BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11944

Length=1315
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10414.1|  unnamed protein product                                662   0.0      Coffea canephora [robusta coffee]
ref|XP_009760786.1|  PREDICTED: phospholipase D alpha 1-like            660   0.0      Nicotiana sylvestris
ref|XP_009613360.1|  PREDICTED: phospholipase D alpha 1-like            656   0.0      Nicotiana tomentosiformis
ref|XP_011078373.1|  PREDICTED: phospholipase D alpha 1-like            656   0.0      Sesamum indicum [beniseed]
ref|XP_006367508.1|  PREDICTED: phospholipase D alpha 1-like isof...    650   0.0      Solanum tuberosum [potatoes]
ref|NP_001289824.1|  uncharacterized protein LOC101257989               647   0.0      
ref|XP_010325100.1|  PREDICTED: phospholipase D alpha 1-like isof...    646   0.0      Solanum lycopersicum
ref|NP_001234863.1|  phospholipase PLDa2                                626   0.0      
ref|XP_006367510.1|  PREDICTED: phospholipase D alpha 1-like            625   0.0      Solanum tuberosum [potatoes]
gb|EYU23016.1|  hypothetical protein MIMGU_mgv1a001487mg                616   0.0      Erythranthe guttata [common monkey flower]
dbj|BAE79735.1|  phospholipase D alpha 2                                610   0.0      Arachis hypogaea [goober]
ref|XP_002517625.1|  phopholipase d alpha, putative                     609   0.0      
gb|AAG50297.1|  phospholipase PLDa3                                     604   0.0      Solanum lycopersicum
sp|Q41142.1|PLDA1_RICCO  RecName: Full=Phospholipase D alpha 1; S...    608   0.0      Ricinus communis
gb|AAB37305.1|  phospholipase D                                         608   0.0      Ricinus communis
ref|XP_010254401.1|  PREDICTED: phospholipase D alpha 1-like            605   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_007150746.1|  hypothetical protein PHAVU_005G177300g             603   0.0      Phaseolus vulgaris [French bean]
ref|XP_012073195.1|  PREDICTED: phospholipase D alpha 1                 602   0.0      
ref|XP_003604419.1|  Phospholipase D alpha                              594   0.0      
ref|XP_011073436.1|  PREDICTED: phospholipase D alpha 1                 597   0.0      Sesamum indicum [beniseed]
gb|KCW70692.1|  hypothetical protein EUGRSUZ_F03862                     592   0.0      Eucalyptus grandis [rose gum]
gb|EPS65578.1|  hypothetical protein M569_09194                         595   0.0      Genlisea aurea
ref|XP_006385316.1|  phospholipase D family protein                     595   0.0      
ref|XP_009799916.1|  PREDICTED: phospholipase D alpha 1                 595   0.0      Nicotiana sylvestris
sp|P86387.1|PLDA1_CARPA  RecName: Full=Phospholipase D alpha 1; S...    594   0.0      Carica papaya [mamon]
gb|AES86616.2|  phospholipase D alpha 1                                 594   0.0      Medicago truncatula
ref|XP_003528334.1|  PREDICTED: phospholipase D alpha 1-like isof...    593   0.0      
ref|XP_010063458.1|  PREDICTED: phospholipase D alpha 1                 592   0.0      Eucalyptus grandis [rose gum]
ref|XP_003543677.1|  PREDICTED: phospholipase D alpha 1-like isof...    592   0.0      Glycine max [soybeans]
ref|XP_011008452.1|  PREDICTED: phospholipase D alpha 1-like            592   0.0      Populus euphratica
gb|KDO48582.1|  hypothetical protein CISIN_1g004579mg                   587   0.0      Citrus sinensis [apfelsine]
ref|XP_011012164.1|  PREDICTED: phospholipase D alpha 1                 592   0.0      Populus euphratica
ref|XP_009625689.1|  PREDICTED: phospholipase D alpha 1                 591   0.0      Nicotiana tomentosiformis
sp|P93400.2|PLDA1_TOBAC  RecName: Full=Phospholipase D alpha 1; S...    591   0.0      Nicotiana tabacum [American tobacco]
gb|KHN01336.1|  Phospholipase D alpha 1                                 590   0.0      Glycine soja [wild soybean]
ref|XP_004506968.1|  PREDICTED: phospholipase D alpha 1-like            587   0.0      
ref|XP_008461111.1|  PREDICTED: phospholipase D alpha 1                 588   0.0      
