEFECTIVE 2753                      457   2e-150   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39981.1|  BnaC06g40590D                                          459   3e-150   Brassica napus [oilseed rape]
ref|XP_010062441.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    456   4e-150   Eucalyptus grandis [rose gum]
emb|CDY38667.1|  BnaC02g23120D                                          456   6e-150   Brassica napus [oilseed rape]
emb|CDM83394.1|  unnamed protein product                                455   2e-149   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008461048.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    454   3e-149   
emb|CDX67946.1|  BnaA07g19860D                                          454   4e-149   
ref|XP_009106750.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    454   4e-149   Brassica rapa
gb|EEC71092.1|  hypothetical protein OsI_02873                          454   6e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_010912607.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    453   6e-149   Elaeis guineensis
ref|XP_009128424.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    453   6e-149   Brassica rapa
ref|NP_001043582.1|  Os01g0617500                                       453   7e-149   
ref|XP_009104460.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    452   9e-149   Brassica rapa
emb|CDY37595.1|  BnaA02g19750D                                          453   9e-149   Brassica napus [oilseed rape]
ref|XP_006644372.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    453   1e-148   Oryza brachyantha
ref|XP_002304180.1|  acetyltransferase-related family protein           449   1e-148   
gb|EEE54991.1|  hypothetical protein OsJ_02617                          452   2e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385624.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    452   2e-148   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385623.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    452   2e-148   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925105.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    450   1e-147   Elaeis guineensis
ref|XP_010925104.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    450   1e-147   Elaeis guineensis
ref|XP_008672544.1|  PREDICTED: uncharacterized protein LOC100274...    450   1e-147   
ref|XP_002458160.1|  hypothetical protein SORBIDRAFT_03g027980          450   1e-147   Sorghum bicolor [broomcorn]
emb|CDX87308.1|  BnaA07g35650D                                          450   2e-147   
ref|XP_003569365.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    449   5e-147   
ref|XP_010232026.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    449   6e-147   
ref|XP_008809145.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    447   1e-146   
emb|CDX79387.1|  BnaC06g19160D                                          446   3e-146   
ref|XP_009106749.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    440   1e-143   Brassica rapa
ref|XP_004969173.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    436   4e-142   Setaria italica
gb|AAF27136.1|AC018849_24  putative N-terminal acetyltransferase;...    424   3e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961540.1|  hypothetical protein SELMODRAFT_164833             408   1e-131   
ref|XP_002971274.1|  hypothetical protein SELMODRAFT_94950              408   1e-131   
ref|XP_001764313.1|  predicted protein                                  404   7e-130   
ref|XP_001776114.1|  predicted protein                                  402   3e-129   
ref|XP_001783197.1|  predicted protein                                  399   5e-128   
ref|XP_008342751.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    378   8e-126   
ref|XP_007217133.1|  hypothetical protein PRUPE_ppa001163m2g            360   5e-122   
ref|XP_010254212.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    377   7e-120   Nelumbo nucifera [Indian lotus]
gb|EMS52083.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    375   1e-117   Triticum urartu
gb|KJB13120.1|  hypothetical protein B456_002G058200                    351   1e-110   Gossypium raimondii
gb|EMT02816.1|  NMDA receptor-regulated 1-like protein                  352   1e-109   
ref|XP_010474516.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    339   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010474515.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    313   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_005827391.1|  hypothetical protein GUITHDRAFT_158303             313   7e-97    Guillardia theta CCMP2712
ref|XP_009834389.1|  hypothetical protein H257_09749                    312   2e-95    Aphanomyces astaci
ref|XP_002899585.1|  N-terminal acetyltransferase A complex subun...    310   5e-95    Phytophthora infestans T30-4
gb|ETL77843.1|  hypothetical protein L917_21235                         308   6e-95    Phytophthora parasitica
gb|ETL24634.1|  hypothetical protein L916_21376                         306   1e-94    Phytophthora parasitica
gb|ETI30789.1|  hypothetical protein F443_22116                         309   1e-94    Phytophthora parasitica P1569
gb|ETM31097.1|  hypothetical protein L914_21244                         309   1e-94    Phytophthora parasitica
gb|ETP00579.1|  hypothetical protein F441_22010                         309   1e-94    Phytophthora parasitica CJ01A1
gb|ETK71183.1|  hypothetical protein L915_21512                         306   2e-94    Phytophthora parasitica
ref|XP_008915357.1|  hypothetical protein PPTG_18551                    308   2e-94    Phytophthora parasitica INRA-310
ref|XP_009526689.1|  hypothetical protein PHYSODRAFT_331569             308   2e-94    Phytophthora sojae
ref|XP_008876110.1|  hypothetical protein H310_11284                    308   4e-94    Aphanomyces invadans
ref|XP_008607810.1|  hypothetical protein SDRG_03939                    306   2e-93    Saprolegnia diclina VS20
emb|CCI42224.1|  unnamed protein product                                305   3e-93    Albugo candida
gb|ETP28747.1|  hypothetical protein F442_21980                         305   3e-93    Phytophthora parasitica P10297
ref|XP_005847916.1|  hypothetical protein CHLNCDRAFT_35269              303   6e-93    Chlorella variabilis
gb|KDO25758.1|  hypothetical protein SPRG_09056                         305   7e-93    Saprolegnia parasitica CBS 223.65
ref|XP_010574853.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   4e-86    Haliaeetus leucocephalus
ref|XP_004376674.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   4e-86    
ref|XP_008166844.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   7e-86    Chrysemys picta bellii
ref|XP_007501585.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   2e-85    Monodelphis domestica
ref|XP_011368048.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   2e-85    
ref|XP_002946235.1|  hypothetical protein VOLCADRAFT_55571              284   3e-85    Volvox carteri f. nagariensis
ref|XP_008166841.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   3e-85    Chrysemys picta bellii
ref|XP_004433676.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   3e-85    
ref|XP_006076577.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   3e-85    
ref|XP_004405382.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   3e-85    Odobenus rosmarus divergens
ref|XP_004054472.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   3e-85    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_009190099.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   4e-85    
ref|XP_010844474.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   4e-85    Bison bison bison
ref|XP_005652238.1|  N-terminal acetyltransferase A, auxiliary su...    285   4e-85    Coccomyxa subellipsoidea C-169
ref|NP_060997.2|  N-alpha-acetyltransferase 16, NatA auxiliary su...    270   5e-85    Homo sapiens [man]
ref|XP_008996433.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   5e-85    
ref|XP_011998819.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    270   6e-85    Ovis aries musimon
ref|XP_010844470.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   7e-85    Bison bison bison
ref|XP_007186857.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    270   9e-85    Balaenoptera acutorostrata scammoni
ref|XP_010844471.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    270   1e-84    Bison bison bison
ref|XP_007468672.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   1e-84    Lipotes vexillifer [baiji]
ref|XP_010574846.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   2e-84    Haliaeetus leucocephalus
emb|CCA19584.1|  Nterminal acetyltransferase A complex subunit na...    282   2e-84    Albugo laibachii Nc14
ref|XP_004054473.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   2e-84    
ref|NP_001104268.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    273   2e-84    Homo sapiens [man]
ref|XP_005789742.1|  hypothetical protein EMIHUDRAFT_454943             280   3e-84    Emiliania huxleyi CCMP1516
ref|XP_005585790.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   3e-84    
ref|NP_001096570.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    271   4e-84    
gb|KHN20434.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    263   5e-84    Glycine soja [wild soybean]
ref|XP_011401267.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    281   5e-84    Auxenochlorella protothecoides
ref|XP_004274602.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    268   5e-84    
ref|XP_010844469.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   5e-84    Bison bison bison
gb|AAH44392.1|  Narg1b protein                                          277   5e-84    Danio rerio [leopard danio]
ref|XP_006003551.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   6e-84    Latimeria chalumnae
gb|AAH71438.1|  Narg1b protein                                          277   6e-84    Danio rerio [leopard danio]
ref|XP_005710461.1|  unnamed protein product                            282   6e-84    Chondrus crispus [carageen]
ref|XP_004577510.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    267   1e-83    Ochotona princeps [southern American pika]
ref|XP_004405994.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-83    Odobenus rosmarus divergens
ref|XP_004433675.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   2e-83    
ref|XP_004426542.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-83    
ref|XP_006076576.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   2e-83    Bubalus bubalis [domestic water buffalo]
ref|XP_010844468.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   2e-83    Bison bison bison
ref|XP_005895886.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-83    Bos mutus
ref|XP_007523818.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-83    Erinaceus europaeus [common hedgehog]
ref|XP_004385540.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-83    
ref|XP_004265192.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   3e-83    Orcinus orca [Orca]
ref|XP_011998818.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   3e-83    Ovis aries musimon
ref|XP_007456941.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   3e-83    Lipotes vexillifer [baiji]
gb|EAX08658.1|  NMDA receptor regulated 1-like, isoform CRA_e           272   3e-83    Homo sapiens [man]
ref|XP_005585789.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   3e-83    Macaca fascicularis [crab eating macaque]
ref|XP_007958425.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   3e-83    Chlorocebus sabaeus
ref|XP_007501584.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   4e-83    Monodelphis domestica
ref|XP_009438834.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   4e-83    Pan troglodytes
ref|XP_011533530.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   4e-83    Homo sapiens [man]
ref|XP_011368047.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   5e-83    
ref|XP_010372810.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   5e-83    Rhinopithecus roxellana
ref|XP_005585788.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   5e-83    
ref|XP_011368044.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   5e-83    Pteropus vampyrus
ref|XP_007958423.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   5e-83    Chlorocebus sabaeus
ref|XP_005737422.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    280   5e-83    
ref|XP_006887091.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    272   6e-83    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_007939400.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    271   6e-83    Orycteropus afer afer
ref|XP_005470119.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    279   7e-83    
ref|XP_005737421.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    279   7e-83    Pundamilia nyererei
ref|XP_004538871.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    279   7e-83    
ref|NP_976066.1|  N(alpha)-acetyltransferase 15, NatA auxiliary s...    279   7e-83    
ref|XP_003448033.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    279   8e-83    
ref|XP_010844467.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   8e-83    Bison bison bison
ref|XP_011368046.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   8e-83    Pteropus vampyrus
ref|XP_006076575.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   1e-82    Bubalus bubalis [domestic water buffalo]
ref|XP_007186856.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   1e-82    
ref|XP_011998815.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   1e-82    Ovis aries musimon
ref|XP_011998814.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   1e-82    Ovis aries musimon
ref|XP_007501583.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   1e-82    Monodelphis domestica
ref|XP_005919211.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    278   1e-82    
ref|XP_005919210.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    278   1e-82    Haplochromis burtoni
ref|XP_006003550.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   2e-82    Latimeria chalumnae
ref|XP_002740751.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    278   2e-82    Saccoglossus kowalevskii
ref|XP_007501582.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   2e-82    
gb|AAH32642.1|  NARG1 protein                                           273   2e-82    Homo sapiens [man]
gb|AAH39818.1|  NARG1 protein                                           273   2e-82    Homo sapiens [man]
ref|XP_006639086.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    278   3e-82    
ref|XP_420407.4|  PREDICTED: N-alpha-acetyltransferase 15, NatA a...    278   3e-82    
ref|XP_009291037.1|  PREDICTED: N(alpha)-acetyltransferase 15, Na...    278   3e-82    
ref|XP_006076574.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   3e-82    
ref|XP_006629684.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    277   3e-82    Lepisosteus oculatus
ref|XP_009438833.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   4e-82    
ref|XP_010372809.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   4e-82    Rhinopithecus roxellana
ref|XP_008405679.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    277   4e-82    Poecilia reticulata
ref|XP_005266579.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   4e-82    
ref|XP_005458909.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   4e-82    
ref|XP_007544683.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    277   5e-82    Poecilia formosa
ref|XP_005458908.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   5e-82    
ref|XP_005803075.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    277   5e-82    Xiphophorus maculatus
ref|XP_004462843.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    270   5e-82    
ref|XP_007229932.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    276   7e-82    
ref|XP_005301537.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   7e-82    
ref|XP_005458907.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   8e-82    
ref|XP_007063799.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   9e-82    Chelonia mydas [green seaturtle]
ref|XP_009567336.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    276   1e-81    Cuculus canorus
ref|XP_005301536.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   1e-81    Chrysemys picta bellii
ref|XP_005751906.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    276   1e-81    Pundamilia nyererei
ref|XP_006003549.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   1e-81    Latimeria chalumnae
ref|XP_005458904.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   1e-81    Oreochromis niloticus
ref|XP_002938092.2|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    277   1e-81    
ref|XP_002168214.2|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    260   1e-81    Hydra vulgaris
ref|XP_005458906.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   1e-81    Oreochromis niloticus
ref|XP_004911890.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   1e-81    Xenopus tropicalis [western clawed frog]
ref|XP_005751907.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    276   1e-81    
ref|XP_004376673.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   1e-81    Trichechus manatus latirostris
ref|XP_005944999.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    276   1e-81    Haplochromis burtoni
ref|XP_005945000.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    276   1e-81    
ref|XP_010590885.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   1e-81    Loxodonta africana [African bush elephant]
ref|XP_005458905.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   2e-81    
ref|XP_001368680.3|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    276   2e-81    Monodelphis domestica
ref|XP_009438832.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   2e-81    Pan troglodytes
ref|XP_010574839.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   2e-81    Haliaeetus leucocephalus
gb|EAX08655.1|  NMDA receptor regulated 1-like, isoform CRA_b           273   2e-81    Homo sapiens [man]
ref|XP_004566664.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    276   2e-81    
ref|XP_011591221.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   2e-81    Aquila chrysaetos canadensis
ref|XP_002191713.2|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   2e-81    Taeniopygia guttata
ref|XP_005386749.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-81    Chinchilla lanigera
ref|XP_009020584.1|  hypothetical protein HELRODRAFT_112750             275   2e-81    Helobdella robusta
gb|AAH45491.2|  NMDA receptor-regulated gene 1a                         275   2e-81    Danio rerio [leopard danio]
ref|XP_004462842.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   2e-81    Dasypus novemcinctus
ref|XP_002196302.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   2e-81    Taeniopygia guttata
ref|XP_005516456.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   2e-81    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006076573.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   2e-81    
ref|XP_010590884.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   2e-81    Loxodonta africana [African bush elephant]
ref|XP_007430434.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   2e-81    Python bivittatus
ref|XP_009101228.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   2e-81    Serinus canaria [canary]
ref|XP_005492227.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   2e-81    Zonotrichia albicollis
ref|XP_009438831.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   2e-81    Pan troglodytes
ref|XP_005458903.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   2e-81    
ref|XP_008768346.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    263   2e-81    Rattus norvegicus [brown rat]
ref|XP_010351785.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-81    Rhinopithecus roxellana
ref|XP_006719929.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   3e-81    Homo sapiens [man]
ref|XP_005230744.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   3e-81    Falco peregrinus [peregrine]
ref|XP_005284399.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   3e-81    Chrysemys picta bellii
ref|XP_010844462.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   3e-81    Bison bison bison
ref|XP_006124448.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   3e-81    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008302622.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   3e-81    Stegastes partitus
ref|XP_006741282.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   3e-81    Leptonychotes weddellii
ref|XP_007496372.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   3e-81    
ref|XP_011288389.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   3e-81    
ref|NP_956940.1|  N-alpha-acetyltransferase 15, NatA auxiliary su...    275   3e-81    
ref|XP_003454358.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   3e-81    
ref|XP_007998021.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   4e-81    
ref|XP_008288099.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   4e-81    
ref|XP_007496371.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    275   4e-81    
ref|XP_004433674.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    275   4e-81    
ref|XP_009438830.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   4e-81    
ref|XP_005525673.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    277   4e-81    
ref|XP_011218870.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   4e-81    
gb|KFM72043.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    275   4e-81    
ref|XP_011533529.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   4e-81    
ref|XP_004680181.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   5e-81    
ref|XP_003218678.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   5e-81    
ref|XP_004759344.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   5e-81    
ref|XP_009905882.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   5e-81    
ref|XP_004405381.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   5e-81    
ref|XP_003454359.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   5e-81    
ref|XP_011288295.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   5e-81    
ref|XP_001150675.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   5e-81    
ref|XP_002915916.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   6e-81    
ref|XP_005585784.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   6e-81    
ref|XP_008315924.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   6e-81    
ref|XP_006076570.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   6e-81    
ref|XP_002916186.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   6e-81    
ref|XP_011998809.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   6e-81    
ref|XP_009556072.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   6e-81    
ref|XP_004462841.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   6e-81    
ref|XP_011798352.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   6e-81    
ref|XP_010749869.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   7e-81    
ref|XP_003928083.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   7e-81    
ref|XP_007186852.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   7e-81    
gb|EAX08660.1|  NMDA receptor regulated 1-like, isoform CRA_g           274   7e-81    
ref|XP_004768547.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   7e-81    
ref|XP_004405993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   7e-81    
ref|XP_011288270.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   7e-81    
ref|XP_307895.3|  AGAP002284-PA                                         275   7e-81    
ref|XP_011756703.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   7e-81    
ref|XP_003913858.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   7e-81    
ref|XP_004855043.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   7e-81    
ref|XP_007468671.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   7e-81    
ref|XP_003806946.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    274   7e-81    
ref|NP_001253545.1|  N-alpha-acetyltransferase 16, NatA auxiliary...    274   7e-81    
ref|XP_010343309.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   7e-81    
ref|XP_010336960.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   7e-81    
ref|XP_010900584.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    274   7e-81    
ref|XP_010372807.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    274   7e-81    
ref|XP_011288330.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   7e-81    
ref|NP_078837.3|  N-alpha-acetyltransferase 16, NatA auxiliary su...    274   7e-81    
ref|XP_004768548.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   7e-81    
gb|EFZ17636.1|  hypothetical protein SINV_12886                         268   8e-81    
emb|CDQ77423.1|  unnamed protein product                                274   8e-81    
ref|XP_004855042.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    274   8e-81    
ref|XP_008841645.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   8e-81    
ref|NP_001133628.1|  NMDA receptor-regulated protein 1                  274   8e-81    
ref|XP_008144565.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    273   8e-81    
ref|XP_011998808.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   9e-81    
ref|XP_005386746.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   9e-81    
ref|XP_010844461.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   9e-81    
ref|XP_005386747.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   9e-81    
ref|XP_007958420.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   9e-81    
ref|XP_004265191.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   9e-81    
dbj|BAG37192.1|  unnamed protein product                                273   9e-81    
gb|AAM48746.1|  transcriptional coactivator tubedown-100                273   9e-81    
gb|AAO33713.1|AF510858_1  N-terminal aceyltransferase 1                 273   1e-80    
ref|XP_005263293.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_011218869.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   1e-80    
emb|CDQ78745.1|  unnamed protein product                                273   1e-80    
ref|NP_001126952.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    273   1e-80    
ref|XP_011980399.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|NP_444319.3|  N-alpha-acetyltransferase 15, NatA auxiliary su...    273   1e-80    
ref|XP_417028.2|  PREDICTED: N-alpha-acetyltransferase 16, NatA a...    273   1e-80    
gb|EFN64825.1|  NMDA receptor-regulated protein 1                       268   1e-80    
ref|XP_002749049.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   1e-80    
ref|XP_007186850.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   1e-80    
ref|NP_476516.1|  N-alpha-acetyltransferase 15, NatA auxiliary su...    273   1e-80    
ref|XP_011980398.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_002716918.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_011904635.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_004643687.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|NP_001245032.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    273   1e-80    
ref|XP_006079328.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_005217625.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|NP_001178248.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    273   1e-80    
ref|XP_006079327.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_005344013.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_004426541.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_001502546.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_004643688.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_004938719.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   1e-80    
ref|XP_007186851.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   1e-80    
ref|XP_002745391.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_007456940.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
gb|EGI65509.1|  NMDA receptor-regulated protein 1                       268   1e-80    
ref|XP_008990937.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006906281.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_005327627.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_002713015.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   1e-80    
ref|XP_004462840.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    272   1e-80    
ref|XP_011904636.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_007998019.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006766119.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_008265652.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_005607893.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006906280.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_001138279.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006766120.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006081762.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_007523816.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_003129234.2|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|NP_001101144.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    273   1e-80    
ref|XP_007103888.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006872287.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006081761.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_007103889.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_004385539.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_008972362.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_003264721.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
gb|ACN10545.1|  NMDA receptor-regulated protein 1                       273   1e-80    
ref|XP_006977653.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_005656593.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_010588868.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_006144689.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   1e-80    
ref|XP_003221704.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-80    
ref|XP_003985042.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-80    
ref|XP_008258237.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   2e-80    
ref|XP_005996676.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    273   2e-80    
ref|XP_006930914.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    273   2e-80    
ref|XP_007946370.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    273   2e-80    
ref|XP_003476834.2|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    273   2e-80    
ref|XP_003482946.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    273   2e-80    
ref|XP_008418207.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    272   3e-80    
ref|XP_006887090.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    272   3e-80    
ref|XP_007939399.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    272   3e-80    
sp|Q80UM3.1|NAA15_MOUSE  RecName: Full=N-alpha-acetyltransferase ...    272   3e-80    
gb|KDR18769.1|  NMDA receptor-regulated protein 1                       266   4e-80    
ref|XP_010634573.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    270   4e-80    
ref|XP_006264092.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   5e-80    
ref|XP_008768342.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    264   6e-80    
ref|XP_005809050.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    271   7e-80    
ref|XP_007253759.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    271   7e-80    
gb|EFN82187.1|  NMDA receptor-regulated protein 1                       265   8e-80    
ref|XP_004274601.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   8e-80    
ref|XP_006884630.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    271   9e-80    
ref|XP_011873086.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    270   1e-79    
ref|XP_005809049.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    271   1e-79    
ref|XP_004322470.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    270   1e-79    
ref|XP_010634568.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    270   1e-79    
ref|XP_007172398.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    270   1e-79    
ref|XP_010634561.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    270   1e-79    
ref|XP_006261776.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    270   1e-79    
emb|CBN77876.1|  acetyltransferase 1-like                               272   1e-79    
ref|XP_010794132.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    270   2e-79    
ref|XP_007576184.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    270   2e-79    
ref|XP_005336837.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    270   2e-79    
ref|XP_008545894.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    268   2e-79    
ref|XP_008212117.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    265   2e-79    
ref|XP_003790194.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    270   3e-79    
ref|XP_011054404.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   3e-79    
ref|XP_005102206.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   3e-79    
ref|XP_004577509.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    269   4e-79    
ref|XP_012054144.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   4e-79    
ref|XP_005102207.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   4e-79    
ref|XP_011261421.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   4e-79    
ref|XP_011644904.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   4e-79    
ref|XP_011160699.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   4e-79    
ref|XP_011694090.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   5e-79    
ref|XP_007895872.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    269   5e-79    
ref|XP_003977076.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    268   7e-79    
ref|XP_002131267.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    269   7e-79    
gb|ETE66923.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    268   8e-79    
ref|XP_009044896.1|  hypothetical protein LOTGIDRAFT_198658             268   1e-78    
ref|XP_006837670.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    268   1e-78    
ref|XP_002611320.1|  hypothetical protein BRAFLDRAFT_120339             268   2e-78    
ref|XP_005366096.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    267   2e-78    
ref|XP_003693881.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    267   2e-78    
ref|XP_006613796.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    267   3e-78    
ref|XP_394637.2|  PREDICTED: N-alpha-acetyltransferase 15, NatA a...    267   3e-78    
ref|XP_003491306.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    267   3e-78    
gb|ERZ98463.1|  hypothetical protein GLOINDRAFT_286155                  263   3e-78    
ref|XP_003396013.1|  PREDICTED: n-alpha-acetyltransferase 15, Nat...    266   3e-78    
ref|XP_008471752.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    261   3e-78    
ref|XP_008852913.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    259   3e-78    
ref|XP_975602.1|  PREDICTED: N-alpha-acetyltransferase 16, NatA a...    266   4e-78    
ref|XP_008192284.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    266   4e-78    
ref|XP_010078080.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    251   4e-78    
gb|EMF17187.1|  N-terminal acetyltransferase A, auxiliary subunit       264   5e-78    
ref|XP_011297851.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    266   6e-78    
ref|XP_011442207.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    266   6e-78    
ref|XP_005770381.1|  hypothetical protein EMIHUDRAFT_432230             253   6e-78    
ref|XP_011142993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    266   6e-78    
ref|XP_009895032.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    266   6e-78    
ref|XP_001073064.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    266   7e-78    
ref|XP_003972011.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    266   8e-78    
gb|EFX89563.1|  hypothetical protein DAPPUDRAFT_190829                  266   8e-78    
ref|XP_001632534.1|  predicted protein                                  265   1e-77    
ref|XP_010118297.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    251   1e-77    
gb|ETN66349.1|  NMDA receptor-regulated protein 1                       265   1e-77    
ref|XP_011405204.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    266   1e-77    
ref|XP_010293448.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    253   1e-77    
ref|XP_010208791.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    254   1e-77    
gb|EWM30147.1|  tetratricopeptide repeat-containing protein             266   2e-77    
gb|EXX55520.1|  Nat1p                                                   264   2e-77    
ref|XP_003703292.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    264   3e-77    
ref|XP_011350705.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    264   3e-77    
gb|EZA46879.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    263   4e-77    
ref|XP_007640049.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    263   4e-77    
gb|AAI26031.1|  Narg1l protein                                          258   7e-77    
ref|XP_001657405.1|  AAEL006087-PA                                      263   9e-77    
ref|XP_011499374.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    263   9e-77    
ref|XP_009033788.1|  hypothetical protein AURANDRAFT_36410              263   1e-76    
ref|XP_006124451.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    250   1e-76    
ref|XP_011552202.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    262   1e-76    
ref|XP_011552201.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    262   1e-76    
ref|XP_010734112.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    262   2e-76    
ref|XP_004922640.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    262   2e-76    
ref|XP_007776702.1|  hypothetical protein W97_00599                     261   3e-76    
gb|KHG22454.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    242   3e-76    
ref|XP_008852912.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    261   4e-76    
ref|XP_010223721.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    261   5e-76    