ref|XP_006427267.1|  hypothetical protein CICLE_v10024917mg             587   0.0      Citrus clementina [clementine]
ref|XP_004486668.1|  PREDICTED: phospholipase D alpha 1-like isof...    587   0.0      
ref|XP_002299756.1|  phospholipase D family protein                     587   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001275827.1|  phospholipase D alpha                              586   0.0      Citrus sinensis [apfelsine]
emb|CAB43063.1|  phospholipase D1                                       586   0.0      Craterostigma plantagineum
ref|XP_011081358.1|  PREDICTED: phospholipase D alpha 1                 586   0.0      Sesamum indicum [beniseed]
ref|XP_006465340.1|  PREDICTED: phospholipase D alpha 1                 586   0.0      Citrus sinensis [apfelsine]
ref|XP_003531710.1|  PREDICTED: phospholipase D alpha 1-like isof...    586   0.0      
gb|ABB82551.1|  phospholipase D-alpha                                   586   0.0      Cucumis melo var. inodorus [casaba melon]
ref|XP_009146200.1|  PREDICTED: phospholipase D alpha 1                 585   0.0      Brassica rapa
gb|KHN47766.1|  Phospholipase D alpha 1                                 585   0.0      Glycine soja [wild soybean]
sp|O82549.1|PLDA1_BRAOC  RecName: Full=Phospholipase D alpha 1; S...    584   0.0      Brassica oleracea var. capitata
emb|CDY21865.1|  BnaC01g35830D                                          584   0.0      Brassica napus [oilseed rape]
gb|AIE90138.1|  phospholipase D1                                        584   0.0      Brassica napus [oilseed rape]
ref|XP_010907269.1|  PREDICTED: phospholipase D alpha 1                 584   0.0      Elaeis guineensis
ref|XP_010097235.1|  Phospholipase D alpha 1                            583   0.0      Morus notabilis
gb|AGN71006.1|  phospholipase D2                                        583   0.0      Brassica napus [oilseed rape]
gb|AGN71005.1|  phospholipase D1                                        583   0.0      Brassica napus [oilseed rape]
ref|XP_006842069.1|  PREDICTED: phospholipase D alpha 1                 583   0.0      Amborella trichopoda
gb|AGV22364.1|  phospholipase D4                                        582   0.0      Brassica napus [oilseed rape]
ref|XP_009115281.1|  PREDICTED: phospholipase D alpha 2                 582   0.0      Brassica rapa
sp|P55939.2|PLDA2_BRAOC  RecName: Full=Phospholipase D alpha 2; S...    582   0.0      Brassica oleracea var. capitata
gb|AHN53202.1|  phospholipase D alpha 1-like protein                    582   0.0      Cocos nucifera
emb|CDO98145.1|  unnamed protein product                                582   0.0      Coffea canephora [robusta coffee]
emb|CDX97705.1|  BnaA05g23740D                                          582   0.0      
ref|XP_008454241.1|  PREDICTED: phospholipase D alpha 1                 582   0.0      Cucumis melo [Oriental melon]
ref|XP_008805616.1|  PREDICTED: phospholipase D alpha 1-like            581   0.0      Phoenix dactylifera
ref|XP_007023176.1|  Phospholipase D alpha 2 isoform 3                  575   0.0      
emb|CAB43062.1|  phospholipase D2                                       580   0.0      Craterostigma plantagineum
gb|KJB70611.1|  hypothetical protein B456_011G083000                    575   0.0      Gossypium raimondii
ref|XP_006356207.1|  PREDICTED: phospholipase D alpha 1-like isof...    580   0.0      Solanum tuberosum [potatoes]
ref|XP_004152203.1|  PREDICTED: phospholipase D alpha 1                 580   0.0      Cucumis sativus [cucumbers]
ref|XP_010691149.1|  PREDICTED: phospholipase D alpha 1-like            580   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009619857.1|  PREDICTED: phospholipase D alpha 1                 580   0.0      
ref|NP_001267897.1|  phospholipase D alpha                              579   0.0      Vitis vinifera
ref|XP_002882959.1|  PLDALPHA1                                          579   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_004135845.1|  PREDICTED: phospholipase D alpha 1                 579   0.0      