>gb|KDO58184.1| hypothetical protein CISIN_1g0453552mg, partial [Citrus sinensis]
Length=302

 Score =   472 bits (1214),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGS ERAL E+ KKE KIVDKL YKEQEV LL+K+   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSFERALAEMHKKESKIVDKLAYKEQEVSLLVKIGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E   LY+ LLSMNPDNY YYEGLQ+CLG
Sbjct  241  EAAELYRALLSMNPDNYSYYEGLQKCLG  268



>ref|XP_009623793.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nicotiana tomentosiformis]
Length=899

 Score =   492 bits (1266),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 250/268 (93%), Positives = 257/268 (96%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ +LKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTVLKKFPDHGETLAMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEE G LERALEEL KKE KIVDKLGYKEQEV LLLKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEEYGFLERALEELHKKESKIVDKLGYKEQEVSLLLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLLSMNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLSMNPDNYRYYEGLQRCLG  268



>ref|XP_009802987.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nicotiana sylvestris]
Length=899

 Score =   491 bits (1265),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 250/268 (93%), Positives = 257/268 (96%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ +LKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTVLKKFPDHGETLAMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEE G LERALEEL KKE KIVDKLGYKEQEV LLLKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEEYGFLERALEELHKKESKIVDKLGYKEQEVSLLLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLLSMNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLSMNPDNYRYYEGLQRCLG  268



>ref|XP_009778994.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Nicotiana sylvestris]
Length=876

 Score =   490 bits (1262),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 246/268 (92%), Positives = 256/268 (96%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL+DDYP
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLDDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG  ERALEEL KKE K+VDKL +KEQEV +LLKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEECGFPERALEELHKKESKMVDKLAFKEQEVSILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLL+MNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLTMNPDNYRYYEGLQRCLG  268



>ref|XP_006356169.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Solanum tuberosum]
Length=903

 Score =   491 bits (1264),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/268 (92%), Positives = 256/268 (96%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNC+ RKS
Sbjct  1    MGASLPAKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCVDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYK+SLLEECG LERALEEL K+E KI DKLGYKEQEV LLLKL  FE
Sbjct  181  PENERCEHGEMLLYKVSLLEECGFLERALEELHKRESKIFDKLGYKEQEVSLLLKLHRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLLSMNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLSMNPDNYRYYEGLQRCLG  268



>ref|XP_009778993.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Nicotiana sylvestris]
Length=902

 Score =   490 bits (1262),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 246/268 (92%), Positives = 256/268 (96%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL+DDYP
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLDDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG  ERALEEL KKE K+VDKL +KEQEV +LLKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEECGFPERALEELHKKESKMVDKLAFKEQEVSILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLL+MNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLTMNPDNYRYYEGLQRCLG  268



>ref|XP_004241722.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Solanum lycopersicum]
Length=903

 Score =   488 bits (1256),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 245/268 (91%), Positives = 255/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETLAMKGLTLNC+ RKS
Sbjct  1    MGASLPAKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLAMKGLTLNCVDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKN+LKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNNLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAVDILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYK+SLLEECG  ERALEEL K+E KI DKLGYKEQEV LLLKL  FE
Sbjct  181  PENERCEHGEMLLYKVSLLEECGFFERALEELHKRESKIFDKLGYKEQEVSLLLKLHRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLLSMNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLSMNPDNYRYYEGLQRCLG  268



>ref|XP_011072284.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Sesamum indicum]
Length=899

 Score =   486 bits (1251),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 246/268 (92%), Positives = 255/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLNSNGSKAVDILEAYEGTLEDDYP
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAQHLNSNGSKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG +ERALEELRKKE KIVDKL YKEQEV LL KL  F+
Sbjct  181  PDNERCEHGEMLLYKISLLEECGMVERALEELRKKEPKIVDKLAYKEQEVSLLEKLGRFD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE LYK LLSMNPDNYRYYEGLQRC+G
Sbjct  241  EGEELYKKLLSMNPDNYRYYEGLQRCMG  268



>ref|XP_009619830.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Nicotiana tomentosiformis]
Length=875

 Score =   485 bits (1248),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 244/268 (91%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKF DHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFSDHGETLAMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL+DDYP
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLDDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEE G  ERALEEL K+E K+VDKL YKEQEV +LLKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEEYGFPERALEELHKEESKMVDKLAYKEQEVSILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLL+MNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLTMNPDNYRYYEGLQRCLG  268



>ref|XP_009619829.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Nicotiana tomentosiformis]
Length=901

 Score =   484 bits (1247),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 244/268 (91%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKF DHGETLAMKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFSDHGETLAMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL+DDYP
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLDDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEE G  ERALEEL K+E K+VDKL YKEQEV +LLKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEEYGFPERALEELHKEESKMVDKLAYKEQEVSILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGERL++VLL+MNPDNYRYYEGLQRCLG
Sbjct  241  EGERLFRVLLTMNPDNYRYYEGLQRCLG  268



>ref|XP_004235695.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Solanum lycopersicum]
Length=897

 Score =   484 bits (1246),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 243/268 (91%), Positives = 256/268 (96%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPNHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL+DDYP
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLDDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG  ERALEELRKKE K+VDKL YKEQE  L+LKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEECGFPERALEELRKKESKMVDKLDYKEQEALLILKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+L++VLL+MNPDNYRYY+GLQRCLG
Sbjct  241  EGEKLFRVLLTMNPDNYRYYDGLQRCLG  268



>ref|XP_003546283.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Glycine max]
Length=901

 Score =   483 bits (1243),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG  ++ALEEL+KKE KIVDKL YKEQEV LL+KL H E
Sbjct  181  PENERCEHGEMLLYKISLLEECGFFQKALEELQKKELKIVDKLAYKEQEVSLLVKLAHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEKLYRKLLSMNPDNYRYYEGLQKCVG  268



>ref|XP_006343105.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Solanum tuberosum]
Length=897

 Score =   482 bits (1241),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 242/268 (90%), Positives = 255/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKA + ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKATDTILKKFPNHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTL+DDYP
Sbjct  121  QAQMRDLEGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLDDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG  ERALEELRKKE K+VDKL YKEQE  L+LKL  FE
Sbjct  181  PENERCEHGEMLLYKISLLEECGFPERALEELRKKESKMVDKLDYKEQEALLILKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+L++VLL+MNPDNYRYY+GLQRCLG
Sbjct  241  EGEKLFRVLLTMNPDNYRYYDGLQRCLG  268



>ref|XP_010654709.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X3 [Vitis vinifera]
Length=801

 Score =   478 bits (1231),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG ++RA EEL KKE+KIVDKL  KEQ V L +KL   E
Sbjct  181  PENERCEHGEMLLYKISLLEECGFIQRAYEELLKKEFKIVDKLAVKEQLVSLFVKLDCLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG++LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGDKLYRALLSMNPDNYRYYEGLQKCVG  268



>gb|KHM98779.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   481 bits (1238),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWH YGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHAYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG  ++ALEEL+KKE KIVDKL YKEQEV LL+KL H E
Sbjct  181  PENERCEHGEMLLYKISLLEECGFFQKALEELQKKELKIVDKLAYKEQEVSLLVKLAHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEKLYRKLLSMNPDNYRYYEGLQKCVG  268



>ref|XP_010249876.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nelumbo nucifera]
Length=888

 Score =   479 bits (1233),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNGSKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGSKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYK+SL+EECG LERALEEL KKE KIVDKL +KEQEV LL+KL    
Sbjct  181  PENERCEHGEMLLYKVSLMEECGFLERALEELHKKESKIVDKLAFKEQEVSLLVKLGRLG  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE +Y+ LLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EGEEIYRALLSMNPDNYRYYEGLQKCLG  268



>gb|KEH39579.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=854

 Score =   478 bits (1230),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAV+HHLNSN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVSHHLNSNASKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEM+LYK+SLLEECGS ER LEEL+KKE KIVDKLGYKEQEV L++KL   E
Sbjct  181  PENERIEHGEMILYKVSLLEECGSFERGLEELQKKESKIVDKLGYKEQEVSLIVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQRC+G
Sbjct  241  EGEKLYQALLSMNPDNYRYYEGLQRCVG  268



>ref|XP_002299630.2| acetyltransferase-related family protein [Populus trichocarpa]
 gb|EEE84435.2| acetyltransferase-related family protein [Populus trichocarpa]
Length=900

 Score =   478 bits (1231),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 241/268 (90%), Positives = 254/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSNGSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGSLERALEEL KKE KIVDKL  KEQEV LL+KL H E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSLERALEELHKKESKIVDKLTLKEQEVSLLVKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  +Y+ LLS+NPDNYRY EGLQ+C+G
Sbjct  241  EGAEVYRALLSINPDNYRYCEGLQKCVG  268



>ref|XP_010110300.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Morus notabilis]
 gb|EXC25820.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Morus notabilis]
Length=901

 Score =   478 bits (1231),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/268 (90%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN  KAV+ILEAYEGTLEDD+P
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNALKAVEILEAYEGTLEDDFP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEE GSLERAL+EL KKE KIVDKL YKEQEV LL+KL  FE
Sbjct  181  PDNERCEHGEMLLYKISLLEESGSLERALDELHKKELKIVDKLAYKEQEVSLLVKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LYK LL+MNPDNYRYYEGLQ+C+G
Sbjct  241  EGATLYKALLAMNPDNYRYYEGLQKCVG  268



>gb|KEH39578.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=908

 Score =   478 bits (1231),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAV+HHLNSN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVSHHLNSNASKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEM+LYK+SLLEECGS ER LEEL+KKE KIVDKLGYKEQEV L++KL   E
Sbjct  181  PENERIEHGEMILYKVSLLEECGSFERGLEELQKKESKIVDKLGYKEQEVSLIVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQRC+G
Sbjct  241  EGEKLYQALLSMNPDNYRYYEGLQRCVG  268



>gb|EYU21564.1| hypothetical protein MIMGU_mgv1a001105mg [Erythranthe guttata]
Length=888

 Score =   478 bits (1229),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/268 (90%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKG+KAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGIKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLN NGSKAVDILEAYEGTLEDDYP
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAQHLNYNGSKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG  ER L+ELRKKE+KIVDKL  KEQEV LL KL  F+
Sbjct  181  PDNERCEHGEMLLYKISLLEECGLTERGLQELRKKEFKIVDKLAVKEQEVSLLEKLGLFD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE LY+ LLSMNPDNYRYYEGLQRC+G
Sbjct  241  EGEELYRKLLSMNPDNYRYYEGLQRCMG  268



>ref|XP_002284882.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X1 [Vitis vinifera]
 emb|CBI36188.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   478 bits (1230),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG ++RA EEL KKE+KIVDKL  KEQ V L +KL   E
Sbjct  181  PENERCEHGEMLLYKISLLEECGFIQRAYEELLKKEFKIVDKLAVKEQLVSLFVKLDCLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG++LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGDKLYRALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_010654708.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Vitis vinifera]
Length=899

 Score =   478 bits (1229),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG ++RA EEL KKE+KIVDKL  KEQ V L +KL   E
Sbjct  181  PENERCEHGEMLLYKISLLEECGFIQRAYEELLKKEFKIVDKLAVKEQLVSLFVKLDCLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG++LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGDKLYRALLSMNPDNYRYYEGLQKCVG  268



>gb|KJB70535.1| hypothetical protein B456_011G078200 [Gossypium raimondii]
Length=891

 Score =   477 bits (1227),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 241/267 (90%), Positives = 252/267 (94%), Gaps = 0/267 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGFLERALEELHKKEPKIVDKLTYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            EG  LYK LL+MNPDNYRYYEGLQ+C 
Sbjct  241  EGANLYKALLTMNPDNYRYYEGLQKCF  267



>ref|XP_003597797.1| NMDA receptor-regulated protein [Medicago truncatula]
Length=952

 Score =   479 bits (1232),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAV+HHLNSN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVSHHLNSNASKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEM+LYK+SLLEECGS ER LEEL+KKE KIVDKLGYKEQEV L++KL   E
Sbjct  181  PENERIEHGEMILYKVSLLEECGSFERGLEELQKKESKIVDKLGYKEQEVSLIVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQRC+G
Sbjct  241  EGEKLYQALLSMNPDNYRYYEGLQRCVG  268



>ref|XP_012073296.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Jatropha curcas]
Length=900

 Score =   476 bits (1226),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN +KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNATKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEEC  ++RALEEL KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECDFIDRALEELHKKESKIVDKLTYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY+VLL+MNPDNYRYYEGLQ+C+G
Sbjct  241  EGAELYRVLLAMNPDNYRYYEGLQKCVG  268



>ref|XP_012073295.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Jatropha curcas]
 gb|KDP37181.1| hypothetical protein JCGZ_06237 [Jatropha curcas]
Length=901

 Score =   476 bits (1226),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN +KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNATKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEEC  ++RALEEL KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECDFIDRALEELHKKESKIVDKLTYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY+VLL+MNPDNYRYYEGLQ+C+G
Sbjct  241  EGAELYRVLLAMNPDNYRYYEGLQKCVG  268



>ref|XP_006465444.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Citrus sinensis]
Length=900

 Score =   476 bits (1226),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGS ERAL E+ KKE KIVDKL YKEQEV LL+K+   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSFERALAEMHKKESKIVDKLAYKEQEVSLLVKIGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E   LY+ LLSMNPDNY YYEGLQ+CLG
Sbjct  241  EAAELYRALLSMNPDNYSYYEGLQKCLG  268



>ref|XP_011002722.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Populus euphratica]
Length=900

 Score =   476 bits (1225),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSNGSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGSLERALEEL KKE KIVDK+  KEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSLERALEELDKKESKIVDKVTLKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  +Y+ LLS+NPDNYRY+EGLQ+C+G
Sbjct  241  EGAEVYRALLSINPDNYRYFEGLQKCVG  268



>ref|XP_003531689.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Glycine max]
Length=901

 Score =   476 bits (1224),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/268 (90%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLE+D+P
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTLEEDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL YKEQEV LL+KL H E
Sbjct  181  PENERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLVYKEQEVSLLVKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEALYQALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_008228606.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Prunus mume]
Length=897

 Score =   476 bits (1224),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLN+N  KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAQHLNANALKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEEC  +ERALEEL KKE KIVDKL YKEQEV LL+KL H E
Sbjct  181  PDNERCEHGEMLLYKISLLEECNLIERALEELHKKETKIVDKLDYKEQEVSLLVKLDHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY++LLSMNPDNYRYY+GLQ+CLG
Sbjct  241  EGAELYRILLSMNPDNYRYYQGLQKCLG  268



>ref|XP_011000818.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Populus euphratica]
Length=900