gb|KHG06123.1|  Phospholipase D alpha 1                                 579   0.0      Gossypium arboreum [tree cotton]
gb|ADP23922.1|  phospholipase D alpha                                   578   0.0      Litchi chinensis [litchi]
gb|AGV22363.1|  phospholipase D3                                        578   0.0      Brassica napus [oilseed rape]
ref|XP_008792036.1|  PREDICTED: phospholipase D alpha 1                 578   0.0      Phoenix dactylifera
ref|XP_009381115.1|  PREDICTED: phospholipase D alpha 1                 578   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|ABN13537.2|  phospholipase D                                         577   0.0      Cucumis sativus [cucumbers]
ref|NP_188194.1|  phospholipase D alpha 1                               577   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AGW22212.1|  phospholipase D alpha                                   577   0.0      Chorispora bungeana
gb|EYU21635.1|  hypothetical protein MIMGU_mgv1a001489mg                577   0.0      Erythranthe guttata [common monkey flower]
ref|XP_009408983.1|  PREDICTED: phospholipase D alpha 1-like            577   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG63795.1|  phospholipase D alpha                                   577   0.0      Gossypium raimondii
gb|ACG63794.1|  phospholipase D alpha                                   576   0.0      Gossypium arboreum [tree cotton]
ref|XP_007023174.1|  Phospholipase D alpha 2 isoform 1                  575   0.0      
ref|XP_003597894.1|  Phospholipase D alpha                              575   0.0      Medicago truncatula
ref|XP_006364210.1|  PREDICTED: phospholipase D alpha 1-like isof...    575   0.0      Solanum tuberosum [potatoes]
gb|ACV70146.1|  phospholipase D                                         574   0.0      Gossypium arboreum [tree cotton]
gb|ABU54776.1|  phospholipase D alpha 1 precursor                       574   0.0      Helianthus annuus
ref|XP_007135745.1|  hypothetical protein PHAVU_010G155000g             573   0.0      Phaseolus vulgaris [French bean]
ref|NP_001234102.1|  phospholipase PLDa1                                573   0.0      
gb|ADY75750.1|  phospholipase D alpha                                   572   0.0      Dimocarpus longan [longan]
ref|XP_006297003.1|  hypothetical protein CARUB_v10012996mg             573   0.0      Capsella rubella
ref|XP_009348321.1|  PREDICTED: phospholipase D alpha 1                 572   0.0      Pyrus x bretschneideri [bai li]
ref|XP_004235964.1|  PREDICTED: phospholipase D alpha 1                 572   0.0      Solanum lycopersicum
ref|XP_008360327.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    572   0.0      Malus domestica [apple tree]
ref|XP_008243731.1|  PREDICTED: phospholipase D alpha 1                 571   0.0      Prunus mume [ume]
ref|XP_007217042.1|  hypothetical protein PRUPE_ppa001519mg             571   0.0      Prunus persica
sp|Q70EW5.2|PLDA1_CYNCA  RecName: Full=Phospholipase D alpha 1; S...    570   0.0      Cynara cardunculus [cardoon]
ref|XP_010487412.1|  PREDICTED: phospholipase D alpha 1 isoform X2      570   0.0      Camelina sativa [gold-of-pleasure]
sp|O04865.1|PLDA1_VIGUN  RecName: Full=Phospholipase D alpha 1; S...    570   0.0      Vigna unguiculata
ref|XP_010322318.1|  PREDICTED: phospholipase PLDa1 isoform X1          570   0.0      Solanum lycopersicum
ref|XP_008673445.1|  PREDICTED: phospholipase D alpha 1 isoform X1      570   0.0      Zea mays [maize]
gb|ACR35730.1|  unknown                                                 570   0.0      Zea mays [maize]
gb|ACG80607.1|  phospholipase D alpha                                   569   0.0      Prunus persica
ref|XP_010250112.1|  PREDICTED: phospholipase D alpha 1                 569   0.0      
gb|ACL53693.1|  unknown                                                 569   0.0      Zea mays [maize]
ref|XP_010465563.1|  PREDICTED: phospholipase D alpha 1-like            569   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_003569355.1|  PREDICTED: phospholipase D alpha 1                 568   0.0      Brachypodium distachyon [annual false brome]
ref|XP_006643814.1|  PREDICTED: phospholipase D alpha 1-like            568   0.0      Oryza brachyantha
ref|XP_008654846.1|  PREDICTED: phospholipase D family protein is...    568   0.0      Zea mays [maize]
ref|XP_010503392.1|  PREDICTED: phospholipase D alpha 1-like            567   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006406922.1|  hypothetical protein EUTSA_v10020083mg             567   0.0      
ref|NP_001105686.1|  phospholipase D alpha 1                            567   0.0      Zea mays [maize]
ref|XP_009365415.1|  PREDICTED: phospholipase D alpha 1-like            567   0.0      Pyrus x bretschneideri [bai li]
ref|XP_008373955.1|  PREDICTED: phospholipase D alpha 1                 566   0.0      
ref|XP_007150745.1|  hypothetical protein PHAVU_005G177200g             566   0.0      Phaseolus vulgaris [French bean]
ref|NP_001042153.1|  Os01g0172400                                       566   0.0      
gb|ABX83202.2|  phospholipase D                                         565   0.0      Lolium temulentum
ref|XP_006364211.1|  PREDICTED: phospholipase D alpha 1-like isof...    565   0.0      
ref|XP_010545768.1|  PREDICTED: phospholipase D alpha 1                 565   0.0      Tarenaya hassleriana [spider flower]
ref|XP_004303313.1|  PREDICTED: phospholipase D alpha 1                 564   0.0      Fragaria vesca subsp. vesca
gb|EEC70024.1|  hypothetical protein OsI_00588                          564   0.0      Oryza sativa Indica Group [Indian rice]
gb|AAW83125.1|  phospholipase D alpha                                   564   0.0      Fragaria x ananassa
ref|XP_002894388.1|  predicted protein                                  563   0.0      Arabidopsis lyrata subsp. lyrata
dbj|BAA11136.1|  phospholipase D                                        563   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010462102.1|  PREDICTED: phospholipase D alpha 2                 561   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010925209.1|  PREDICTED: phospholipase D alpha 1-like            561   0.0      Elaeis guineensis
ref|XP_010687988.1|  PREDICTED: phospholipase D alpha 1-like            560   0.0      
ref|XP_006306783.1|  hypothetical protein CARUB_v10008323mg             559   0.0      
ref|NP_175666.1|  phospholipase D alpha 2                               559   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY20148.1|  BnaA01g28540D                                          544   0.0      Brassica napus [oilseed rape]
gb|KCW70693.1|  hypothetical protein EUGRSUZ_F03862                     556   0.0      Eucalyptus grandis [rose gum]
gb|EMT03624.1|  Phospholipase D alpha 1                                 557   0.0      
ref|XP_010500864.1|  PREDICTED: phospholipase D alpha 2-like isof...    556   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010500868.1|  PREDICTED: phospholipase D alpha 2-like isof...    556   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010479770.1|  PREDICTED: phospholipase D alpha 2-like            556   0.0      Camelina sativa [gold-of-pleasure]
gb|AAL48262.2|AF451980_1  phospholipase D2                              553   0.0      Papaver somniferum
emb|CDM81985.1|  unnamed protein product                                553   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|AAL48261.2|AF451979_1  phospholipase D1                              553   0.0      Papaver somniferum
ref|XP_002443625.1|  hypothetical protein SORBIDRAFT_08g022520          553   0.0      Sorghum bicolor [broomcorn]
tpg|DAA53246.1|  TPA: phospholipase D family protein                    547   0.0      
ref|XP_009787005.1|  PREDICTED: phospholipase D alpha 1-like isof...    551   0.0      Nicotiana sylvestris
ref|XP_009123823.1|  PREDICTED: phospholipase D alpha 2-like            551   0.0      Brassica rapa
ref|XP_006392903.1|  hypothetical protein EUTSA_v10011246mg             551   0.0      Eutrema salsugineum [saltwater cress]
gb|EYU24646.1|  hypothetical protein MIMGU_mgv1a001477mg                551   0.0      Erythranthe guttata [common monkey flower]