 Score =   476 bits (1224),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 240/268 (90%), Positives = 255/268 (95%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR +LL+LKPNHRMNWIGFAVAHHLNS+GSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQKLLSLKPNHRMNWIGFAVAHHLNSDGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGSLERA+EELRKKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSLERAIEELRKKESKIVDKLTYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LYK LLS+NPDNYRYYEGLQ+C+G
Sbjct  241  EGAELYKELLSINPDNYRYYEGLQKCVG  268



>ref|XP_002517521.1| NMDA receptor-regulated protein, putative [Ricinus communis]
 gb|EEF44685.1| NMDA receptor-regulated protein, putative [Ricinus communis]
Length=901

 Score =   475 bits (1222),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREY+EAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYKEAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQ+RDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN SKAVDILEAYEGTLEDDYP
Sbjct  121  QAQIRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNASKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGSLERALEEL KK  KIVDKL  +EQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSLERALEELHKKGLKIVDKLACEEQEVSLLVKLARLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY+VLL+MNPDNYRYYEGLQ+C+G
Sbjct  241  EGAELYRVLLAMNPDNYRYYEGLQKCVG  268



>ref|XP_008373494.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Malus domestica]
Length=898

 Score =   474 bits (1221),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEEC  +ERALEEL KKE +IVDKL YKEQEV LL+KL H E
Sbjct  181  PDNERCEHGEMLLYKISLLEECSLIERALEELHKKELRIVDKLDYKEQEVSLLVKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG +LY+VLLSMNPDNY YY+GLQ+CLG
Sbjct  241  EGGKLYRVLLSMNPDNYGYYQGLQKCLG  268



>ref|XP_009358220.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 15, 
NatA auxiliary subunit-like [Pyrus x bretschneideri]
Length=897

 Score =   474 bits (1221),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEEC  +ERALEEL KKE +IVDKL YKEQEV LL+KL H E
Sbjct  181  PDNERCEHGEMLLYKISLLEECSLIERALEELHKKESRIVDKLDYKEQEVSLLVKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY+VLLSMNPDNY YY+GLQ+CLG
Sbjct  241  EGAELYRVLLSMNPDNYGYYQGLQKCLG  268



>ref|XP_009358213.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Pyrus x bretschneideri]
Length=897

 Score =   474 bits (1221),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEEC  +ERALEEL KKE +IVDKL YKEQEV LL+KL H E
Sbjct  181  PDNERCEHGEMLLYKISLLEECSLIERALEELHKKESRIVDKLDYKEQEVSLLVKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY+VLLSMNPDNY YY+GLQ+CLG
Sbjct  241  EGAELYRVLLSMNPDNYGYYQGLQKCLG  268



>ref|XP_009358212.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Pyrus x bretschneideri]
Length=898

 Score =   474 bits (1221),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEEC  +ERALEEL KKE +IVDKL YKEQEV LL+KL H E
Sbjct  181  PDNERCEHGEMLLYKISLLEECSLIERALEELHKKESRIVDKLDYKEQEVSLLVKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY+VLLSMNPDNY YY+GLQ+CLG
Sbjct  241  EGAELYRVLLSMNPDNYGYYQGLQKCLG  268



>ref|XP_006427096.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40336.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=842

 Score =   472 bits (1215),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGS ERAL E+ KKE KIVDKL YKEQEV LL+ +   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSFERALGEMHKKESKIVDKLAYKEQEVSLLVMIGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E   LY+ LLSMNPDNY YYEGLQ+CLG
Sbjct  241  EAAELYRALLSMNPDNYSYYEGLQKCLG  268



>ref|XP_003528376.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Glycine max]
Length=901

 Score =   474 bits (1220),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN  KAV+ILEAYEGTL++D+P
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNSFKAVEILEAYEGTLDEDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL YKEQEV LL+KL H +
Sbjct  181  PENERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLVYKEQEVSLLVKLGHLD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEALYRALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_006427095.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40335.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=851

 Score =   472 bits (1215),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGS ERAL E+ KKE KIVDKL YKEQEV LL+ +   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSFERALGEMHKKESKIVDKLAYKEQEVSLLVMIGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E   LY+ LLSMNPDNY YYEGLQ+CLG
Sbjct  241  EAAELYRALLSMNPDNYSYYEGLQKCLG  268



>ref|XP_006583136.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Glycine max]
Length=951

 Score =   474 bits (1221),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 239/268 (89%), Positives = 253/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN  KAV+ILEAYEGTL++D+P
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNSFKAVEILEAYEGTLDEDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL YKEQEV LL+KL H +
Sbjct  181  PENERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLVYKEQEVSLLVKLGHLD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEALYRALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_006427097.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40337.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=900

 Score =   472 bits (1215),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP K+ANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECGS ERAL E+ KKE KIVDKL YKEQEV LL+ +   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGSFERALGEMHKKESKIVDKLAYKEQEVSLLVMIGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E   LY+ LLSMNPDNY YYEGLQ+CLG
Sbjct  241  EAAELYRALLSMNPDNYSYYEGLQKCLG  268



>gb|KGN45336.1| hypothetical protein Csa_7G440577 [Cucumis sativus]
Length=372

 Score =   454 bits (1168),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 236/277 (85%), Positives = 250/277 (90%), Gaps = 9/277 (3%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLSMKGLTLNCMDRKA  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLKGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNPSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PE+ERCEHGEMLLYKISLL+ECGSLERAL EL KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PESERCEHGEMLLYKISLLDECGSLERALGELHKKEPKIVDKLSYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYR---------YYEGLQRCLG  956
            E E LYK LL++NPDNYR          YEGLQ C+G
Sbjct  241  EAENLYKKLLAINPDNYRDCIHTSMQTEYEGLQVCVG  277



>gb|KHN44136.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=893

 Score =   472 bits (1214),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEHGEMLLYKISLLEEC   ++ALEEL+KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PENEWCEHGEMLLYKISLLEECRFFQKALEELQKKELKIVDKLAYKEQEVLLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEKLYRTLLSMNPDNYRYYEGLQKCVG  268



>ref|XP_010691269.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Beta vulgaris subsp. vulgaris]
Length=895

 Score =   472 bits (1214),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK 
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKP  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR +LL+LKPNHRMNWIGFAV+HHLNSN  KA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLAGFVETRQRLLSLKPNHRMNWIGFAVSHHLNSNALKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEH EM+LYK+SLLEECGSLE+ALEEL++K+ KIVD+L YKEQEV LL KL   E
Sbjct  181  PDNERCEHSEMVLYKVSLLEECGSLEKALEELQRKQPKIVDRLSYKEQEVSLLAKLNRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY++LLSMNPDNYRYYEGLQRCLG
Sbjct  241  EAAKLYRILLSMNPDNYRYYEGLQRCLG  268



>ref|XP_007024039.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY26661.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
Length=898

 Score =   471 bits (1213),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLL+RSDREYREAIKCYRNAL+ DPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDVKSHVCWHVYGLLHRSDREYREAIKCYRNALKRDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSNG+KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNGAKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLTYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            +G  +YK LL+MNPDNYRYYEGLQ+C G
Sbjct  241  DGANIYKTLLNMNPDNYRYYEGLQKCFG  268



>ref|XP_007135709.1| hypothetical protein PHAVU_010G151600g [Phaseolus vulgaris]
 gb|ESW07703.1| hypothetical protein PHAVU_010G151600g [Phaseolus vulgaris]
Length=892

 Score =   471 bits (1212),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLE+DYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTLEEDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEHGEMLLYKISLL+ECG LERALEEL KKE+KIVDKL YKEQEV LL+KL   E
Sbjct  181  PENEGCEHGEMLLYKISLLDECGFLERALEELHKKEFKIVDKLAYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEALYRALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_003543657.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Glycine max]
Length=900

 Score =   471 bits (1211),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNSN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSNASKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEHGEMLLYKISLLEEC   ++ALEEL+KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PENEWCEHGEMLLYKISLLEECRFFQKALEELQKKELKIVDKLAYKEQEVLLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEKLYRTLLSMNPDNYRYYEGLQKCVG  268



>ref|NP_001142479.1| uncharacterized protein LOC100274696 [Zea mays]
 gb|ACG24261.1| hypothetical protein [Zea mays]
Length=287

 Score =   449 bits (1156),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN SKAV++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAVEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EH EMLLYKISL EECG L+RALEE++KKE KIVDKL +KEQ   +L KL  F+
Sbjct  181  PENERYEHNEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMASVLFKLGRFD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E +Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  241  ESESIYRSLLFMNPDNYKYFIAVQKCLG  268



>gb|KHN01367.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   470 bits (1210),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/268 (89%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN  KAV+ILEAYEGTL++D+P
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNSFKAVEILEAYEGTLDEDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL YKEQEV LL+KL H +
Sbjct  181  PENERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLVYKEQEVSLLVKLGHLD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG+ LY  LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGKALYWALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_004506868.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Cicer arietinum]
Length=899

 Score =   469 bits (1207),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHV+GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLE+D+P
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTLENDFP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG LERALEELR+KE  IVDKL  KEQEV L++KL H  
Sbjct  181  PDNERCEHGEMLLYKISLLEECGFLERALEELRQKESNIVDKLAVKEQEVSLVVKLGHLV  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EAESLYRALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_006844401.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Amborella trichopoda]
 gb|ERN06076.1| hypothetical protein AMTR_s00142p00102260 [Amborella trichopoda]
Length=901

 Score =   468 bits (1204),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG SLP KEANLFK+IVKSYETKQYKKGLKAA++ILKKFPDHGETL+MKGLTLNCM RK 
Sbjct  1    MGTSLPSKEANLFKLIVKSYETKQYKKGLKAADSILKKFPDHGETLSMKGLTLNCMDRKP  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLAGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG  ERALEEL+KKE K+VDKL YKEQ V L +KL H  
Sbjct  181  PDNERCEHGEMLLYKISLLEECGVFERALEELQKKEAKVVDKLAYKEQLVSLRIKLGHLA  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            +GE++Y+ LL+MNPDNYRYYEGLQ+CLG
Sbjct  241  DGEKIYRALLAMNPDNYRYYEGLQKCLG  268



>ref|XP_007150682.1| hypothetical protein PHAVU_005G172700g [Phaseolus vulgaris]
 gb|ESW22676.1| hypothetical protein PHAVU_005G172700g [Phaseolus vulgaris]
Length=893

 Score =   466 bits (1200),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANL K+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLLKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            +AY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   DAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLK NHRMNWIGFAVAHHLNS+ SKA++ILEAYEGTLE+DYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKSNHRMNWIGFAVAHHLNSSASKAIEILEAYEGTLEEDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
             ENERCEHGEMLLYKISLLEECG  ++ALEEL+KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  LENERCEHGEMLLYKISLLEECGFFQKALEELQKKELKIVDKLAYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEKLYRTLLSMNPDNYRYYEGLQKCVG  268



>gb|KEH28765.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=900

 Score =   466 bits (1200),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+NIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLE+D+P
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTLENDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NER EHGEM+LYKISLLE+CG LERAL ELR+KE KIVDKL +KEQEV LL+KL H E
Sbjct  181  PDNERLEHGEMILYKISLLEQCGFLERALGELRQKETKIVDKLAFKEQEVSLLVKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E LY+ LLSMNPDNY YYEGLQ+C+G
Sbjct  241  EAETLYRTLLSMNPDNYSYYEGLQKCVG  268



>ref|XP_009339003.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Pyrus x bretschneideri]
Length=899

 Score =   466 bits (1199),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 250/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTLED YP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTLEDGYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLL+EC  +ERALEEL KKE +IVDKL YKEQEV LL+KL H  
Sbjct  181  PDNERCEHGEMLLYKISLLDECSLIERALEELHKKESRIVDKLDYKEQEVSLLVKLGHLG  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            +G  LY+ LLSMNPDNYRYY+GLQ+CLG
Sbjct  241  KGAELYRELLSMNPDNYRYYQGLQKCLG  268



>ref|XP_010539517.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Tarenaya hassleriana]
Length=892

 Score =   466 bits (1198),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRD+ GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDVSGFVETRQQLLTLKPNHRMNWIGFAVAHHLHSNASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEH EMLLYK+SLLEE GS ERALE+L KKE KIVDKL YKE EV LL KL   E
Sbjct  181  PENERCEHSEMLLYKVSLLEESGSFERALEQLHKKEPKIVDKLAYKELEVSLLTKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EANKLYRVLLSMNPDNYRYYEGLQKCLG  268



>gb|KHG11825.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Gossypium 
arboreum]
Length=897

 Score =   466 bits (1198),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA+HL SN +KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVANHLCSNVAKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL  KEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLTSKEQEVTLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG   YK LL+MNPDNYRYYEGLQ+C G
Sbjct  241  EGANHYKALLAMNPDNYRYYEGLQKCFG  268



>ref|XP_004302931.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Fragaria vesca subsp. vesca]
Length=898

 Score =   465 bits (1196),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 233/268 (87%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNC+ RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCLDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLK+DLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+ DPDNIEILRDLSLL
Sbjct  61   EAYELVRMGLKHDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKRDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+ILEAYEGTLEDD+P
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEILEAYEGTLEDDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYK+SLLEE  S+ERALEEL KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKVSLLEESSSMERALEELHKKELKIVDKLDYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG  LY+VLLSMNPDNYRYY+GLQ+CLG
Sbjct  241  EGAELYRVLLSMNPDNYRYYQGLQKCLG  268



>ref|XP_010532133.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Tarenaya hassleriana]
Length=894

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPSKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRD+ GFVETR QLLTLKPNHRMNWIGFAVA HL+SN SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDVSGFVETRQQLLTLKPNHRMNWIGFAVAQHLHSNASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEH EMLLYK+SLLEE GS ERAL+EL K+E KIVDK+ YKEQEV LL KL   E
Sbjct  181  PENERCEHSEMLLYKVSLLEESGSFERALKELHKEEPKIVDKVAYKEQEVSLLTKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E ++LY+VLLSMNPDNYRYY+GLQ+CLG
Sbjct  241  EADKLYRVLLSMNPDNYRYYDGLQKCLG  268



>ref|XP_006389790.1| hypothetical protein EUTSA_v10018100mg [Eutrema salsugineum]
 gb|ESQ27076.1| hypothetical protein EUTSA_v10018100mg [Eutrema salsugineum]
Length=897

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 228/267 (85%), Positives = 249/267 (93%), Gaps = 0/267 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE GS ++ALEEL KKE KIVDKL YKEQEV LL KL   E
Sbjct  181  PENELCEHTEMILYKVSLLEESGSFDKALEELHKKESKIVDKLSYKEQEVSLLSKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E ++LY+VLLSMNPDNYRYYEGLQ+CL
Sbjct  241  EAKKLYRVLLSMNPDNYRYYEGLQKCL  267



>ref|XP_010254211.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Nelumbo nucifera]
Length=903

 Score =   465 bits (1196),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 234/268 (87%), Positives = 252/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGSSLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKA  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID DNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDADNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR +LLTLKPNHRMNWIGFAVAHHLNS+GSKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQKLLTLKPNHRMNWIGFAVAHHLNSSGSKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL  KEQEV LL+KL    
Sbjct  181  PDNERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLALKEQEVSLLVKLGCLG  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE++++ LLSMNPDNY+YYEGLQ+CLG
Sbjct  241  EGEKIFRALLSMNPDNYKYYEGLQKCLG  268



>ref|XP_010537937.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Tarenaya hassleriana]
Length=895

 Score =   464 bits (1193),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 231/268 (86%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPNHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPN RMNWIGFAVA HL+SN SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNQRMNWIGFAVAQHLHSNASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P NERCEH EMLLYK+SLLEE GS ERAL EL KKE +IVDKL YKEQEV LL+KL   E
Sbjct  181  PANERCEHSEMLLYKVSLLEEIGSFERALGELHKKEPEIVDKLAYKEQEVSLLIKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E ++LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EADKLYRVLLSMNPDNYRYYEGLQKCLG  268



>gb|KJB56693.1| hypothetical protein B456_009G132500 [Gossypium raimondii]
Length=897

 Score =   464 bits (1193),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA+HL SN +KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVANHLCSNVAKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL  KEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGFLERALEELHKKEPKIVDKLTSKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG   Y+ LL+MNPDNYRYYEGLQ+C G
Sbjct  241  EGANHYRALLAMNPDNYRYYEGLQKCFG  268



>ref|XP_002887831.1| EMB2753 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64090.1| EMB2753 [Arabidopsis lyrata subsp. lyrata]
Length=897

 Score =   463 bits (1192),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE GS ++ALEEL KKE KIVDKL YKEQEV LL K+   E
Sbjct  181  PENELCEHTEMILYKVSLLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLLSKVGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EANKLYRVLLSMNPDNYRYYEGLQKCLG  268



>ref|XP_006301121.1| hypothetical protein CARUB_v10021530mg [Capsella rubella]
 gb|EOA34019.1| hypothetical protein CARUB_v10021530mg [Capsella rubella]
Length=907

 Score =   463 bits (1192),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 230/268 (86%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE GS ++ALEEL KKE KIVDKL YKEQEV LL KL   E
Sbjct  181  PENELCEHTEMILYKVSLLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLLSKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EANKLYRVLLSMNPDNYRYYEGLQKCLG  268



>gb|KJB56692.1| hypothetical protein B456_009G132500 [Gossypium raimondii]
Length=894

 Score =   463 bits (1191),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 236/268 (88%), Positives = 249/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA+HL SN +KAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVANHLCSNVAKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL  KEQEV LL+KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEECGFLERALEELHKKEPKIVDKLTSKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG   Y+ LL+MNPDNYRYYEGLQ+C G
Sbjct  241  EGANHYRALLAMNPDNYRYYEGLQKCFG  268



>gb|KHN47800.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   463 bits (1191),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVC  VYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCCIVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLE+D+P
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNASKAVEILEAYEGTLEEDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISLLEECG LERALEEL KKE KIV+KL YKEQEV +L+K  H E
Sbjct  181  PENERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVNKLVYKEQEVSVLVKPGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE LY+ LLSMNPDNYRYYEGLQ+C+G
Sbjct  241  EGEALYRALLSMNPDNYRYYEGLQKCVG  268



>ref|XP_010417709.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=896

 Score =   461 bits (1187),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNTNASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE  EH EM+LYK+SLLEE GS ++ALEEL KKE KIVDKL YKEQEV LL KL H E
Sbjct  181  PENELIEHTEMILYKVSLLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLLSKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EANKLYRVLLSMNPDNYRYYEGLQKCLG  268



>ref|XP_010429971.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=896

 Score =   461 bits (1185),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 229/268 (85%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE  EH EM+LYK+SLLEE GS ++ALEELRKK+ KIVDKL YKEQEV LL KL H E
Sbjct  181  PENELIEHTEMILYKVSLLEESGSFDKALEELRKKQPKIVDKLSYKEQEVSLLSKLGHLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EATKLYRVLLSMNPDNYRYYEGLQKCLG  268



>ref|XP_009416095.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Musa acuminata subsp. malaccensis]
Length=903

 Score =   459 bits (1181),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPP+EANLFKVIVKSYETKQYKKGLK+A++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPREANLFKVIVKSYETKQYKKGLKSADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDLIGFVETR QLL LKPNHRMNWIGFAVAHHLNSN SKA+DILEAYEGTLEDDYP
Sbjct  121  QVQMRDLIGFVETRQQLLALKPNHRMNWIGFAVAHHLNSNASKAIDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PE+ER EHGEMLLYKISLLEECG  +RALEE+ KKE KIVDKL +KE+   ++LKL  FE
Sbjct  181  PESERYEHGEMLLYKISLLEECGLFDRALEEMHKKEAKIVDKLAFKEEMASIVLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E++Y+ LL MNPDNYRY+ GLQ+CLG
Sbjct  241  EAEKMYRFLLVMNPDNYRYFIGLQKCLG  268



>emb|CDO98079.1| unnamed protein product [Coffea canephora]
Length=909

 Score =   459 bits (1180),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 232/268 (87%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG SLP +E NLFK+IVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNC+ RK 
Sbjct  1    MGTSLPSREGNLFKLIVKSYETKQYKKGLKAADSILKKFPNHGETLSMKGLTLNCLDRKP  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR +LLTLKPNHRMNWIGFAVAHHLNSNGSKA +ILEAYEGTL+DD+P
Sbjct  121  QAQMRDLDGFVETRQRLLTLKPNHRMNWIGFAVAHHLNSNGSKATEILEAYEGTLDDDHP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NERCEHGEMLLYKISLLEE G LERALEEL KKE KIVDKL YKEQEV LL KL   E
Sbjct  181  PDNERCEHGEMLLYKISLLEESGLLERALEELHKKESKIVDKLAYKEQEVSLLTKLGFLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+ Y++LLSMNPDNYRYYEGLQRCLG
Sbjct  241  EGEKEYRLLLSMNPDNYRYYEGLQRCLG  268