sp|O04883.1|PLDA1_PIMBR  RecName: Full=Phospholipase D alpha 1; S...    549   0.0      Spuriopimpinella brachycarpa
ref|NP_001267764.1|  phospholipase D alpha 1-like                       549   0.0      Setaria italica
emb|CDY47540.1|  BnaC03g69220D                                          548   0.0      Brassica napus [oilseed rape]
ref|XP_008673447.1|  PREDICTED: phospholipase D alpha 1 isoform X2      546   0.0      
gb|KJB70612.1|  hypothetical protein B456_011G083000                    545   0.0      Gossypium raimondii
ref|XP_008242775.1|  PREDICTED: phospholipase D alpha 1-like            545   0.0      Prunus mume [ume]
ref|XP_007204652.1|  hypothetical protein PRUPE_ppa001528mg             545   0.0      Prunus persica
emb|CDY60551.1|  BnaA05g35700D                                          544   0.0      Brassica napus [oilseed rape]
ref|XP_009144830.1|  PREDICTED: phospholipase D alpha 2                 544   0.0      Brassica rapa
ref|XP_002325225.2|  hypothetical protein POPTR_0018s13110g             539   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011017763.1|  PREDICTED: phospholipase D alpha 1-like            539   0.0      Populus euphratica
ref|XP_009787006.1|  PREDICTED: phospholipase D alpha 1-like isof...    535   1e-180   Nicotiana sylvestris
gb|KDO48581.1|  hypothetical protein CISIN_1g004579mg                   528   1e-179   Citrus sinensis [apfelsine]
ref|XP_006654096.1|  PREDICTED: phospholipase D alpha 1-like            531   2e-178   Oryza brachyantha
gb|KDO48580.1|  hypothetical protein CISIN_1g004579mg                   529   3e-178   Citrus sinensis [apfelsine]
ref|NP_001054773.2|  Os05g0171000                                       526   8e-178   
ref|XP_002440692.1|  hypothetical protein SORBIDRAFT_09g005220          524   5e-177   
gb|AFW76092.1|  phospholipase D family protein                          518   5e-177   
gb|KJB68102.1|  hypothetical protein B456_010G225600                    527   7e-177   Gossypium raimondii
gb|AAU44332.1|  hypothetical protein                                    526   5e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002282187.3|  PREDICTED: phospholipase D alpha 1-like            525   9e-176   Vitis vinifera
ref|XP_008650412.1|  PREDICTED: phospholipase D alpha 1-like            520   4e-175   
gb|EPS60466.1|  hypothetical protein M569_14336                         518   1e-173   Genlisea aurea
ref|XP_008649399.1|  PREDICTED: phospholipase D alpha 1-like            520   1e-173   Zea mays [maize]
ref|XP_004287315.1|  PREDICTED: phospholipase D alpha 1-like            519   2e-173   Fragaria vesca subsp. vesca
gb|AFW77332.1|  phospholipase D family protein                          520   1e-172   
ref|XP_003568837.1|  PREDICTED: phospholipase D alpha 1-like            517   1e-172   
ref|XP_010325101.1|  PREDICTED: phospholipase D alpha 1-like isof...    513   2e-172   Solanum lycopersicum
ref|XP_010656428.1|  PREDICTED: phospholipase D alpha 1-like            515   5e-172   Vitis vinifera
gb|AAC49274.1|  phospholipase D                                         514   9e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368855.1|  PREDICTED: phospholipase D alpha 1-like            512   8e-171   Pyrus x bretschneideri [bai li]
dbj|BAJ93878.1|  predicted protein                                      510   2e-170   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24153.1|  Phospholipase D alpha 1                                 514   2e-170   
ref|XP_002524502.1|  phopholipase d alpha, putative                     507   5e-170   
gb|ACL53520.1|  unknown                                                 504   1e-168   Zea mays [maize]
ref|NP_001146559.1|  phospholipase D family protein                     504   1e-168   Zea mays [maize]
emb|CAN76339.1|  hypothetical protein VITISV_014670                     506   2e-168   Vitis vinifera
ref|XP_009364028.1|  PREDICTED: phospholipase D alpha 1-like            504   1e-167   Pyrus x bretschneideri [bai li]
ref|XP_008385550.1|  PREDICTED: phospholipase D alpha 1-like            504   1e-167   
ref|XP_012076577.1|  PREDICTED: phospholipase D alpha 1-like isof...    502   3e-167   
emb|CDX87920.1|  BnaC06g09820D                                          486   3e-167   
ref|XP_012076575.1|  PREDICTED: phospholipase D alpha 1-like isof...    501   7e-167   
ref|XP_012076576.1|  PREDICTED: phospholipase D alpha 1-like isof...    501   7e-167   
ref|XP_002515518.1|  phopholipase d alpha, putative                     499   7e-166   Ricinus communis
emb|CDY63527.1|  BnaAnng18990D                                          481   2e-165   Brassica napus [oilseed rape]
ref|XP_012076574.1|  PREDICTED: phospholipase D alpha 1-like isof...    498   4e-165   
ref|XP_011070230.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    498   4e-165   Sesamum indicum [beniseed]
emb|CAN81667.1|  hypothetical protein VITISV_017804                     491   5e-165   Vitis vinifera
ref|XP_012078794.1|  PREDICTED: phospholipase D alpha 1-like isof...    496   8e-165   Jatropha curcas
ref|XP_012076573.1|  PREDICTED: phospholipase D alpha 1-like isof...    496   1e-164   Jatropha curcas
emb|CBI36314.3|  unnamed protein product                                477   1e-163   Vitis vinifera
ref|NP_001146242.1|  uncharacterized protein LOC100279815               493   2e-163   Zea mays [maize]
ref|XP_012078795.1|  PREDICTED: phospholipase D alpha 1-like isof...    492   4e-163   
ref|XP_004965943.1|  PREDICTED: phospholipase D alpha 2-like            493   4e-163   Setaria italica
ref|XP_006656220.1|  PREDICTED: phospholipase D alpha 2-like            492   6e-163   Oryza brachyantha
ref|XP_012078796.1|  PREDICTED: phospholipase D alpha 1-like isof...    489   4e-162   
tpg|DAA53245.1|  TPA: phospholipase D family protein                    472   6e-162   
ref|XP_010090252.1|  Phospholipase D alpha 1                            487   2e-161   
ref|XP_007013459.1|  Phospholipase D alpha 1                            486   5e-161   
ref|NP_001058017.1|  Os06g0604400                                       486   8e-161   
gb|EYU32345.1|  hypothetical protein MIMGU_mgv1a001383mg                486   2e-160   Erythranthe guttata [common monkey flower]
ref|XP_003563661.1|  PREDICTED: phospholipase D alpha 2-like            484   9e-160   Brachypodium distachyon [annual false brome]
ref|XP_012076566.1|  PREDICTED: phospholipase D alpha 1-like isof...    482   2e-159   
ref|XP_008777837.1|  PREDICTED: phospholipase D alpha 1-like            483   5e-159   Phoenix dactylifera
dbj|BAJ85695.1|  predicted protein                                      480   3e-158   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94103.1|  predicted protein                                      480   3e-158   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437251.1|  hypothetical protein SORBIDRAFT_10g023630          479   8e-158   Sorghum bicolor [broomcorn]
gb|EMT32202.1|  Phospholipase D alpha 2                                 479   9e-158   
dbj|BAA19466.1|  phospholipase D                                        478   1e-157   Oryza sativa Japonica Group [Japonica rice]
gb|EYU23014.1|  hypothetical protein MIMGU_mgv1a0192722mg               466   2e-157   Erythranthe guttata [common monkey flower]
ref|XP_012076565.1|  PREDICTED: phospholipase D alpha 1-like isof...    477   3e-157   
emb|CDP13512.1|  unnamed protein product                                477   4e-157   Coffea canephora [robusta coffee]
ref|XP_012076563.1|  PREDICTED: phospholipase D alpha 1-like isof...    476   7e-157   Jatropha curcas
emb|CDP13510.1|  unnamed protein product                                476   7e-157   Coffea canephora [robusta coffee]
ref|XP_010923204.1|  PREDICTED: phospholipase D alpha 1-like            475   9e-156   Elaeis guineensis
gb|ACI96318.1|  putative phospholipase D alpha 1 precursor              464   1e-155   Aegilops speltoides
gb|ACI96319.1|  putative phospholipase D alpha 1 precursor              464   1e-155   Secale cereale