>ref|XP_008792977.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Phoenix dactylifera]
Length=901

 Score =   458 bits (1179),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA+AILKKFP+HGETL+MKGL LNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLILNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEMLLYKISLLEECG  ++ALEE+ +KE KIVDKL YKEQ   +L+KL   E
Sbjct  181  PENERYEHGEMLLYKISLLEECGLPDKALEEMHRKEAKIVDKLAYKEQMASMLVKLGRVE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE+LY+ LL MN DNYRY+ GLQ+CLG
Sbjct  241  EGEKLYRSLLFMNSDNYRYFMGLQKCLG  268



>ref|NP_178157.2| protein EMBRYO DEFECTIVE 2753 [Arabidopsis thaliana]
 gb|AAL36371.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 gb|AAM14358.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 dbj|BAC42757.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 gb|AEE36399.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=897

 Score =   458 bits (1178),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE  EH EM+LYK+SLLEE GS ++ALEEL KKE KIVDKL YKEQEV LL K+   E
Sbjct  181  PENELIEHTEMILYKVSLLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLLSKVGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRY+EGLQ+CLG
Sbjct  241  EANKLYRVLLSMNPDNYRYHEGLQKCLG  268



>ref|XP_011659551.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Cucumis sativus]
Length=905

 Score =   458 bits (1178),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 236/277 (85%), Positives = 250/277 (90%), Gaps = 9/277 (3%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLSMKGLTLNCMDRKA  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLKGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNPSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PE+ERCEHGEMLLYKISLL+ECGSLERAL EL KKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PESERCEHGEMLLYKISLLDECGSLERALGELHKKEPKIVDKLSYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYR---------YYEGLQRCLG  956
            E E LYK LL++NPDNYR          YEGLQ C+G
Sbjct  241  EAENLYKKLLAINPDNYRDCIHTSMQTEYEGLQVCVG  277



>gb|KFK42434.1| hypothetical protein AALP_AA2G256000 [Arabis alpina]
Length=891

 Score =   457 bits (1175),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE  EH EM+LYKISLLEE GS ++ALEEL KKE  I DKL YKEQEV LL K+   E
Sbjct  181  PENELIEHTEMILYKISLLEESGSFDKALEELHKKEQIIGDKLSYKEQEVSLLSKVGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LYKVLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EANKLYKVLLSMNPDNYRYYEGLQKCLG  268



>ref|NP_001185448.1| protein EMBRYO DEFECTIVE 2753 [Arabidopsis thaliana]
 gb|AEE36400.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=911

 Score =   457 bits (1176),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 247/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE  EH EM+LYK+SLLEE GS ++ALEEL KKE KIVDKL YKEQEV LL K+   E
Sbjct  181  PENELIEHTEMILYKVSLLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLLSKVGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRY+EGLQ+CLG
Sbjct  241  EANKLYRVLLSMNPDNYRYHEGLQKCLG  268



>emb|CDY39981.1| BnaC06g40590D [Brassica napus]
Length=971

 Score =   459 bits (1180),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 227/280 (81%), Positives = 252/280 (90%), Gaps = 0/280 (0%)
 Frame = +3

Query  114  YFPFSSTTPCSATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLA  293
            +F  +S+   S  MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+
Sbjct  62   FFFVASSLSKSKKMGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLS  121

Query  294  MKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  473
            MKGLTLNCM RK+EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRID
Sbjct  122  MKGLTLNCMDRKTEAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRID  181

Query  474  PDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDI  653
            PDN+EILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKAV+I
Sbjct  182  PDNLEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNASKAVEI  241

Query  654  LEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKE  833
            LEA+EGTLEDDYPPENE CEH EM+LYK+SLLEE G+ ++ALEEL +KE KIVDKL YKE
Sbjct  242  LEAFEGTLEDDYPPENELCEHTEMILYKVSLLEESGAFDKALEELHRKESKIVDKLSYKE  301

Query  834  QEVCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            QEV LL KL   EE ++LY+VLLS+NPDNYRYYEGLQ+CL
Sbjct  302  QEVSLLSKLGRLEEAKKLYRVLLSINPDNYRYYEGLQKCL  341



>ref|XP_010062441.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Eucalyptus grandis]
 gb|KCW69583.1| hypothetical protein EUGRSUZ_F03005 [Eucalyptus grandis]
Length=900

 Score =   456 bits (1174),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 227/268 (85%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RK 
Sbjct  1    MGASLPQKEANLFKLIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKG  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRQGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKA+DILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNPSKAIDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENERCEHGEMLLYKISL+EEC  LE+AL+EL KKE+KI+D++  +EQEV LL+KL   E
Sbjct  181  PENERCEHGEMLLYKISLMEECEFLEKALDELYKKEHKILDRIACREQEVSLLVKLARLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EG +LY++LLSMNPDNY YYEGLQ+C G
Sbjct  241  EGGKLYRLLLSMNPDNYSYYEGLQKCAG  268



>emb|CDY38667.1| BnaC02g23120D [Brassica napus]
Length=898

 Score =   456 bits (1173),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM++YK+SLLEE G+  +ALEEL KKE KIVDKL YKEQE  LL KL    
Sbjct  181  PENELCEHTEMIMYKVSLLEESGAFGKALEELHKKEPKIVDKLSYKEQEAYLLWKLGRPA  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EASKLYRVLLSMNPDNYRYYEGLQKCLG  268



>emb|CDM83394.1| unnamed protein product [Triticum aestivum]
Length=907

 Score =   455 bits (1170),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLSSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEMLLYKISLLEECG L+RAL+E+ K E KIVDKL ++EQ  C+LLKL  FE
Sbjct  181  PENERYEHGEMLLYKISLLEECGMLDRALQEMHKMESKIVDKLSFREQMACILLKLSRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E++Y+ LL MNPDNY+Y   +Q+CLG
Sbjct  241  EAEKIYRSLLFMNPDNYKYLIAVQKCLG  268



>ref|XP_008461048.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 16, 
NatA auxiliary subunit [Cucumis melo]
Length=887

 Score =   454 bits (1167),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 231/259 (89%), Positives = 244/259 (94%), Gaps = 0/259 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLSMKGLTLNCMDRKA  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGF+VAHHLNSN SKAV+ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLKGFVETRQQLLTLKPNHRMNWIGFSVAHHLNSNPSKAVEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PE ERCEHGEMLLYKISLL+ECGSLERAL ELRKKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PEGERCEHGEMLLYKISLLDECGSLERALGELRKKEPKIVDKLSYKEQEVSLLVKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRY  929
            E E+LYK LL++NPDNYRY
Sbjct  241  EAEKLYKKLLAINPDNYRY  259



>emb|CDX67946.1| BnaA07g19860D [Brassica napus]
Length=894

 Score =   454 bits (1167),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+N+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE G+ ++ALEEL KKE KIVDKL YKE EV LL KL    
Sbjct  181  PENELCEHTEMILYKVSLLEEIGAFDKALEELHKKEPKIVDKLSYKELEVSLLSKLGRPA  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E ++LY+VLLSMNPDNYRYYEGLQ+C G
Sbjct  241  EADKLYRVLLSMNPDNYRYYEGLQKCFG  268



>ref|XP_009106750.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Brassica rapa]
Length=897

 Score =   454 bits (1167),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 225/267 (84%), Positives = 245/267 (92%), Gaps = 0/267 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSD EYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDIEYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLNSN SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNSNASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE G+ ++ALEEL KKE KIVDKL YKEQEV LL KL   E
Sbjct  181  PENELCEHTEMILYKVSLLEESGAFDKALEELHKKESKIVDKLSYKEQEVSLLSKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E ++LY+VLLSMNPDNYRYYEGLQ+CL
Sbjct  241  EAKKLYRVLLSMNPDNYRYYEGLQKCL  267



>gb|EEC71092.1| hypothetical protein OsI_02873 [Oryza sativa Indica Group]
Length=909

 Score =   454 bits (1167),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EH EMLLYKISL EECG L+RALEE++KKE KIVDKL +KEQ  C+LLKL  FE
Sbjct  181  PENERYEHSEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMACILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E+ Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  241  EAEKTYRSLLFMNPDNYKYFIAVQKCLG  268



>ref|XP_010912607.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Elaeis guineensis]
Length=901

 Score =   453 bits (1166),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLK+A+AIL+KFP+HGETL+MKGL LNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKSADAILRKFPEHGETLSMKGLILNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSNGSKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEMLLYKISLLEECG L++ALEE+ KKE KIVDKL +KEQ   +L  L   E
Sbjct  181  PENERYEHGEMLLYKISLLEECGRLDKALEEMHKKEPKIVDKLAFKEQMASMLANLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE++Y+ LL MN DNYRY+ GLQ+CLG
Sbjct  241  EGEKIYRSLLFMNSDNYRYFMGLQKCLG  268



>ref|XP_009128424.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Brassica rapa]
Length=898

 Score =   453 bits (1166),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 243/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGA LPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGAPLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM++YK+SLLEE G+  +ALEEL K E KIVDKL YKEQE  LL KL    
Sbjct  181  PENELCEHTEMIMYKVSLLEESGAFGKALEELHKNEPKIVDKLSYKEQEAYLLWKLGRPA  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EASKLYRVLLSMNPDNYRYYEGLQKCLG  268



>ref|NP_001043582.1| Os01g0617500 [Oryza sativa Japonica Group]
 dbj|BAD61289.1| acetyltransferase 1-like [Oryza sativa Japonica Group]
 dbj|BAF05496.1| Os01g0617500 [Oryza sativa Japonica Group]
Length=909

 Score =   453 bits (1166),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EH EMLLYKISL EECG L+RALEE++KKE KIVDKL +KEQ  C+LLKL  FE
Sbjct  181  PENERYEHSEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMACILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E+ Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  241  EAEKTYRSLLFMNPDNYKYFIAVQKCLG  268



>ref|XP_009104460.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Brassica rapa]
Length=894

 Score =   452 bits (1164),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+N+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE G+ ++ALEEL KKE KIVDKL YKE EV LL KL    
Sbjct  181  PENELCEHTEMILYKVSLLEEIGAFDKALEELHKKEPKIVDKLSYKELEVSLLSKLGRPA  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E ++LY+VLLSMNPDNYRYYEGLQ+C G
Sbjct  241  EADKLYRVLLSMNPDNYRYYEGLQKCFG  268



>emb|CDY37595.1| BnaA02g19750D [Brassica napus]
Length=898

 Score =   453 bits (1165),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 243/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGA LPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGAPLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM++YK+SLLEE G+  +ALEEL K E KIVDKL YKEQE  LL KL    
Sbjct  181  PENELCEHTEMIMYKVSLLEESGAFGKALEELHKNEPKIVDKLSYKEQEAYLLWKLGRPA  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  241  EASKLYRVLLSMNPDNYRYYEGLQKCLG  268



>ref|XP_006644372.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Oryza brachyantha]
Length=908

 Score =   453 bits (1165),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHLNSN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLNSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EH EMLLYKISL EEC  L+RALEE+ KKE KIVDKL +KEQ  C+LLKL  FE
Sbjct  181  PENERYEHSEMLLYKISLFEECEMLDRALEEMHKKESKIVDKLSFKEQMACILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E++Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  241  EAEKIYRSLLFMNPDNYKYFIAVQKCLG  268



>ref|XP_002304180.1| acetyltransferase-related family protein [Populus trichocarpa]
 gb|EEE79159.1| acetyltransferase-related family protein [Populus trichocarpa]
Length=796

 Score =   449 bits (1156),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 230/258 (89%), Positives = 244/258 (95%), Gaps = 0/258 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYE+KQYKKGLKAA+ ILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYESKQYKKGLKAADTILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR +LL+LKPNHRMNWIGFAVAHHLNS+GSKAV+ILEAYEGTL+DDYP
Sbjct  121  QAQMRDLTGFVETRQKLLSLKPNHRMNWIGFAVAHHLNSDGSKAVEILEAYEGTLDDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NER EHGEMLLYKISLLEECGSLERA+EELRKKE KIVDKL YKEQEV LL+KL   E
Sbjct  181  PDNERWEHGEMLLYKISLLEECGSLERAIEELRKKESKIVDKLTYKEQEVSLLVKLGRHE  240

Query  873  EGERLYKVLLSMNPDNYR  926
            EG  LYK LLS+NPDNYR
Sbjct  241  EGAELYKALLSINPDNYR  258



>gb|EEE54991.1| hypothetical protein OsJ_02617 [Oryza sativa Japonica Group]
Length=909

 Score =   452 bits (1164),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+S+P KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSVPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EH EMLLYKISL EECG L+RALEE++KKE KIVDKL +KEQ  C+LLKL  FE
Sbjct  181  PENERYEHSEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMACILLKLGRFE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E+ Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  241  EAEKTYRSLLFMNPDNYKYFIAVQKCLG  268



>ref|XP_009385624.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=889

 Score =   452 bits (1162),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN  KAVDILEAYEGTLEDDYP
Sbjct  121  QVQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNALKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE  EHGEMLLYKISLLEECG L+RALEE+ +KE KIVDKL +KEQ   ++LKL  F+
Sbjct  181  PENEHYEHGEMLLYKISLLEECGLLDRALEEMHRKEAKIVDKLAFKEQMASIVLKLGCFQ  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE++Y+ LL MN DNYRY+ GLQ+CLG
Sbjct  241  EGEKIYRSLLFMNSDNYRYFIGLQKCLG  268



>ref|XP_009385623.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=902

 Score =   452 bits (1162),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN  KAVDILEAYEGTLEDDYP
Sbjct  121  QVQMRDLTGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNALKAVDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE  EHGEMLLYKISLLEECG L+RALEE+ +KE KIVDKL +KEQ   ++LKL  F+
Sbjct  181  PENEHYEHGEMLLYKISLLEECGLLDRALEEMHRKEAKIVDKLAFKEQMASIVLKLGCFQ  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE++Y+ LL MN DNYRY+ GLQ+CLG
Sbjct  241  EGEKIYRSLLFMNSDNYRYFIGLQKCLG  268



>ref|XP_010925105.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Elaeis guineensis]
Length=901

 Score =   450 bits (1157),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA+AIL+KFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPQKEANLFKVIVKSYETKQYKKGLKAADAILRKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GF+ETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFIETRQQLLTLKPNHRMNWIGFAVSHHLSSNVSKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NER EHGEMLLYKISLLEECG LE+ALEE++KKE KIVDKL YKEQ   +L+KL   E
Sbjct  181  PDNERYEHGEMLLYKISLLEECGLLEKALEEMQKKEAKIVDKLAYKEQMASILVKLGFLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE++Y+ LL MN DNYRY+ GLQ+CLG
Sbjct  241  EGEKVYRSLLFMNSDNYRYFIGLQKCLG  268



>ref|XP_010925104.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Elaeis guineensis]
Length=902

 Score =   450 bits (1157),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/268 (84%), Positives = 248/268 (93%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA+AIL+KFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPQKEANLFKVIVKSYETKQYKKGLKAADAILRKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GF+ETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA++ILEAYEGTLEDDYP
Sbjct  121  QAQMRDLTGFIETRQQLLTLKPNHRMNWIGFAVSHHLSSNVSKAIEILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NER EHGEMLLYKISLLEECG LE+ALEE++KKE KIVDKL YKEQ   +L+KL   E
Sbjct  181  PDNERYEHGEMLLYKISLLEECGLLEKALEEMQKKEAKIVDKLAYKEQMASILVKLGFLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE++Y+ LL MN DNYRY+ GLQ+CLG
Sbjct  241  EGEKVYRSLLFMNSDNYRYFIGLQKCLG  268



>ref|XP_008672544.1| PREDICTED: uncharacterized protein LOC100274696 isoform X1 [Zea 
mays]
 gb|ACN33851.1| unknown [Zea mays]
 tpg|DAA58577.1| TPA: putative tetratricopeptide repeat (TPR)-containing protein 
[Zea mays]
Length=908

 Score =   450 bits (1158),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN SKAV++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAVEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EH EMLLYKISL EECG L+RALEE++KKE KIVDKL +KEQ   +L KL  F+
Sbjct  181  PENERYEHNEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMASVLFKLGRFD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E +Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  241  ESESIYRSLLFMNPDNYKYFIAVQKCLG  268



>ref|XP_002458160.1| hypothetical protein SORBIDRAFT_03g027980 [Sorghum bicolor]
 gb|EES03280.1| hypothetical protein SORBIDRAFT_03g027980 [Sorghum bicolor]
Length=908

 Score =   450 bits (1158),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/268 (83%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLL+LKPNHRMNWIGFAVAHHLNSN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EH EMLLYKISL EECG L+RALEE++KKE KIVDKL +KEQ   +L KL  F+
Sbjct  181  PENERYEHSEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMASVLFKLGRFD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E +Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  241  ESESIYRSLLFMNPDNYKYFIAVQKCLG  268



>emb|CDX87308.1| BnaA07g35650D [Brassica napus]
Length=910

 Score =   450 bits (1157),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/267 (84%), Positives = 244/267 (91%), Gaps = 0/267 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSD EYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDIEYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPN RMNWIGFAV+ HLNSN SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNRRMNWIGFAVSQHLNSNASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE G+ ++ALEEL KKE KIVDKL YKEQEV LL KL   E
Sbjct  181  PENELCEHTEMILYKVSLLEESGAFDKALEELHKKESKIVDKLSYKEQEVSLLSKLGRLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E ++LY+VLLSMNPDNYRYYEGLQ+CL
Sbjct  241  EAKKLYRVLLSMNPDNYRYYEGLQKCL  267



>ref|XP_003569365.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Brachypodium distachyon]
Length=907

 Score =   449 bits (1154),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 220/268 (82%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            M +SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MDSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEMLLYKISL EECG L+RALEE+ K E +IVDKL ++EQ   +LLKL  F+
Sbjct  181  PENERYEHGEMLLYKISLFEECGMLDRALEEMHKMESRIVDKLSFREQRASILLKLGRFD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E++Y+ LL MNPDNY+Y+  +Q+C+G
Sbjct  241  EAEKIYRSLLFMNPDNYKYFIAVQKCVG  268



>ref|XP_010232026.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Brachypodium distachyon]
Length=914

 Score =   449 bits (1154),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 220/268 (82%), Positives = 245/268 (91%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            M +SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MDSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVAHHL+SN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVAHHLSSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEMLLYKISL EECG L+RALEE+ K E +IVDKL ++EQ   +LLKL  F+
Sbjct  181  PENERYEHGEMLLYKISLFEECGMLDRALEEMHKMESRIVDKLSFREQRASILLKLGRFD  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E++Y+ LL MNPDNY+Y+  +Q+C+G
Sbjct  241  EAEKIYRSLLFMNPDNYKYFIAVQKCVG  268



>ref|XP_008809145.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 15, 
NatA auxiliary subunit-like [Phoenix dactylifera]
Length=901

 Score =   447 bits (1151),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/268 (84%), Positives = 246/268 (92%), Gaps = 0/268 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA+A+LKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADAVLKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNAL+IDPDNIEILRDLSLL
Sbjct  61   EAYDLVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALKIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRD  GF+ETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA+DILEAYEGTLEDDYP
Sbjct  121  QAQMRDHTGFIETRQQLLTLKPNHRMNWIGFAVSHHLSSNVSKAIDILEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+NER EHGEMLLYKISLLEE G L++ALEE+ KKE KIVDKL Y+EQ   +L+KL   E
Sbjct  181  PDNERYEHGEMLLYKISLLEERGLLKKALEEMHKKEAKIVDKLAYREQMASILVKLGCLE  240

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            EGE++Y+ LL MN DNYRY+ GLQ+CLG
Sbjct  241  EGEKIYRSLLFMNSDNYRYFIGLQKCLG  268



>emb|CDX79387.1| BnaC06g19160D [Brassica napus]
Length=908

 Score =   446 bits (1148),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 242/268 (90%), Gaps = 2/268 (1%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFP HGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPSHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV+GLLYRSDREYREAIKCYRNALRIDP+N+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVFGLLYRSDREYREAIKCYRNALRIDPENLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEA+EGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAFEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENE CEH EM+LYK+SLLEE G+ ++AL++   K   IVDKL YKE EV LL KL    
Sbjct  181  PENELCEHTEMILYKVSLLEEIGAFDKALDDKFLKL--IVDKLSYKELEVSLLSKLGRPA  238