gb|ACI96316.1|  putative phospholipase D alpha 1 precursor              464   2e-155   Triticum monococcum [einkorn wheat]
ref|XP_011459180.1|  PREDICTED: phospholipase D alpha 1-like            473   2e-155   Fragaria vesca subsp. vesca
ref|XP_010050012.1|  PREDICTED: phospholipase D alpha 1-like            470   2e-154   
gb|KCW82853.1|  hypothetical protein EUGRSUZ_C04222                     469   2e-154   Eucalyptus grandis [rose gum]
ref|XP_008219493.1|  PREDICTED: phospholipase D alpha 1-like            468   7e-154   Prunus mume [ume]
ref|XP_009614730.1|  PREDICTED: phospholipase D alpha 1 {ECO:0000...    466   9e-153   Nicotiana tomentosiformis
ref|XP_009758055.1|  PREDICTED: phospholipase D alpha 1-like            466   1e-152   Nicotiana sylvestris
ref|XP_009407292.1|  PREDICTED: phospholipase D alpha 1-like            461   5e-151   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB07619.1|  hypothetical protein B456_001G0333002                   461   6e-151   Gossypium raimondii
gb|KHN07080.1|  Phospholipase D alpha 1                                 460   1e-150   Glycine soja [wild soybean]
ref|XP_007011867.1|  Phospholipase D alpha 1                            460   2e-150   
ref|XP_011039694.1|  PREDICTED: phospholipase D alpha 1-like            459   3e-150   Populus euphratica
emb|CBI28204.3|  unnamed protein product                                456   3e-150   Vitis vinifera
ref|XP_011649822.1|  PREDICTED: phospholipase D alpha 1-like            457   1e-149   Cucumis sativus [cucumbers]
ref|XP_008394091.1|  PREDICTED: phospholipase D alpha 1-like isof...    452   2e-149   
ref|XP_004251821.1|  PREDICTED: phospholipase D alpha 1-like            457   3e-149   Solanum lycopersicum
ref|XP_006350007.1|  PREDICTED: phospholipase D alpha 1-like            456   7e-149   Solanum tuberosum [potatoes]
ref|XP_006581357.1|  PREDICTED: phospholipase D alpha 1-like            455   2e-148   Glycine max [soybeans]
ref|XP_008394090.1|  PREDICTED: phospholipase D alpha 1-like isof...    452   8e-148   
ref|XP_010648662.1|  PREDICTED: phospholipase D alpha 1-like            452   3e-147   Vitis vinifera
ref|XP_007225238.1|  hypothetical protein PRUPE_ppa001818mg             448   1e-146   
ref|XP_008445210.1|  PREDICTED: phospholipase D alpha 1-like            449   2e-146   Cucumis melo [Oriental melon]
gb|EPS71739.1|  hypothetical protein M569_03019                         444   1e-144   Genlisea aurea
ref|XP_009355736.1|  PREDICTED: phospholipase D alpha 1-like            444   2e-144   
ref|XP_002308663.2|  hypothetical protein POPTR_0006s27000g             442   2e-144   
gb|ACI96317.1|  putative phospholipase D alpha 1 precursor              434   9e-144   Triticum urartu
ref|XP_007137028.1|  hypothetical protein PHAVU_009G093500g             439   2e-142   Phaseolus vulgaris [French bean]
ref|XP_002963233.1|  hypothetical protein SELMODRAFT_165923             437   6e-142   Selaginella moellendorffii
ref|XP_002974536.1|  hypothetical protein SELMODRAFT_267774             436   1e-141   Selaginella moellendorffii
ref|XP_010228542.1|  PREDICTED: phospholipase D alpha 1-like isof...    437   2e-141   Brachypodium distachyon [annual false brome]
ref|XP_009401714.1|  PREDICTED: phospholipase D alpha 1-like isof...    436   3e-141   
ref|XP_009401723.1|  PREDICTED: phospholipase D alpha 1-like isof...    434   5e-141   
ref|XP_006394788.1|  hypothetical protein EUTSA_v10003659mg             435   7e-141   Eutrema salsugineum [saltwater cress]
ref|XP_010048204.1|  PREDICTED: phospholipase D alpha 1-like            435   9e-141   Eucalyptus grandis [rose gum]
tpg|DAA45660.1|  TPA: phospholipase D family protein                    432   9e-141   
ref|XP_006650158.1|  PREDICTED: phospholipase D alpha 1-like            435   1e-140   Oryza brachyantha
ref|XP_010101275.1|  Phospholipase D alpha 1                            432   6e-140   
tpg|DAA53243.1|  TPA: phospholipase D family protein                    414   8e-140   
ref|XP_010228543.1|  PREDICTED: phospholipase D alpha 1-like isof...    432   8e-140   