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E ++LY+VLLSMNPDNYRYYEGLQ+C G
Sbjct  239  EADKLYRVLLSMNPDNYRYYEGLQKCFG  266



>ref|XP_009106749.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Brassica rapa]
Length=922

 Score =   440 bits (1132),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 225/292 (77%), Positives = 245/292 (84%), Gaps = 25/292 (9%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIV-------------------------KSYETKQYKKGLKAAEAI  257
            MGASLP KEANLFK+IV                         KSYETKQYKKGLKAA+AI
Sbjct  1    MGASLPTKEANLFKLIVTLVTLIAASYISLLPLFVSQLLGKLKSYETKQYKKGLKAADAI  60

Query  258  LKKFPDHGETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYRE  437
            LKKFP HGETL+MKGLTLNCM RK+EAY+LVRLG+KND+KSHVCWHV GLLYRSD EYRE
Sbjct  61   LKKFPSHGETLSMKGLTLNCMDRKTEAYELVRLGVKNDIKSHVCWHVLGLLYRSDIEYRE  120

Query  438  AIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAH  617
            AIKCYRNALRIDPDN+EILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ 
Sbjct  121  AIKCYRNALRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQ  180

Query  618  HLNSNGSKAVDILEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkk  797
            HLNSN SKAV+ILEA+EGTLEDDYPPENE CEH EM+LYK+SLLEE G+ ++ALEEL KK
Sbjct  181  HLNSNASKAVEILEAFEGTLEDDYPPENELCEHTEMILYKVSLLEESGAFDKALEELHKK  240

Query  798  eYKIVDKLGYKEQEVCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E KIVDKL YKEQEV LL KL   EE ++LY+VLLSMNPDNYRYYEGLQ+CL
Sbjct  241  ESKIVDKLSYKEQEVSLLSKLGRLEEAKKLYRVLLSMNPDNYRYYEGLQKCL  292



>ref|XP_004969173.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Setaria italica]
Length=905

 Score =   436 bits (1120),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 241/268 (90%), Gaps = 3/268 (1%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLPPKEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HGETL+MKGLTLNCM RKS
Sbjct  1    MGSSLPPKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLL+LKP+HRMNWIGFAVAHHLNSN SKA+++LEAYEGTLEDDYP
Sbjct  121  QAQMRDLSGFVETRQQLLSLKPSHRMNWIGFAVAHHLNSNSSKAIEVLEAYEGTLEDDYP  180

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    EH EMLLYKISL EECG L+R LEE++KKE KIVDKL +KEQ   +L KL  F+
Sbjct  181  PD---YEHSEMLLYKISLFEECGMLDRGLEEMQKKESKIVDKLSFKEQMASVLFKLGRFD  237

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E +Y+ LL MNPDNY+Y+  +Q+CLG
Sbjct  238  ESESIYRSLLFMNPDNYKYFIAVQKCLG  265



>gb|AAF27136.1|AC018849_24 putative N-terminal acetyltransferase; 84330-89402 [Arabidopsis 
thaliana]
Length=683

 Score =   424 bits (1091),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/251 (84%), Positives = 230/251 (92%), Gaps = 0/251 (0%)
 Frame = +3

Query  204  KSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSH  383
            KSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+EAY+LVRLG+KND+KSH
Sbjct  3    KSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKTEAYELVRLGVKNDIKSH  62

Query  384  VCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQL  563
            VCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLLQAQMRDL GFVETR QL
Sbjct  63   VCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQL  122

Query  564  LTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPENERCEHGEMLLYKIS  743
            LTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYPPENE  EH EM+LYK+S
Sbjct  123  LTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYPPENELIEHTEMILYKVS  182

Query  744  LLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEGERLYKVLLSMNPDNY  923
            LLEE GS ++ALEEL KKE KIVDKL YKEQEV LL K+   EE  +LY+VLLSMNPDNY
Sbjct  183  LLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLLSKVGRLEEANKLYRVLLSMNPDNY  242

Query  924  RYYEGLQRCLG  956
            RY+EGLQ+CLG
Sbjct  243  RYHEGLQKCLG  253



>ref|XP_002961540.1| hypothetical protein SELMODRAFT_164833 [Selaginella moellendorffii]
 gb|EFJ36800.1| hypothetical protein SELMODRAFT_164833 [Selaginella moellendorffii]
Length=886

 Score =   408 bits (1048),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 209/270 (77%), Positives = 234/270 (87%), Gaps = 2/270 (1%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG SLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETLAMKGLTLNCM RK+
Sbjct  1    MGTSLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLAMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN--IEILRDLS  506
            EAY+LVR GLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDP+N  I+ILRDLS
Sbjct  61   EAYELVRKGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPENKPIQILRDLS  120

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GFVETR QLLTLKPNHR NWI FA+A HLNS    AV+IL+AYEGTLE+D
Sbjct  121  LLQVQMRDLDGFVETRRQLLTLKPNHRNNWICFAIAQHLNSRADIAVEILQAYEGTLEED  180

Query  687  YPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRH  866
            +PP+NER EH EMLLYK+SLLEE G+LE+ALEELR K+ KIVDKLG KE    LLLKL  
Sbjct  181  FPPDNERYEHSEMLLYKVSLLEESGALEKALEELRNKQAKIVDKLGVKEVTAGLLLKLNR  240

Query  867  FEEGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            FEE E+ Y+ L+ + PDN  Y+E LQ+C+G
Sbjct  241  FEEAEKGYRNLIEICPDNTTYHESLQKCIG  270



>ref|XP_002971274.1| hypothetical protein SELMODRAFT_94950 [Selaginella moellendorffii]
 gb|EFJ27872.1| hypothetical protein SELMODRAFT_94950 [Selaginella moellendorffii]
Length=887

 Score =   408 bits (1048),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 209/270 (77%), Positives = 234/270 (87%), Gaps = 2/270 (1%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG SLPPKEANLFK+IVKSYETKQYKKGLKAA+ ILKKFP+HGETLAMKGLTLNCM RK+
Sbjct  1    MGTSLPPKEANLFKLIVKSYETKQYKKGLKAADQILKKFPEHGETLAMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDN--IEILRDLS  506
            EAY+LVR GLKND+KSHVCWHVYGLLYRSDREYREAIKCYRNALRIDP+N  I+ILRDLS
Sbjct  61   EAYELVRKGLKNDVKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPENKPIQILRDLS  120

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GFVETR QLLTLKPNHR NWI FA+A HLNS    AV+IL+AYEGTLE+D
Sbjct  121  LLQVQMRDLDGFVETRRQLLTLKPNHRNNWICFAIAQHLNSRADIAVEILQAYEGTLEED  180

Query  687  YPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRH  866
            +PP+NER EH EMLLYK+SLLEE G+LE+ALEELR K+ KIVDKLG KE    LLLKL  
Sbjct  181  FPPDNERYEHSEMLLYKVSLLEESGALEKALEELRNKQAKIVDKLGVKEVTAGLLLKLNR  240

Query  867  FEEGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            FEE E+ Y+ L+ + PDN  Y+E LQ+C+G
Sbjct  241  FEEAEKGYRNLIEICPDNTTYHESLQKCIG  270



>ref|XP_001764313.1| predicted protein [Physcomitrella patens]
 gb|EDQ70867.1| predicted protein [Physcomitrella patens]
Length=920

 Score =   404 bits (1039),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 203/267 (76%), Positives = 230/267 (86%), Gaps = 0/267 (0%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE  335
            G  LPPKEANLFK+IVKSYETKQYKKGLKA++ IL+KFP+HGETLAMKGLTLNCM RK E
Sbjct  3    GPVLPPKEANLFKLIVKSYETKQYKKGLKASDQILRKFPEHGETLAMKGLTLNCMDRKPE  62

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GLKNDLKSHVCWHVYGLLYRSDR+YREAIKCYR ALRIDP+NI+ILRDLSLLQ
Sbjct  63   AYELVRKGLKNDLKSHVCWHVYGLLYRSDRDYREAIKCYRCALRIDPENIQILRDLSLLQ  122

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
            AQMR+L GFVETR QLLTLKP+HR NWIGFA+AHH+N   + AV+IL+AYEGTLE+D+PP
Sbjct  123  AQMRELPGFVETRRQLLTLKPSHRNNWIGFAIAHHVNQQPAMAVNILDAYEGTLEEDFPP  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            E+ER EHGEMLLYK +LLEE G  E+ALEEL KKE KIVDKLG +E    L L+     E
Sbjct  183  ESERYEHGEMLLYKATLLEEAGHPEKALEELAKKEGKIVDKLGLREHRASLYLQTNRLSE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCLG  956
             E +Y+ LL +NPDNY YYEGLQ+CLG
Sbjct  243  AEEIYRKLLVVNPDNYHYYEGLQKCLG  269



>ref|XP_001776114.1| predicted protein [Physcomitrella patens]
 gb|EDQ59025.1| predicted protein [Physcomitrella patens]
Length=905

 Score =   402 bits (1034),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/267 (74%), Positives = 231/267 (87%), Gaps = 0/267 (0%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE  335
            G +LPPKE NLFK+IVKSYETKQYKKGLKA++ IL+KFP+HGETLAMKGL LNCM RK+E
Sbjct  3    GPALPPKENNLFKLIVKSYETKQYKKGLKASDQILRKFPEHGETLAMKGLILNCMDRKAE  62

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            A++LVR GLKNDLKSHVCWHVYGLLYRSDR+YREAIKCYR ALRIDP+NI+ILRDLSLLQ
Sbjct  63   AFELVRKGLKNDLKSHVCWHVYGLLYRSDRDYREAIKCYRCALRIDPENIQILRDLSLLQ  122

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
            AQMR+L+GFVETR QLLTLKP+HR NWIGFA+AHH+N   + AV+IL+AYEGTLE+D+PP
Sbjct  123  AQMRELVGFVETRRQLLTLKPSHRNNWIGFAIAHHINHEPAMAVNILDAYEGTLEEDFPP  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            E+ER EH EMLLYK ++LEE G  E+ALEEL KKE KIVDKLG +E    L L+  H  E
Sbjct  183  ESERYEHSEMLLYKATVLEEAGQPEKALEELAKKEEKIVDKLGLREHRASLYLQTNHVAE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCLG  956
             E +Y+ LL +NPDNY YYEG+Q+CLG
Sbjct  243  AEEIYRKLLDVNPDNYLYYEGVQKCLG  269



>ref|XP_001783197.1| predicted protein [Physcomitrella patens]
 gb|EDQ51965.1| predicted protein [Physcomitrella patens]
Length=902

 Score =   399 bits (1025),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 199/267 (75%), Positives = 228/267 (85%), Gaps = 0/267 (0%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE  335
            G  LPPKEANLFK+IVKSYETKQYKKGLKA++ IL+KFP+HGETLAMKGLTLNCM RKSE
Sbjct  3    GQVLPPKEANLFKLIVKSYETKQYKKGLKASDQILRKFPEHGETLAMKGLTLNCMDRKSE  62

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GLKND+KSHVCWHVYGLLYRSDR+YREAIKCYR ALRID  NI+ILRDLSLLQ
Sbjct  63   AYELVRKGLKNDVKSHVCWHVYGLLYRSDRDYREAIKCYRCALRIDSQNIQILRDLSLLQ  122

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
            AQMR+L GFVETR QLLTLKP+HR NWIGFA+AHH+N   + AV IL+AYEGTLE+D+PP
Sbjct  123  AQMRELPGFVETRRQLLTLKPSHRNNWIGFAIAHHVNHEPAMAVSILDAYEGTLEEDFPP  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            E+ER EH EMLLYK ++LEE G  E+A EEL K E KIVDKLG +E +  LLL++    E
Sbjct  183  ESERYEHSEMLLYKATVLEEAGQPEKAFEELAKNEGKIVDKLGLREHKASLLLQINRSAE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCLG  956
             E +Y+ LL +NPDNY YYEGLQ+CLG
Sbjct  243  AEDIYRKLLDINPDNYLYYEGLQKCLG  269



>ref|XP_008342751.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Malus domestica]
Length=398

 Score =   378 bits (970),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 192/221 (87%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = +3

Query  294  MKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  473
            MKGLTLNCM RKSEAY+LVR+GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID
Sbjct  1    MKGLTLNCMDRKSEAYELVRIGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  60

Query  474  PDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDI  653
            PDNIEILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHLNSN  KAV+I
Sbjct  61   PDNIEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNALKAVEI  120

Query  654  LEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKE  833
            LEAYEGTLEDDYPP+NERCEHGEMLLYKISLLEEC  +ERALEEL KKE +IVD+L YKE
Sbjct  121  LEAYEGTLEDDYPPDNERCEHGEMLLYKISLLEECSLIERALEELHKKESRIVDRLDYKE  180

Query  834  QEVCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            QEV LL+KL + EEG  LY+VLL MNPDNYRYY+GLQ+CLG
Sbjct  181  QEVSLLVKLGYLEEGAELYRVLLKMNPDNYRYYQGLQKCLG  221



>ref|XP_007217133.1| hypothetical protein PRUPE_ppa001163m2g, partial [Prunus persica]
 gb|EMJ18332.1| hypothetical protein PRUPE_ppa001163m2g, partial [Prunus persica]
Length=190

 Score =   360 bits (925),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 183/195 (94%), Gaps = 5/195 (3%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLPPKEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RKS
Sbjct  1    MGASLPPKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR+GLK+      CWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  61   EAYELVRIGLKS-----CCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  115

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAVA HLN+N  KAV+ILEAYEGTLEDDYP
Sbjct  116  QAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVAQHLNANALKAVEILEAYEGTLEDDYP  175

Query  693  PENERCEHGEMLLYK  737
            P+NERCEHGEMLLYK
Sbjct  176  PDNERCEHGEMLLYK  190



>ref|XP_010254212.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Nelumbo nucifera]
Length=856

 Score =   377 bits (967),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 191/221 (86%), Positives = 205/221 (93%), Gaps = 0/221 (0%)
 Frame = +3

Query  294  MKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  473
            MKGLTLNCM RK+EAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID
Sbjct  1    MKGLTLNCMDRKAEAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRID  60

Query  474  PDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDI  653
             DNIEILRDLSLLQAQMRDL GFVETR +LLTLKPNHRMNWIGFAVAHHLNS+GSKA++I
Sbjct  61   ADNIEILRDLSLLQAQMRDLTGFVETRQKLLTLKPNHRMNWIGFAVAHHLNSSGSKAIEI  120

Query  654  LEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKE  833
            LEAYEGTLEDDYPP+NERCEHGEMLLYKISLLEECG LERALEEL KKE KIVDKL  KE
Sbjct  121  LEAYEGTLEDDYPPDNERCEHGEMLLYKISLLEECGFLERALEELHKKESKIVDKLALKE  180

Query  834  QEVCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            QEV LL+KL    EGE++++ LLSMNPDNY+YYEGLQ+CLG
Sbjct  181  QEVSLLVKLGCLGEGEKIFRALLSMNPDNYKYYEGLQKCLG  221



>gb|EMS52083.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Triticum 
urartu]
Length=1034

 Score =   375 bits (963),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +3

Query  282  ETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNA  461
            ETL+MKGLTLNCM RKSEAY+LVR GLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNA
Sbjct  16   ETLSMKGLTLNCMDRKSEAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNA  75

Query  462  LRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSK  641
            LRIDPDNIEILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHL+SN SK
Sbjct  76   LRIDPDNIEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLSSNSSK  135

Query  642  AVDILEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKL  821
            A+++LEAYEGTLEDDYPPENER EHGEMLLYKISLLEECG L+RAL+E+ K E KIVDKL
Sbjct  136  AIEVLEAYEGTLEDDYPPENERYEHGEMLLYKISLLEECGMLDRALQEMHKMESKIVDKL  195

Query  822  GYKEQEVCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCLG  956
             ++EQ  C+LLKL  FEE E++Y+ LL MNPDNY+Y   +Q+CLG
Sbjct  196  SFREQMACILLKLGRFEEAEKIYRSLLFMNPDNYKYLIAVQKCLG  240



>gb|KJB13120.1| hypothetical protein B456_002G058200, partial [Gossypium raimondii]
Length=797

 Score =   351 bits (901),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 191/216 (88%), Gaps = 9/216 (4%)
 Frame = +3

Query  279  GETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRN  458
             ETL+MKGLTLNCM RK+EAY+LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRN
Sbjct  16   SETLSMKGLTLNCMDRKTEAYELVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRN  75

Query  459  ALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGS  638
            ALRIDPDNIEILRDLSLLQAQMRDL GFVETR QLLTLKPN RMNWIGFAVAHHLNSNG+
Sbjct  76   ALRIDPDNIEILRDLSLLQAQMRDLAGFVETRQQLLTLKPNQRMNWIGFAVAHHLNSNGA  135

Query  639  KAVDILEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDK  818
            KA +ILEAYEGTLEDDYPP+NERCEHGEMLLYKISLLEECG  ERALEEL KKE KIVD+
Sbjct  136  KAAEILEAYEGTLEDDYPPDNERCEHGEMLLYKISLLEECGFHERALEELHKKEPKIVDR  195

Query  819  LGYKEQEVCLLLKLRHFEEGERLYKVLLSMNPDNYR  926
            L YKEQEV L            +YK LL++NPDNYR
Sbjct  196  LTYKEQEVSL---------RTNIYKALLTLNPDNYR  222



>gb|EMT02816.1| NMDA receptor-regulated 1-like protein [Aegilops tauschii]
Length=942

 Score =   352 bits (903),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/268 (70%), Positives = 212/268 (79%), Gaps = 25/268 (9%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MG+SLP KEANLFKVIVKSYETKQYKKGLKAA++ILKKFP+HG   A     L C+    
Sbjct  1    MGSSLPAKEANLFKVIVKSYETKQYKKGLKAADSILKKFPEHG---ASSDRILLCL----  53

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
                   +  +N +             RSDREYREAIKCYRNALRIDPDNIEILRDLSLL
Sbjct  54   -------VSCRNFIDE-----------RSDREYREAIKCYRNALRIDPDNIEILRDLSLL  95

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+HHL+SN SKA+++LEAYEGTLEDDYP
Sbjct  96   QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSHHLSSNSSKAIEVLEAYEGTLEDDYP  155

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            PENER EHGEMLLYKISLLEECG L+RAL+E+ K E KIVDKL ++EQ  C+LLKL  FE
Sbjct  156  PENERYEHGEMLLYKISLLEECGMLDRALQEMHKMESKIVDKLSFREQMACILLKLGRFE  215

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E E++Y+ LL MNPDNY+Y   +Q+CLG
Sbjct  216  EAEKIYRSLLFMNPDNYKYLIAVQKCLG  243



>ref|XP_010474516.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=995

 Score =   339 bits (870),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  204  KSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSH  383
            KSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+EAY+LVRLG+KND+KSH
Sbjct  3    KSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKTEAYELVRLGVKNDIKSH  62

Query  384  VCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQL  563
            VCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLLQAQMRDL GFVETR QL
Sbjct  63   VCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQL  122

Query  564  LTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPENERCEHGEMLLYKI  740
            LTLKPNHRMNWIGFAV+ HLN+N SKAV+ILEAYEGTLEDDYPPENE  EH EM+LYK+
Sbjct  123  LTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEGTLEDDYPPENELIEHTEMILYKL  181


 Score =   263 bits (673),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +3

Query  447  CYRNA--LRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHH  620
            C R    LRIDPDN+EILRDLSLLQAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ H
Sbjct  196  CLRRVVXLRIDPDNLEILRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQH  255

Query  621  LNSNGSKAVDILEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkke  800
            LN+N SKAV+ILEAYEGTLEDDYPPENE  EH EM+LYK+SLLEE GS ++ALEEL KKE
Sbjct  256  LNANASKAVEILEAYEGTLEDDYPPENELIEHTEMILYKVSLLEESGSFDKALEELHKKE  315

Query  801  YKIVDKLGYKEQEVCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCLG  956
             KIVDKL YKEQEV LL KL H EE  +LY+VLLSMNPDNYRYYEGLQ+CLG
Sbjct  316  PKIVDKLSYKEQEVSLLSKLGHLEEATKLYRVLLSMNPDNYRYYEGLQKCLG  367



>ref|XP_010474515.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Camelina sativa]
Length=177

 Score =   313 bits (802),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGASLP KEANLFK+IVKSYETKQYKKGLKAA+AILKKFPDHGETL+MKGLTLNCM RK+
Sbjct  1    MGASLPTKEANLFKLIVKSYETKQYKKGLKAADAILKKFPDHGETLSMKGLTLNCMDRKT  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVRLG+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EILRDLSLL
Sbjct  61   EAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEILRDLSLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAV  647
            QAQMRDL GFVETR QLLTLKPNHRMNWIGFAV+ HLN+N SKAV
Sbjct  121  QAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAV  165



>ref|XP_005827391.1| hypothetical protein GUITHDRAFT_158303 [Guillardia theta CCMP2712]
 gb|EKX40411.1| hypothetical protein GUITHDRAFT_158303 [Guillardia theta CCMP2712]
Length=706

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 166/274 (61%), Positives = 201/274 (73%), Gaps = 6/274 (2%)
 Frame = +3

Query  144  SATMGASLPPKEANLFKVIV---KSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLN  314
            S++    LP KEA +FK IV   K YETKQYKKGLKAA++ILKK+P+HGETLAMKGLTLN
Sbjct  2    SSSNTQLLPQKEAAVFKTIVVRLKFYETKQYKKGLKAADSILKKYPEHGETLAMKGLTLN  61

Query  315  CMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEIL  494
            CM RK EAYD VRL LK ++ SHVCWHVYGLLYRSDR+Y+EAIKCY+ ALR D DN +IL
Sbjct  62   CMDRKQEAYDFVRLALKKNMLSHVCWHVYGLLYRSDRDYKEAIKCYKQALRRDKDNGQIL  121

Query  495  RDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGT  674
            RDL LLQ Q R+L GF+ETR QLL + P +R NW+GFAV+HH   +   A+ +LE+YEGT
Sbjct  122  RDLCLLQIQTRELTGFIETRRQLLAINPKNRNNWVGFAVSHHAAGDLDMALKVLESYEGT  181

Query  675  LEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLL  854
            LED     N   EH EMLLYK  +LEE G LE+ L  L K E  IVDK  ++E+   LLL
Sbjct  182  LED---TSNADYEHSEMLLYKAQVLEEKGELEKTLAHLEKSEPLIVDKQSFREKRAELLL  238

Query  855  KLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCLG  956
            KL   E+ E +Y+ LLS+N DNY+Y++GL    G
Sbjct  239  KLGRLEDAEAMYRELLSINSDNYQYHKGLLEARG  272



>ref|XP_009834389.1| hypothetical protein H257_09749 [Aphanomyces astaci]
 gb|ETV76264.1| hypothetical protein H257_09749 [Aphanomyces astaci]
Length=837

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 190/267 (71%), Gaps = 3/267 (1%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            M   LP KE  LF+ IVK YE KQYKKGLKAA+AILKKFPDHGETLAMKGLTLNCMG+K 
Sbjct  1    MANKLPSKENALFRSIVKCYEIKQYKKGLKAADAILKKFPDHGETLAMKGLTLNCMGKKE  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDNI+ILRDL L 
Sbjct  61   EAYEFVRQGVKQDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNIQILRDLYLQ  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR Q L+LKP +R NWIG A+AH LN     A+DI++ Y  TL+   P
Sbjct  121  QVQMRDLKGYAETRRQFLSLKPTNRNNWIGLAIAHQLNGTHETAIDIIDQYNETLD---P  177

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
                  +  EM LY+  L+EE G L   L  L   +  ++D L ++ ++  LL+K   F+
Sbjct  178  LRPVSYDDSEMYLYQNELIEEKGDLVACLAHLETTKSFVLDTLVWRHRKADLLVKQGDFD  237

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +   LY+ LL++NPD+Y Y+ GLQ  L
Sbjct  238  DAVVLYQELLAINPDHYHYHRGLQAAL  264



>ref|XP_002899585.1| N-terminal acetyltransferase A complex subunit nat1-like protein 
[Phytophthora infestans T30-4]
 gb|EEY61945.1| N-terminal acetyltransferase A complex subunit nat1-like protein 
[Phytophthora infestans T30-4]
Length=785

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/266 (59%), Positives = 195/266 (73%), Gaps = 3/266 (1%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK PDHGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPDHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAY+ V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYEFVKNGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI++ Y  TL+ +
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIDKYFSTLDGE  181

Query  687  YPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRH  866
              P     E  E+ LY+  L+EE G  E+AL  L + E +I D L ++++    LL+L  
Sbjct  182  SVP---NYEDSEIYLYQNQLIEEAGDAEKALAHLEENESQITDTLAWRQKRGQFLLQLER  238

Query  867  FEEGERLYKVLLSMNPDNYRYYEGLQ  944
            ++E   +++ LL +N DN  Y  G+Q
Sbjct  239  YDEARAVFEELLEINFDNEEYQRGVQ  264



>gb|ETL77843.1| hypothetical protein L917_21235 [Phytophthora parasitica]
Length=698

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L+EE G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIEESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL +N DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEINFDNEEFQRGVQ  264



>gb|ETL24634.1| hypothetical protein L916_21376, partial [Phytophthora parasitica]
Length=683

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA++HHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAISHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L+EE G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIEESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL +N DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEINFDNEEFQRGVQ  264



>gb|ETI30789.1| hypothetical protein F443_22116 [Phytophthora parasitica P1569]
Length=785

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L+EE G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIEESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL +N DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEINFDNEEFQRGVQ  264



>gb|ETM31097.1| hypothetical protein L914_21244 [Phytophthora parasitica]
Length=785

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L+EE G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIEESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL +N DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEINFDNEEFQRGVQ  264



>gb|ETP00579.1| hypothetical protein F441_22010 [Phytophthora parasitica CJ01A1]
Length=785

 Score =   309 bits (791),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L+EE G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIEESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL +N DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEINFDNEEFQRGVQ  264



>gb|ETK71183.1| hypothetical protein L915_21512 [Phytophthora parasitica]
Length=698

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA++HHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAISHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L+EE G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIEESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL +N DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEINFDNEEFQRGVQ  264



>ref|XP_008915357.1| hypothetical protein PPTG_18551 [Phytophthora parasitica INRA-310]
 gb|ETM99316.1| hypothetical protein PPTG_18551 [Phytophthora parasitica INRA-310]
 gb|ETO74485.1| hypothetical protein F444_09820 [Phytophthora parasitica P1976]
Length=785

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPVKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L+EE G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIEESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL +N DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEINFDNEEFQRGVQ  264



>ref|XP_009526689.1| hypothetical protein PHYSODRAFT_331569 [Phytophthora sojae]
 gb|EGZ17631.1| hypothetical protein PHYSODRAFT_331569 [Phytophthora sojae]
Length=785

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/260 (60%), Positives = 198/260 (76%), Gaps = 3/260 (1%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAYD  344
            LP KE+ LF+ IVK+YE KQYKKGLKAA+ ILKK+P+HGETLAMKGLTLNCMGRK EAY+
Sbjct  7    LPAKESALFRSIVKNYEIKQYKKGLKAADTILKKYPEHGETLAMKGLTLNCMGRKEEAYE  66

Query  345  LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQM  524
             V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL LLQ QM
Sbjct  67   FVKSGLRHDLRSHVCWHVFGLLYRSDRNYPEAIKCYRNAIRIDPENLQILRDLYLLQVQM  126

Query  525  RDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPENE  704
            RDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL D  P  N 
Sbjct  127  RDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL-DGEPVAN-  184

Query  705  RCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEGER  884
              E  E+ LY+  LLEE G +E+AL+ L   + +I D L +++++   LL+L  ++E   
Sbjct  185  -YEDSEIHLYQNQLLEEAGDIEKALKHLEDTKSQITDTLYWRQKKGQFLLQLERYDEARA  243

Query  885  LYKVLLSMNPDNYRYYEGLQ  944
            +++ LL +N DNY +  G+Q
Sbjct  244  VFEELLEINFDNYEFQRGMQ  263



>ref|XP_008876110.1| hypothetical protein H310_11284 [Aphanomyces invadans]
 gb|ETV95409.1| hypothetical protein H310_11284 [Aphanomyces invadans]
Length=842

 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 190/267 (71%), Gaps = 3/267 (1%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            M   LP KE  LF+ IVK YE KQYKKGLKAA+AILKKFPDHGETLAMKGLTLNCMG+K 
Sbjct  1    MANKLPSKENALFRSIVKCYEIKQYKKGLKAADAILKKFPDHGETLAMKGLTLNCMGKKE  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDNI+ILRDL L 
Sbjct  61   EAYEFVRQGVKQDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNIQILRDLYLQ  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR Q L LKP +R NWIG A+AH LN     A+DIL+ Y  TL    P
Sbjct  121  QVQMRDLKGYAETRRQFLALKPTNRNNWIGLAIAHQLNGTYDTAIDILDQYNDTLS---P  177

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
                  +  EM LY+  L+EE G LER L  L   +  ++D L +++++  +L+KL  F+
Sbjct  178  TREGTYDDSEMYLYQNELIEEKGDLERCLAHLETIKPFVLDTLVWRQRKADMLVKLGQFD  237

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +   +Y+ LL +N D+Y Y+ G+Q  L
Sbjct  238  DAVAIYQELLDINGDHYHYHRGIQAAL  264



>ref|XP_008607810.1| hypothetical protein SDRG_03939 [Saprolegnia diclina VS20]
 gb|EQC38986.1| hypothetical protein SDRG_03939 [Saprolegnia diclina VS20]
Length=841

 Score =   306 bits (785),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 191/268 (71%), Gaps = 5/268 (2%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            M   LP KE+ LF+ IVK YE KQYKKGLKAA+AILKKFP+HGETLAMKGLTLNCMG+K 
Sbjct  1    MSKQLPSKESTLFRSIVKYYEIKQYKKGLKAADAILKKFPEHGETLAMKGLTLNCMGKKE  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDN +ILRDL LL
Sbjct  61   EAYEFVRQGVKRDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNAQILRDLYLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR   LTLKPN+R NWIG A+AHHL+     A+DIL+ Y  TLE    
Sbjct  121  QVQMRDLKGYCETRRMFLTLKPNNRNNWIGLAIAHHLHGTHQTAIDILDKYSATLESS--  178

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEV-CLLLKLRHF  869
              +   +  EM LY+  +++E G +   L  L   +  ++D L +++++  CL+L+  H 
Sbjct  179  -RDANYDDSEMYLYQNEIIQETGDIAACLAHLETIKPYVLDTLVWRQRKAECLILQGAH-  236

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            ++   +Y  LL +N DNY Y+ G+Q  L
Sbjct  237  DDAMAIYAELLDINMDNYAYHRGVQAAL  264



>emb|CCI42224.1| unnamed protein product [Albugo candida]
Length=794

 Score =   305 bits (782),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 158/264 (60%), Positives = 199/264 (75%), Gaps = 4/264 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCM-GRKSEAY  341
            LP KEA+LF+ IVK YE KQYKKGLK ++ ILKK+P+HGETLAMKGL L+CM GRK EAY
Sbjct  8    LPSKEASLFRSIVKHYELKQYKKGLKTSDLILKKYPEHGETLAMKGLLLSCMNGRKEEAY  67

Query  342  DLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQ  521
            +  RLGLKNDLKSHVCWHVYGLLYRSDR Y EAIKCYRNA+R+DP N++ILRDL LLQ Q
Sbjct  68   EFARLGLKNDLKSHVCWHVYGLLYRSDRNYHEAIKCYRNAIRLDPQNVQILRDLYLLQVQ  127

Query  522  MRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPEN  701
            MRDL GF ETR  +LTL PN+R NWIGFA+AHHL  N   A+DI++ Y GTLE +  P  
Sbjct  128  MRDLRGFAETRRAILTLMPNNRNNWIGFAIAHHLLGNYQMAIDIIKKYVGTLEPNTSPS-  186

Query  702  ERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEGE  881
               E  EM LY+  LL+E G++++ALE L +K+  I+D L +++++   L++L  ++E  
Sbjct  187  --YEDSEMYLYQNQLLQESGNIDKALEHLMEKQNFILDTLAWRQKKAEFLVQLERYDEAV  244

Query  882  RLYKVLLSMNPDNYRYYEGLQRCL  953
              Y+ LL +N DN+ Y+ GLQ  L
Sbjct  245  IAYEELLDINVDNFIYHHGLQSAL  268



>gb|ETP28747.1| hypothetical protein F442_21980 [Phytophthora parasitica P10297]
Length=785

 Score =   305 bits (782),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/269 (58%), Positives = 196/269 (73%), Gaps = 9/269 (3%)
 Frame = +3

Query  147  ATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGR  326
            A     LP KE+ LF+ IVK YE KQYKKGLKAA+AILKK P+HGETLAMKGLTLNCMGR
Sbjct  2    AVASKQLPAKESALFRSIVKCYEIKQYKKGLKAADAILKKHPEHGETLAMKGLTLNCMGR  61

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K EAYD V+ GL++DL+SHVCWHV+GLLYRSDR Y EAIKCYRNA+RIDP+N++ILRDL 
Sbjct  62   KEEAYDFVKSGLRHDLRSHVCWHVFGLLYRSDRNYNEAIKCYRNAIRIDPENLQILRDLY  121

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GF ETR  +LTLKPN+R NWIGFA+AHHL  N   A+DI+E Y  TL   
Sbjct  122  LLQVQMRDLKGFAETRRTMLTLKPNNRNNWIGFAIAHHLVGNYQMAIDIIEKYFSTL---  178

Query  687  YPPENERC---EHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
               E ER    E  E+ LY+  L++E G  E+AL  L + + +I D L +++++   LL+
Sbjct  179  ---EGERVSNYEDSEIYLYQNQLIDESGDAEKALAHLEENKSQITDTLAWRQKKGQFLLQ  235

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  ++E   +++ LL ++ DN  +  G+Q
Sbjct  236  LERYDEAHEVFEELLEISFDNEEFQRGVQ  264



>ref|XP_005847916.1| hypothetical protein CHLNCDRAFT_35269 [Chlorella variabilis]
 gb|EFN55814.1| hypothetical protein CHLNCDRAFT_35269 [Chlorella variabilis]
Length=736

 Score =   303 bits (777),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 191/261 (73%), Gaps = 11/261 (4%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAY  341
            +LP KEA LF+ + K YETKQYKKG+K A+AILKKFP+HGETLAMKGL LNC+ RK EAY
Sbjct  12   TLPSKEAGLFRQLAKQYETKQYKKGVKNADAILKKFPEHGETLAMKGLLLNCLERKEEAY  71

Query  342  DLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQ  521
            +LV+ G+KNDL+SHVCWHVYGLLYRSDREY EAIKCY+NALR+D +N+ ++RDL+LLQ Q
Sbjct  72   ELVKRGVKNDLRSHVCWHVYGLLYRSDREYDEAIKCYKNALRMDKENLTVMRDLALLQIQ  131

Query  522  MRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPEN  701
            MRDL GF+ETR  LL LK N++ NWI FA+AHHLN +   A  +LE+Y  T++++ P  N
Sbjct  132  MRDLPGFLETRQTLLELKSNNKHNWISFALAHHLNGHHEVAAKVLESYAATVDEEGPGSN  191

Query  702  --ERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
              E  EH EM+LYK  +LEE                ++ D LG KEQ+  LLL L   EE
Sbjct  192  SSEAYEHSEMVLYKAMVLEEGDGTAAR---------RLRDPLGVKEQQARLLLALGRQEE  242

Query  876  GERLYKVLLSMNPDNYRYYEG  938
             E  Y+ L+++N +NY+Y+ G
Sbjct  243  AEVAYRRLITINTENYQYHAG  263



>gb|KDO25758.1| hypothetical protein SPRG_09056 [Saprolegnia parasitica CBS 223.65]
Length=841

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 191/268 (71%), Gaps = 5/268 (2%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            M   LP KE+ LF+ IVK YE KQYKKGLKAA+AILKKFP+HGETLAMKGLTLNCMG+K 
Sbjct  1    MSKQLPSKESTLFRSIVKYYEIKQYKKGLKAADAILKKFPEHGETLAMKGLTLNCMGKKE  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR G+K DLKSHVCWHVYGLLYRSDR Y EAIKCYR ALRIDPDN +ILRDL LL
Sbjct  61   EAYEFVRQGVKRDLKSHVCWHVYGLLYRSDRNYAEAIKCYRQALRIDPDNAQILRDLYLL  120

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR   LTLKPN+R NWIG A+AHHL+     A+DIL+ Y  TLE    
Sbjct  121  QVQMRDLKGYCETRRMFLTLKPNNRNNWIGLAIAHHLHGTHQTAIDILDKYSATLE---T  177

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEV-CLLLKLRHF  869
              +   +  EM LY+  +++E G +   L  L   +  ++D L +++++  CL+L+   +
Sbjct  178  SRDANYDDSEMYLYQNEIIQETGDIAACLSHLETIKPYVLDTLVWRQRKAECLILQ-GAY  236

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   +Y  LL +N DNY Y+ G+Q  L
Sbjct  237  DEAMAIYAELLEINMDNYAYHRGVQAAL  264



>ref|XP_010574853.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Haliaeetus leucocephalus]
Length=304

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQIPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLIVEEIKGEMLLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +YK L+  N +N+ YYEGL++ L
Sbjct  244  GEVYKELIERNAENWHYYEGLEKAL  268



>ref|XP_004376674.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Trichechus manatus latirostris]
Length=306

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+GRK
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGRK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_008166844.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Chrysemys picta bellii]
Length=320

 Score =   273 bits (698),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQIPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +YK L+  N +N+ YYEGL++ L
Sbjct  244  GEIYKELIDRNAENWYYYEGLEKAL  268



>ref|XP_007501585.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Monodelphis domestica]
Length=340

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQI  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEAGEIFKDLIDRNAENWNYYEGLEKAL  268



>ref|XP_011368048.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Pteropus vampyrus]
 ref|XP_011368049.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Pteropus vampyrus]
Length=311

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 190/267 (71%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     P
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVP  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P     E+ E++LY+  ++ E   ++ +LE +   E +I DKL  +E +  +LLKL   +
Sbjct  182  PNKIDYEYSELILYQNQVMREADLVQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRLK  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   ++K L+  N +N+ YYEGL++ L
Sbjct  242  EASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_002946235.1| hypothetical protein VOLCADRAFT_55571 [Volvox carteri f. nagariensis]
 gb|EFJ53230.1| hypothetical protein VOLCADRAFT_55571 [Volvox carteri f. nagariensis]
Length=760

 Score =   284 bits (726),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 153/269 (57%), Positives = 195/269 (72%), Gaps = 8/269 (3%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSE---  335
            LP KEA LFK +++ +E+KQYKK +K A+ ILKKF +HGETLAMKGL L  +   SE   
Sbjct  12   LPSKEAGLFKQVLRYHESKQYKKAIKTADQILKKFAEHGETLAMKGLCLRNLAPDSEKEK  71

Query  336  ---AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
               AY+LVR G+K DLKSHVCWHVYGLLYR DREY+EAIKCY NALRID +NI+ILRDL+
Sbjct  72   KEEAYELVRKGVKCDLKSHVCWHVYGLLYRQDREYKEAIKCYLNALRIDKENIQILRDLA  131

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRDL GFV+TR QLLTLKP++R +WI FAVAHH+N N   AV +L+ +E TL  D
Sbjct  132  LLQIQMRDLQGFVDTRHQLLTLKPSNRSHWITFAVAHHMNGNHELAVQVLDQFERTL--D  189

Query  687  YPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRH  866
              P +E  EH EMLLY  ++L + G  E ALE + K++ KI D+LG  E +  LLL++  
Sbjct  190  EVPASEAYEHSEMLLYAATVLADGGKPEEALEYVEKRKDKIKDRLGLAEMQAGLLLRVGR  249

Query  867  FEEGERLYKVLLSMNPDNYRYYEGLQRCL  953
              E    Y+ LL+ NP+NY+ ++GL+  +
Sbjct  250  KAEAAASYRRLLATNPNNYKIHDGLRAAM  278



>ref|XP_008166841.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Chrysemys picta bellii]
Length=365

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQIPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +YK L+  N +N+ YYEGL++ L
Sbjct  244  GEIYKELIDRNAENWYYYEGLEKAL  268



>ref|XP_004433676.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 3 [Ceratotherium simum simum]
 ref|XP_004433677.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 4 [Ceratotherium simum simum]
Length=311

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYERQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_006076577.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Bubalus bubalis]
Length=311

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_004405382.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Odobenus rosmarus divergens]
Length=313

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_004054472.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Gorilla gorilla gorilla]
 ref|XP_009438835.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Pan troglodytes]
 ref|XP_011798353.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Colobus angolensis palliatus]
Length=311

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_009190099.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Papio anubis]
Length=339

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010844474.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X11 [Bison bison bison]
 ref|XP_010844475.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X11 [Bison bison bison]
Length=311

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005652238.1| N-terminal acetyltransferase A, auxiliary subunit [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27694.1| N-terminal acetyltransferase A, auxiliary subunit [Coccomyxa 
subellipsoidea C-169]
Length=873

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 191/269 (71%), Gaps = 5/269 (2%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCM--GRK  329
            G  LP KEA LF+ +VK YETKQYKK +KAAE +LKK+PDHGETLAMKGLTLN M   +K
Sbjct  6    GQVLPTKEAGLFRQVVKYYETKQYKKAIKAAEQVLKKYPDHGETLAMKGLTLNNMDPSKK  65

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+L R G+KN+LKSHV WHVYGLLYR D+ Y EAIKCY+NALRID +N +ILRDLS 
Sbjct  66   EEAYELARRGIKNNLKSHVTWHVYGLLYRGDQNYDEAIKCYKNALRIDKENYQILRDLSN  125

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRD+ GFVETR  +L  K +++ +WI FA+AHHLN +   A   L+ Y    E+  
Sbjct  126  LQIQMRDIPGFVETRTAMLAQKASNKSHWISFAIAHHLNGSHQLAAHALKTYADMQEE--  183

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P +E  EH EM+LY+  +LEE G  E AL  L   +  I D++G  EQ   LLLKL   
Sbjct  184  VPASEAYEHSEMILYRALVLEEGGQTEEALAYLDTSKELIKDRIGLMEQRGRLLLKLPQK  243

Query  870  EE-GERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E  E +Y+ LL++NPDN++Y+EGL+  L
Sbjct  244  QEAAEDIYRKLLALNPDNHKYHEGLRAAL  272



>ref|NP_060997.2| N-alpha-acetyltransferase 16, NatA auxiliary subunit isoform 
2 [Homo sapiens]
 gb|AAH32318.1| NMDA receptor regulated 1-like [Homo sapiens]
 gb|EAX08657.1| NMDA receptor regulated 1-like, isoform CRA_d [Homo sapiens]
 gb|ADQ32355.1| NMDA receptor regulated 1-like [synthetic construct]
 gb|AIC63563.1| NAA16, partial [synthetic construct]
Length=311

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 190/265 (72%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E   L+ +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_008996433.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Callithrix jacchus]
Length=324

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +L+ +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKMDYEYSELILYQNQVMREADLFQESLDHIETYEKQICDKLLVEEIKGEILLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YY+GL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYDGLEKAL  268



>ref|XP_011998819.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X14 [Ovis aries musimon]
Length=311

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E ++ DKL  +E +  +LLKL   
Sbjct  181  PPSKVDYEYSELILYQNQVMREADLFQESLEHIETYEKQVCDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010844470.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X9 [Bison bison bison]
Length=365

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007186857.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Balaenoptera acutorostrata scammoni]
Length=311

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010844471.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X10 [Bison bison bison]
 ref|XP_010844472.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X10 [Bison bison bison]
Length=345

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007468672.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Lipotes vexillifer]
Length=396

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKLILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010574846.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Haliaeetus leucocephalus]
Length=477

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQIPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLIVEEIKGEMLLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +YK L+  N +N+ YYEGL++ L
Sbjct  244  GEVYKELIERNAENWHYYEGLEKAL  268



>emb|CCA19584.1| Nterminal acetyltransferase A complex subunit nat1like protein 
putative [Albugo laibachii Nc14]
Length=816

 Score =   282 bits (722),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 184/246 (75%), Gaps = 4/246 (2%)
 Frame = +3

Query  210  YETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCM-GRKSEAYDLVRLGLKNDLKSHV  386
            Y  KQYKKGLK +++ILKK+P+HGETL+MKGL L+CM GRK EAYD  RLGLKNDLKSHV
Sbjct  46   YCVKQYKKGLKTSDSILKKYPEHGETLSMKGLLLSCMNGRKEEAYDFARLGLKNDLKSHV  105

Query  387  CWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLL  566
            CWHVYGLLYRSDR Y EAIKCYRNA+R+DP N++ILRDL LLQ QMRDL GF ETR  +L
Sbjct  106  CWHVYGLLYRSDRNYNEAIKCYRNAIRLDPQNVQILRDLYLLQVQMRDLRGFAETRRAIL  165

Query  567  TLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPENERCEHGEMLLYKISL  746
            TL PN+R NWIGFA+AHHL  N   A+DI+  Y GTL+ + P      E  EM LY+  L
Sbjct  166  TLMPNNRNNWIGFAIAHHLLGNYQMAIDIINKYVGTLDTNTPTSY---EDSEMYLYQNQL  222

Query  747  LEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEGERLYKVLLSMNPDNYR  926
            ++E G +++AL+ L +K+  I+D L +++++   L++L  F+E    Y+ LL +N DN+ 
Sbjct  223  IQESGDIDQALQHLMEKKTVILDTLAWRQRKAEFLVQLERFDEAVGGYEELLDINCDNFI  282

Query  927  YYEGLQ  944
            Y+ GLQ
Sbjct  283  YHHGLQ  288



>ref|XP_004054473.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Gorilla gorilla gorilla]
Length=429

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|NP_001104268.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit isoform 
3 [Homo sapiens]
 gb|AAH64592.1| NARG1L protein [Homo sapiens]
 gb|EAX08654.1| NMDA receptor regulated 1-like, isoform CRA_a [Homo sapiens]
Length=429

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 190/265 (72%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E   L+ +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005789742.1| hypothetical protein EMIHUDRAFT_454943 [Emiliania huxleyi CCMP1516]
 gb|EOD37313.1| hypothetical protein EMIHUDRAFT_454943 [Emiliania huxleyi CCMP1516]
Length=716

 Score =   280 bits (716),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 190/265 (72%), Gaps = 5/265 (2%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            M   LP KEA LFK IVK YE K YKKGL+AA+ +LKKFP+HGET+AMK   +NC+ +K 
Sbjct  1    MAPPLPAKEATLFKAIVKHYELKSYKKGLRAADQVLKKFPEHGETIAMK---VNCLEKKG  57

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
              + L R GLK D+KS VCWHVYGLLYRSDREY +AIKCYR ALR +PDN++ILRDLS+L
Sbjct  58   GGFALFRKGLKLDIKSQVCWHVYGLLYRSDREYAQAIKCYRGALRHEPDNVKILRDLSML  117

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q Q+R L GF+ETR +LLT+KP +RM+W  FAVA HL     +AV ++EAYE TLE    
Sbjct  118  QIQLRLLPGFLETRQKLLTMKPTNRMHWFTFAVALHLVGRYDEAVGVVEAYERTLEGSDE  177

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKL-RHF  869
            P  E  E+ EMLLYK +L EE G  ++AL++L   + K+ D+ G++E+   LLL + RH 
Sbjct  178  PSKEPYEYSEMLLYKNTLYEEAGQPQKALDDLDAIKEKVADRTGWRERRAALLLAVGRHG  237

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQ  944
            E GE  Y  LL  NP+++ ++ GLQ
Sbjct  238  EAGEE-YLALLKRNPEHFGWHAGLQ  261



>ref|XP_005585790.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Macaca fascicularis]
Length=382

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|NP_001096570.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Bos taurus]
 gb|AAI42457.1| NARG1L protein [Bos taurus]
 tpg|DAA23950.1| TPA: NMDA receptor regulated 1-like protein [Bos taurus]
Length=396

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLK+   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKVGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>gb|KHN20434.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=192

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 142/192 (74%), Gaps = 36/192 (19%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKS  332
            MGA LPPKEANLFK+IVKSYETKQYKKGLKAA  ILKKFPDHGETL+MKGLTLNCM   S
Sbjct  1    MGAFLPPKEANLFKLIVKSYETKQYKKGLKAANTILKKFPDHGETLSMKGLTLNCMDHGS  60

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GLKNDLKSHVCW+VYGLLYRS+REYREAIKCYRNA +IDPDNIEI RDL LL
Sbjct  61   EAYELVRQGLKNDLKSHVCWYVYGLLYRSNREYREAIKCYRNAHKIDPDNIEISRDLLLL  120

Query  513  QA------------------------------------QMRDLIGFVETRLQLLTLKPNH  584
            QA                                    QM+DL GFVETR QLL LK NH
Sbjct  121  QARLTIKVEGKSLSSLLPFGIFHYIAKGHITGELEGCTQMQDLTGFVETRQQLLMLKSNH  180

Query  585  RMNWIGFAVAHH  620
            RMNWIGFAVAHH
Sbjct  181  RMNWIGFAVAHH  192



>ref|XP_011401267.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Auxenochlorella 
protothecoides]
 gb|KFM28253.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Auxenochlorella 
protothecoides]
Length=802

 Score =   281 bits (719),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 187/266 (70%), Gaps = 3/266 (1%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLTLNCMGRKSEAYD  344
            LP KEA LF+ +VK YETKQYKKGLK A+AILK+F +HGETLAMKGL  NC+G K  A D
Sbjct  11   LPGKEAGLFRQLVKQYETKQYKKGLKTADAILKRFSEHGETLAMKGLLQNCLGHKEVALD  70

Query  345  LVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQM  524
            LV+ G+KN+L+SHVCWHV+GL+ +SD  + EA+KCY+NALRID +N+ ILRDLS+LQ QM
Sbjct  71   LVKRGVKNNLRSHVCWHVFGLIQQSDENFDEAMKCYKNALRIDRENLTILRDLSVLQIQM  130

Query  525  RDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPENE  704
            RDL GF+ETR  LL LK  +R NW+ FAVAHHLN N   AV +L++Y  T+ D+    +E
Sbjct  131  RDLPGFLETRQTLLELKATNRQNWLAFAVAHHLNGNHDVAVKVLDSYGATM-DEEAAAHE  189

Query  705  RCEHGEMLLYKISLLEECGSleraleelrkkeYK--IVDKLGYKEQEVCLLLKLRHFEEG  878
              E  E+LLYK  +LEE G  E AL  +     K  + D+LG       LL KL   EE 
Sbjct  190  PYETSEVLLYKAQILEEGGQAEEALAAIDAAVGKRLLKDRLGVLTGRARLLTKLGRTEEA  249

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E +Y  LL +NP+N++Y+ GL+  LG
Sbjct  250  EGVYWELLGINPENHQYHAGLRTALG  275



>ref|XP_004274602.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Orcinus orca]
Length=311

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKLILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  SPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010844469.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X8 [Bison bison bison]
Length=402

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>gb|AAH44392.1| Narg1b protein, partial [Danio rerio]
Length=629

 Score =   277 bits (709),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNSKFSEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQT--S  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G L  ALE L   E +I DKL  +E +  LLL L  FE
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLLREALEHLTTYEKQICDKLAVEETKGELLLNLERFE  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL+R L
Sbjct  242  EAADVYRRLQERNPENWLYYHGLERAL  268



>ref|XP_006003551.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Latimeria chalumnae]
Length=520

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 187/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRD  G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDFEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E+LLY+  ++ E    + +LE +   E +I DKL  +E +  +LL L   EE 
Sbjct  184  KIDYEYSELLLYQNQVMREADLFQESLEHIEAYEKQICDKLAAEEIKGEMLLNLGRLEEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +Y+ L+  N +N+ YYEGL++ L
Sbjct  244  AAVYRGLIDRNSENWSYYEGLEKAL  268



>gb|AAH71438.1| Narg1b protein, partial [Danio rerio]
Length=633

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNSKFSEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQT--S  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G L  ALE L   E +I DKL  +E +  LLL L  FE
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLLREALEHLTTYEKQICDKLAVEETKGELLLNLERFE  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL+R L
Sbjct  242  EAADVYRRLQERNPENWLYYHGLERAL  268



>ref|XP_005710461.1| unnamed protein product [Chondrus crispus]
 emb|CDF40167.1| unnamed protein product [Chondrus crispus]
Length=857

 Score =   282 bits (721),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 149/272 (55%), Positives = 188/272 (69%), Gaps = 4/272 (1%)
 Frame = +3

Query  129  STTPCSATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILKKFPDHGETLAMKGLT  308
            S  P  +T   +LPPKEANLFK +V+ YETKQ KK LK+A++ILK+FP HGETLAMKGLT
Sbjct  2    SPNPAGST---ALPPKEANLFKAVVRLYETKQLKKALKSADSILKRFPHHGETLAMKGLT  58

Query  309  LNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIE  488
            LN + +K EA DLVR GL+ D++SH+CWHVYGLLYRSDR+YREA K Y NAL+ D DN +
Sbjct  59   LNALDKKPEATDLVRRGLRMDMRSHICWHVYGLLYRSDRDYREAAKAYLNALKFDKDNQQ  118

Query  489  ILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYE  668
            ILRDL+LLQ Q+RD  G  +TR  LLT++P+ R NWIGFA++ HL  N S AV +L+ Y 
Sbjct  119  ILRDLALLQIQIRDYEGLEDTRRTLLTVRPSQRHNWIGFALSFHLLDNYSMAVSVLDTYR  178

Query  669  GTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCL  848
             TL+    PE+ R E  E+LLYK  +LEE G    AL+ +     K+VDKL  +E +  +
Sbjct  179  ETLKQSNDPED-RYEASELLLYKAFVLEESGEHAAALQHIADCGPKLVDKLALRETKARI  237

Query  849  LLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQ  944
            L  L  F+E       LL +NPDN  Y  GLQ
Sbjct  238  LGALGRFDEAAEELVALLRINPDNRIYQRGLQ  269



>ref|XP_004577510.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Ochotona princeps]
Length=311

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK ++K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRVLKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
              AY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EAAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +W+G+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWVGYAIAYHLLKDYDMALKLLEEFRQT--QHI  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    +++LE +   E ++ DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQQSLEHIETYEKQVCDKLLVEEIKGEILLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
             E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  SEASEVFKKLIDRNAENWCYYEGLEKAL  268



>ref|XP_004405994.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Odobenus rosmarus divergens]
Length=526

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_004433675.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 2 [Ceratotherium simum simum]
Length=515

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYERQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_004426542.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Ceratotherium simum simum]
Length=526

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_006076576.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Bubalus bubalis]
Length=517

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010844468.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Bison bison bison]
Length=517

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005895886.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Bos mutus]
 ref|XP_006200156.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Vicugna pacos]
 ref|XP_006872288.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Chrysochloris asiatica]
 ref|XP_011841032.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Mandrillus leucophaeus]
 dbj|BAB14562.1| unnamed protein product [Homo sapiens]
 gb|EAX05120.1| NMDA receptor regulated 1, isoform CRA_b [Homo sapiens]
Length=526

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_007523818.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X3 [Erinaceus europaeus]
Length=526

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_004385540.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Trichechus manatus latirostris]
Length=526

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_004265192.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform 2 [Orcinus orca]
Length=526

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_011998818.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X13 [Ovis aries musimon]
Length=517

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E ++ DKL  +E +  +LLKL   
Sbjct  181  PPSKVDYEYSELILYQNQVMREADLFQESLEHIETYEKQVCDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007456941.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Lipotes vexillifer]
Length=526

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>gb|EAX08658.1| NMDA receptor regulated 1-like, isoform CRA_e [Homo sapiens]
Length=516

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 190/265 (72%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E   L+ +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005585789.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Macaca fascicularis]
Length=516

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007958425.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Chlorocebus sabaeus]
Length=516

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGKLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007501584.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Monodelphis domestica]
Length=553

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQI  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEAGEIFKDLIDRNAENWNYYEGLEKAL  268



>ref|XP_009438834.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Pan troglodytes]
Length=530

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_011533530.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Homo sapiens]
 emb|CAE45801.1| hypothetical protein [Homo sapiens]
 gb|EAX08659.1| NMDA receptor regulated 1-like, isoform CRA_f [Homo sapiens]
Length=530

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 190/265 (72%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E   L+ +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_011368047.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Pteropus vampyrus]
Length=530

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 190/267 (71%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     P
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVP  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P     E+ E++LY+  ++ E   ++ +LE +   E +I DKL  +E +  +LLKL   +
Sbjct  182  PNKIDYEYSELILYQNQVMREADLVQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRLK  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   ++K L+  N +N+ YYEGL++ L
Sbjct  242  EASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010372810.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Rhinopithecus roxellana]
Length=530

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005585788.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Macaca fascicularis]
 ref|XP_011756707.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Macaca nemestrina]
Length=530

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_011368044.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Pteropus vampyrus]
 ref|XP_011368045.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Pteropus vampyrus]
Length=542

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 190/267 (71%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     P
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVP  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P     E+ E++LY+  ++ E   ++ +LE +   E +I DKL  +E +  +LLKL   +
Sbjct  182  PNKIDYEYSELILYQNQVMREADLVQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRLK  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   ++K L+  N +N+ YYEGL++ L
Sbjct  242  EASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007958423.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Chlorocebus sabaeus]
Length=530

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGKLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005737422.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Pundamilia nyererei]
Length=865

 Score =   280 bits (715),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEALEHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ LL  NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLLERNPENWSYYHGLEKAL  268



>ref|XP_006887091.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Elephantulus edwardii]
Length=526

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLHLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_007939400.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Orycteropus afer afer]
Length=526

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL+  L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLENAL  268



>ref|XP_005470119.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Oreochromis niloticus]
Length=865

 Score =   279 bits (714),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEALEHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ LL  NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLLERNPENWSYYHGLEKAL  268



>ref|XP_005737421.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Pundamilia nyererei]
Length=864

 Score =   279 bits (714),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEALEHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ LL  NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLLERNPENWSYYHGLEKAL  268



>ref|XP_004538871.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Maylandia zebra]
Length=864

 Score =   279 bits (714),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEALEHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ LL  NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLLERNPENWSYYHGLEKAL  268



>ref|NP_976066.1| N(alpha)-acetyltransferase 15, NatA auxiliary subunit b [Danio 
rerio]
 gb|AAQ91276.1| transcriptional coactivator tubedown-100 [Danio rerio]
Length=863

 Score =   279 bits (714),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNSKFSEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  N   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLKNYEMAAKIIEEFRKTQQT--S  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G L  ALE L   E +I DKL  +E +  LLL L  FE
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLLREALEHLTTYEKQICDKLAVEEHKDELLLNLERFE  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL+R L
Sbjct  242  EAADVYRRLQERNPENWLYYHGLERAL  268



>ref|XP_003448033.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Oreochromis niloticus]
Length=864

 Score =   279 bits (714),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEALEHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ LL  NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLLERNPENWSYYHGLEKAL  268



>ref|XP_010844467.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Bison bison bison]
Length=555

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_011368046.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Pteropus vampyrus]
Length=539

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 190/267 (71%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
              LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLL
Sbjct  64   EAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     P
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVP  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P     E+ E++LY+  ++ E   ++ +LE +   E +I DKL  +E +  +LLKL   +
Sbjct  182  PNKIDYEYSELILYQNQVMREADLVQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRLK  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   ++K L+  N +N+ YYEGL++ L
Sbjct  242  EASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_006076575.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X6 [Bubalus bubalis]
Length=555

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007186856.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X7 [Balaenoptera acutorostrata scammoni]
Length=530

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_011998815.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X11 [Ovis aries musimon]
Length=555

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E ++ DKL  +E +  +LLKL   
Sbjct  181  PPSKVDYEYSELILYQNQVMREADLFQESLEHIETYEKQVCDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_011998814.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X10 [Ovis aries musimon]
Length=569

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E ++ DKL  +E +  +LLKL   
Sbjct  181  PPSKVDYEYSELILYQNQVMREADLFQESLEHIETYEKQVCDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_007501583.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X4 [Monodelphis domestica]
Length=653

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQI  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEAGEIFKDLIDRNAENWNYYEGLEKAL  268



>ref|XP_005919211.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Haplochromis burtoni]
Length=865

 Score =   278 bits (712),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEALEHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ LL  NP+N+ YY GL++ +
Sbjct  242  EATEVYRRLLERNPENWSYYHGLEKAI  268



>ref|XP_005919210.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Haplochromis burtoni]
Length=864

 Score =   278 bits (712),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEALEHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ LL  NP+N+ YY GL++ +
Sbjct  242  EATEVYRRLLERNPENWSYYHGLEKAI  268



>ref|XP_006003550.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Latimeria chalumnae]
Length=729

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 187/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRD  G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDFEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E+LLY+  ++ E    + +LE +   E +I DKL  +E +  +LL L   EE 
Sbjct  184  KIDYEYSELLLYQNQVMREADLFQESLEHIEAYEKQICDKLAAEEIKGEMLLNLGRLEEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +Y+ L+  N +N+ YYEGL++ L
Sbjct  244  AAVYRGLIDRNSENWSYYEGLEKAL  268



>ref|XP_002740751.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Saccoglossus kowalevskii]
Length=857

 Score =   278 bits (711),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 185/266 (70%), Gaps = 6/266 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE  LFK I+K YE KQYK  LK A+AIL   K+ DHGETLAMKGLT+NCMGRK EA
Sbjct  7    LPPKENTLFKRILKCYEQKQYKNSLKFAKAILTNPKYCDHGETLAMKGLTMNCMGRKEEA  66

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            YD VR GL+NDL+SHVCWHVYGLL RSDR+Y EAIKCYRNAL+ D DNI+ILRDLSLLQ 
Sbjct  67   YDYVRRGLRNDLQSHVCWHVYGLLQRSDRKYDEAIKCYRNALKWDKDNIQILRDLSLLQI  126

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R++WIG+A++HHL+     A+ +LE +  T      P+
Sbjct  127  QMRDLEGYRETRFQLLQLRPAQRVSWIGYAMSHHLSKEYDMALRVLEEFRKT----QTPK  182

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                EH E+LLY+  ++ E G    AL  L   E +I DKL   E +  L L+L   +E 
Sbjct  183  PYDYEHSELLLYQNEVMRESGMFNEALNHLETYERQICDKLAANEIKGALCLRLGKMKEA  242

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCLG  956
            E +Y+ L++ NP+N+  Y  L+  LG
Sbjct  243  ELIYRDLIARNPENHENYRRLEEALG  268



>ref|XP_007501582.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Monodelphis domestica]
Length=686

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQI  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEAGEIFKDLIDRNAENWNYYEGLEKAL  268



>gb|AAH32642.1| NARG1 protein, partial [Homo sapiens]
Length=614

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQT--  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  181  SPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>gb|AAH39818.1| NARG1 protein, partial [Homo sapiens]
Length=614

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    AVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G    ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E+   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EDAADVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_006639086.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Lepisosteus oculatus]
Length=865

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 192/268 (72%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVSLPPKESNLFKRILKCYEQKQYKNGLKFCKMILANPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             +AY+ VR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   DDAYEFVRKGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDTALRLLEEFRKTQQ--V  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E+LLY+  ++ E    + +LE +   E +I D+L  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELLLYQNEVMREGSLFQESLEHIETYEKQICDQLMVEEIKGEMLLKLGKL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            EE  ++Y+ L+  N +N+ YY+GL++ L
Sbjct  241  EEAAKVYRALIDRNAENWSYYQGLEQAL  268



>ref|XP_420407.4| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Gallus gallus]
Length=889

 Score =   278 bits (711),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/297 (53%), Positives = 201/297 (68%), Gaps = 8/297 (3%)
 Frame = +3

Query  72   IKALPTPPCSSNLLYFPFSSTTP-CSATMGASLPPKEANLFKVIVKSYETKQYKKGLKAA  248
            ++A+ + P         F   +P CS T   +LPPKE  LFK I++ YE KQY+ GLK  
Sbjct  1    MRAVRSDPAGEAARGGHFGGASPACSVT---TLPPKENALFKRILRCYEHKQYRNGLKFC  57

Query  249  EAILK--KFPDHGETLAMKGLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSD  422
            + IL   KF +HGETLAMKGLTLNC+G+K EAY+LVR GL+NDLKSHVCWHVYGLL RSD
Sbjct  58   KQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSD  117

Query  423  REYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIG  602
            ++Y EAIKCYRNAL+ D DN++ILRDLSLLQ QMRDL G+ ETR QLL L+P  R +WIG
Sbjct  118  KKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPAQRASWIG  177

Query  603  FAVAHHLNSNGSKAVDILEAYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSlerale  782
            +A+A+HL  +   A  ILE +  T +    P+    E+ E+LLY+  +L E G  + ALE
Sbjct  178  YAIAYHLLEDYEMAAKILEEFRKTQQTS--PDKVDYEYSELLLYQNQVLREAGLHKEALE  235

Query  783  elrkkeYKIVDKLGYKEQEVCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQRCL  953
             L   E +I DKL  +E +  LLL+L   EE   +YK L   NP+N+ YY+GL++ L
Sbjct  236  HLCTYEKQICDKLAVEETKGELLLQLGRLEEAVDVYKGLQERNPENWAYYKGLEKAL  292



>ref|XP_009291037.1| PREDICTED: N(alpha)-acetyltransferase 15, NatA auxiliary subunit 
b isoform X1 [Danio rerio]
Length=865

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNSKFSEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G L  ALE L   E +I DKL  +E +  LLL L  FE
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLLREALEHLTTYEKQICDKLAVEETKGELLLNLERFE  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL+R L
Sbjct  242  EAADVYRRLQERNPENWLYYHGLERAL  268



>ref|XP_006076574.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Bubalus bubalis]
Length=652

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 187/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKENNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+N++KSHVCWHVYGLL RSD+ Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNNVKSHVCWHVYGLLQRSDKRYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+AVAHHL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAVAHHLLKDYEMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPSKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_006629684.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Lepisosteus oculatus]
Length=865

 Score =   277 bits (709),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 188/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E +  LLLKL   E
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLYKEALEHLTTYEKQICDKLAVEETKGILLLKLDRLE  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL++ L
Sbjct  242  EAADVYRRLQERNPENWSYYHGLEKAL  268



>ref|XP_009438833.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Pan troglodytes]
Length=653

 Score =   273 bits (698),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_010372809.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Rhinopithecus roxellana]
Length=653

 Score =   273 bits (698),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_008405679.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Poecilia reticulata]
Length=864

 Score =   277 bits (709),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 187/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNSKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLYKEALDHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLQERNPENWSYYHGLEKAL  268



>ref|XP_005266579.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Homo sapiens]
Length=653

 Score =   273 bits (697),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 190/265 (72%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E   L+ +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLLVEEIKGEILLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              ++K L+  N +N+ YYEGL++ L
Sbjct  244  SEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005458909.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X9 [Oreochromis niloticus]
Length=688

 Score =   273 bits (699),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFEMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEALDHLNNYEKQICDKLAVEESRGELLLKLEKPQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_007544683.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Poecilia formosa]
Length=864

 Score =   277 bits (708),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 187/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNSKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLYKEALDHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLQERNPENWSYYHGLEKAL  268



>ref|XP_005458908.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X8 [Oreochromis niloticus]
Length=703

 Score =   274 bits (700),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFEMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEALDHLNNYEKQICDKLAVEESRGELLLKLEKPQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_005803075.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Xiphophorus maculatus]
Length=864

 Score =   277 bits (708),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 187/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNSKFAEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKIIEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLYKEALDHLSNYEKQICDKLAVEETRGELLLKLERLD  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY GL++ L
Sbjct  242  EATEVYRRLQERNPENWSYYHGLEKAL  268



>ref|XP_004462843.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 4 [Dasypus novemcinctus]
Length=562

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 188/268 (70%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK ++K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    NVQLPPKESNLFKRVLKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKLDYEYSELILYQNQVMREADLFQESLEHIEIYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            EE   ++K L+  N +N+ YYE L++ L
Sbjct  241  EEASAIFKNLIDRNAENWCYYESLEKAL  268



>ref|XP_007229932.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Astyanax mexicanus]
Length=867

 Score =   276 bits (707),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 187/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+GRK E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGRKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AYDLVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYDLVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLQDYEMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E +  L LKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGHFKEALDHLTTYEKQICDKLAVEETKGELFLKLDRSDE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCLG  956
               +Y+ L   NP+N+ YY+GL+  L 
Sbjct  243  ATEVYRRLQERNPENWSYYQGLESALN  269



>ref|XP_005301537.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Chrysemys picta bellii]
Length=833

 Score =   276 bits (706),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQIPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +YK L+  N +N+ YYEGL++ L
Sbjct  244  GEIYKELIDRNAENWYYYEGLEKAL  268



>ref|XP_005458907.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X7 [Oreochromis niloticus]
Length=704

 Score =   273 bits (699),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFEMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEALDHLNNYEKQICDKLAVEESRGELLLKLEKPQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_007063799.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Chelonia mydas]
Length=811

 Score =   275 bits (704),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLYKEALEHLGTYEKQICDKLAVEETKGELLLQLCRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            EE   +Y+ L   NP+N+ YY+GL++ L
Sbjct  241  EEAAEVYRGLQERNPENWAYYKGLEKAL  268



>ref|XP_009567336.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Cuculus canorus]
 gb|KFO82169.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Cuculus 
canorus]
Length=865

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
              SLPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K
Sbjct  3    SVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSL
Sbjct  63   EEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A  ILE +  T +   
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTS-  181

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
             P+    E+ E+LLY+  +L E G  + ALE L   E +I DKL  +E +  LLL+L   
Sbjct  182  -PDKVDYEYSELLLYQNQVLREAGLHKEALEHLCTYEKQICDKLAVEETKGELLLQLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            EE   +YK L   NP+N+ YY+GL++ L
Sbjct  241  EEAVEVYKGLQERNPENWAYYKGLEKAL  268



>ref|XP_005301536.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Chrysemys picta bellii]
Length=865

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQIPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   +E 
Sbjct  184  KIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLVVEEIKGEMLLKLGRLKEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +YK L+  N +N+ YYEGL++ L
Sbjct  244  GEIYKELIDRNAENWYYYEGLEKAL  268



>ref|XP_005751906.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Pundamilia nyererei]
Length=868

 Score =   276 bits (706),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 187/266 (70%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFDMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + A + L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEAFDHLSSYEKQICDKLAVEETRGELLLKLEKHQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_006003549.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Latimeria chalumnae]
Length=864

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 187/265 (71%), Gaps = 4/265 (2%)
 Frame = +3

Query  165  LPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSEA  338
            LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+G+K EA
Sbjct  6    LPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEA  65

Query  339  YDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQA  518
            Y+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSLLQ 
Sbjct  66   YEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQI  125

Query  519  QMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPPE  698
            QMRD  G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     PP 
Sbjct  126  QMRDFEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRKT--QQVPPN  183

Query  699  NERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEEG  878
                E+ E+LLY+  ++ E    + +LE +   E +I DKL  +E +  +LL L   EE 
Sbjct  184  KIDYEYSELLLYQNQVMREADLFQESLEHIEAYEKQICDKLAAEEIKGEMLLNLGRLEEA  243

Query  879  ERLYKVLLSMNPDNYRYYEGLQRCL  953
              +Y+ L+  N +N+ YYEGL++ L
Sbjct  244  AAVYRGLIDRNSENWSYYEGLEKAL  268



>ref|XP_005458904.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X4 [Oreochromis niloticus]
Length=790

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFEMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEALDHLNNYEKQICDKLAVEESRGELLLKLEKPQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_002938092.2| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Xenopus (Silurana) tropicalis]
Length=917

 Score =   277 bits (708),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 191/276 (69%), Gaps = 9/276 (3%)
 Frame = +3

Query  126  SSTTPCSATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMK  299
            S T PC      SLP KE+NLFK I+K YE KQYK GLK  + IL   +F +HGETLAMK
Sbjct  50   SGTMPC-----VSLPAKESNLFKRILKCYEQKQYKNGLKFCKMILSNPRFSEHGETLAMK  104

Query  300  GLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPD  479
            GLTLNC+G+K EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D D
Sbjct  105  GLTLNCLGKKEEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKD  164

Query  480  NIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILE  659
            N++ILRDLSLLQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE
Sbjct  165  NLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYEMALKLLE  224

Query  660  AYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQE  839
             +  T     PP     E+ E++LY+  ++ E    + +L+ +   E +I DKL  +E  
Sbjct  225  EFRKT--QQVPPNKIDYEYSELILYQNQVMREANLCQESLDHIETYEKQICDKLQVEEIR  282

Query  840  VCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQR  947
              + LKL   +E   +Y+ L+  NP+N++YYE L++
Sbjct  283  GEMFLKLNRLKEASVIYRALIDRNPENWKYYENLEK  318



>ref|XP_002168214.2| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like, 
partial [Hydra vulgaris]
Length=275

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/271 (51%), Positives = 187/271 (69%), Gaps = 9/271 (3%)
 Frame = +3

Query  153  MGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGR  326
            M + LPPKE  +FK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTL+ +GR
Sbjct  1    MPSQLPPKENTIFKRILKCYEQKQYKNGLKFCKQILSNPKFAEHGETLAMKGLTLSYLGR  60

Query  327  KSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLS  506
            K E+Y+ V+ GLKNDL+SHVCWHVYGLL R+D +Y EAIKCYRNAL+ D DNI+ILRDLS
Sbjct  61   KDESYEYVKRGLKNDLRSHVCWHVYGLLQRADHKYDEAIKCYRNALKWDKDNIQILRDLS  120

Query  507  LLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDD  686
            LLQ QMRD  GF +TR QLL ++P  R +WIG++++++L  +   A  ++E +  T+   
Sbjct  121  LLQVQMRDSEGFRDTRYQLLKIRPAQRQSWIGYSISYYLLGDYDMAFSVMEDFRKTI---  177

Query  687  YPPENER---CEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLK  857
              PEN      EH EMLLY+  +L E G ++ +L+ L K E  I DKL   E +    ++
Sbjct  178  -IPENSNKVDFEHSEMLLYQNMVLSEQGKIKESLQHLEKYENLITDKLKVSEIKASQHMQ  236

Query  858  LRHFEEGERLYKVLLSMNPDNYRYYEGLQRC  950
            L +F   E++Y+ LL  NP+N+ YYE +++C
Sbjct  237  LGNFSVAEKIYRNLLKRNPENHMYYEAIEKC  267



>ref|XP_005458906.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X6 [Oreochromis niloticus]
Length=772

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFEMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEALDHLNNYEKQICDKLAVEESRGELLLKLEKPQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_004911890.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Xenopus (Silurana) tropicalis]
Length=919

 Score =   276 bits (707),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 191/276 (69%), Gaps = 9/276 (3%)
 Frame = +3

Query  126  SSTTPCSATMGASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMK  299
            S T PC      SLP KE+NLFK I+K YE KQYK GLK  + IL   +F +HGETLAMK
Sbjct  50   SGTMPC-----VSLPAKESNLFKRILKCYEQKQYKNGLKFCKMILSNPRFSEHGETLAMK  104

Query  300  GLTLNCMGRKSEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPD  479
            GLTLNC+G+K EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D D
Sbjct  105  GLTLNCLGKKEEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKD  164

Query  480  NIEILRDLSLLQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILE  659
            N++ILRDLSLLQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE
Sbjct  165  NLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYEMALKLLE  224

Query  660  AYEGTLEDDYPPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQE  839
             +  T     PP     E+ E++LY+  ++ E    + +L+ +   E +I DKL  +E  
Sbjct  225  EFRKT--QQVPPNKIDYEYSELILYQNQVMREANLCQESLDHIETYEKQICDKLQVEEIR  282

Query  840  VCLLLKLRHFEEGERLYKVLLSMNPDNYRYYEGLQR  947
              + LKL   +E   +Y+ L+  NP+N++YYE L++
Sbjct  283  GEMFLKLNRLKEASVIYRALIDRNPENWKYYENLEK  318



>ref|XP_005751907.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Pundamilia nyererei]
Length=872

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 187/266 (70%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFDMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + A + L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEAFDHLSSYEKQICDKLAVEETRGELLLKLEKHQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_004376673.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform 1 [Trichechus manatus latirostris]
Length=865

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+GRK
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGRK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005944999.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Haplochromis burtoni]
Length=868

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 187/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFDMAAKIVEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + A + L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEAFDHLNSYEKQICDKLAVEETRGELLLKLEKHQ  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY+GL++ L
Sbjct  242  EASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_005945000.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X3 [Haplochromis burtoni]
Length=872

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 187/267 (70%), Gaps = 4/267 (1%)
 Frame = +3

Query  159  ASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKS  332
             +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K 
Sbjct  4    VTLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKE  63

Query  333  EAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLL  512
            EAY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLL
Sbjct  64   EAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLL  123

Query  513  QAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYP  692
            Q QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    
Sbjct  124  QIQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFDMAAKIVEEFRKTQQTS--  181

Query  693  PENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFE  872
            P+    E+ E+LLY+  +L E G  + A + L   E +I DKL  +E    LLLKL   +
Sbjct  182  PDKVDYEYSELLLYQNQVLREAGLHKEAFDHLNSYEKQICDKLAVEETRGELLLKLEKHQ  241

Query  873  EGERLYKVLLSMNPDNYRYYEGLQRCL  953
            E   +Y+ L   NP+N+ YY+GL++ L
Sbjct  242  EASEVYRRLQERNPENWAYYQGLEKAL  268



>ref|XP_010590885.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Loxodonta africana]
Length=865

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 189/268 (71%), Gaps = 4/268 (1%)
 Frame = +3

Query  156  GASLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRK  329
               LPPKE+NLFK I+K YE KQYK GLK  + IL   KF +HGETLAMKGLTLNC+GRK
Sbjct  3    NVQLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGRK  62

Query  330  SEAYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSL  509
             EAY+ VR GL+ND+KSHVCWHVYGLL RSD++Y EAIKCYRNAL++D DN++ILRDLSL
Sbjct  63   EEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSL  122

Query  510  LQAQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDY  689
            LQ QMRDL G+ ETR QLL L+P  R +WIG+A+A+HL  +   A+ +LE +  T     
Sbjct  123  LQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQT--QQV  180

Query  690  PPENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHF  869
            PP     E+ E++LY+  ++ E    + +LE +   E +I DKL  +E +  +LLKL   
Sbjct  181  PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEMLLKLGRL  240

Query  870  EEGERLYKVLLSMNPDNYRYYEGLQRCL  953
            +E   ++K L+  N +N+ YYEGL++ L
Sbjct  241  KEASEVFKNLIDRNAENWCYYEGLEKAL  268



>ref|XP_005458905.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X5 [Oreochromis niloticus]
Length=781

 Score =   274 bits (701),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 188/266 (71%), Gaps = 4/266 (2%)
 Frame = +3

Query  162  SLPPKEANLFKVIVKSYETKQYKKGLKAAEAILK--KFPDHGETLAMKGLTLNCMGRKSE  335
            +LPPKE  LFK I++ YE KQY+ GLK  + IL   KF +HGETLAMKGLTLNC+G+K E
Sbjct  5    TLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFSEHGETLAMKGLTLNCLGKKEE  64

Query  336  AYDLVRLGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQ  515
            AY+LVR GL+NDLKSHVCWHVYGLL RSD++Y EAIKCYRNAL+ D DN++ILRDLSLLQ
Sbjct  65   AYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQ  124

Query  516  AQMRDLIGFVETRLQLLTLKPNHRMNWIGFAVAHHLNSNGSKAVDILEAYEGTLEDDYPP  695
             QMRDL G+ ETR QLL L+P  R +WIG+AVA+HL  +   A  I+E +  T +    P
Sbjct  125  IQMRDLEGYRETRYQLLQLRPAQRASWIGYAVAYHLLEDFEMAAKIVEEFRKTQQTS--P  182

Query  696  ENERCEHGEMLLYKISLLEECGSleraleelrkkeYKIVDKLGYKEQEVCLLLKLRHFEE  875
            +    E+ E+LLY+  +L E G  + AL+ L   E +I DKL  +E    LLLKL   +E
Sbjct  183  DKVDYEYSELLLYQNQVLREAGLHKEALDHLNNYEKQICDKLAVEESRGELLLKLEKPQE  242

Query  876  GERLYKVLLSMNPDNYRYYEGLQRCL  953
               +Y+ L   NP+N+ YY+GL++ L
Sbjct  243  ASEVYRRLQERNPENWAYYQGLEKAL  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2309594300078