ref|XP_008673230.1|  PREDICTED: phospholipase D family protein is...    433   1e-139   
ref|XP_002972515.1|  hypothetical protein SELMODRAFT_441825             431   2e-139   Selaginella moellendorffii
ref|XP_008673211.1|  PREDICTED: phospholipase D family protein is...    432   2e-139   Zea mays [maize]
ref|XP_002992572.1|  hypothetical protein SELMODRAFT_186850             431   2e-139   Selaginella moellendorffii
dbj|BAK02630.1|  predicted protein                                      431   4e-139   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006394787.1|  hypothetical protein EUTSA_v10003665mg             429   8e-139   
gb|EEE65981.1|  hypothetical protein OsJ_21905                          426   1e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007011868.1|  Phospholipase D alpha 2 isoform 1                  429   1e-138   
ref|XP_007011869.1|  Phospholipase D alpha 2 isoform 2                  427   6e-138   
tpg|DAA53242.1|  TPA: phospholipase D family protein                    409   9e-138   
ref|XP_010541603.1|  PREDICTED: phospholipase D zeta                    426   3e-137   Tarenaya hassleriana [spider flower]
gb|AAF78754.1|AF271356_1  phospholipase D                               426   3e-137   Oryza sativa Indica Group [Indian rice]
gb|KJB55001.1|  hypothetical protein B456_009G057800                    425   7e-137   Gossypium raimondii
ref|NP_001058015.1|  Os06g0604200                                       425   7e-137   
tpg|DAA45665.1|  TPA: phospholipase D family protein                    423   2e-136   
ref|XP_003603407.1|  Phospholipase D alpha                              423   3e-136   
ref|XP_002964421.1|  hypothetical protein SELMODRAFT_82084              422   4e-136   
ref|XP_004501331.1|  PREDICTED: phospholipase D alpha 1-like isof...    422   1e-135   
ref|XP_004501330.1|  PREDICTED: phospholipase D alpha 1-like isof...    421   2e-135   
ref|XP_002967619.1|  hypothetical protein SELMODRAFT_231070             417   3e-134   
ref|XP_001762942.1|  predicted protein                                  417   4e-134   
ref|XP_003603403.1|  Phospholipase D alpha                              415   4e-133   
ref|XP_008660012.1|  PREDICTED: phospholipase D alpha 1-like            414   5e-133   
gb|AAR87276.1|  putative phospholipase D                                414   2e-132   
ref|XP_006656219.1|  PREDICTED: phospholipase D alpha 2-like            412   6e-132   
gb|KDO61728.1|  hypothetical protein CISIN_1g003523mg                   411   9e-132   
ref|XP_004501328.1|  PREDICTED: phospholipase D alpha 1-like isof...    411   1e-131   
ref|XP_009129965.1|  PREDICTED: phospholipase D zeta-like               411   2e-131   
ref|XP_006450437.1|  hypothetical protein CICLE_v10010712mg             410   2e-131   
gb|AAF78755.1|AF271357_1  phospholipase D                               411   2e-131   
gb|AFW87187.1|  phospholipase D family protein                          406   9e-131   
ref|XP_010424312.1|  PREDICTED: phospholipase D zeta-like               408   1e-130   
ref|XP_006483709.1|  PREDICTED: phospholipase D alpha 1-like            408   2e-130   
ref|NP_001058016.1|  Os06g0604300                                       408   3e-130   
ref|XP_007137027.1|  hypothetical protein PHAVU_009G093400g             407   4e-130   
ref|XP_009151064.1|  PREDICTED: phospholipase D zeta                    407   5e-130   
gb|EAY90307.1|  hypothetical protein OsI_11882                          408   5e-130   
ref|NP_197919.1|  phospholipase D alpha 3                               406   8e-130   
ref|XP_006287080.1|  hypothetical protein CARUB_v10000238mg             405   2e-129   
emb|CDY05490.1|  BnaA02g32010D                                          405   2e-129   
ref|XP_010454864.1|  PREDICTED: phospholipase D zeta-like               405   3e-129   
ref|XP_010493792.1|  PREDICTED: phospholipase D zeta                    405   4e-129   
emb|CDY05351.1|  BnaC02g40590D                                          404   7e-129   
ref|XP_002874254.1|  predicted protein                                  402   4e-128   
emb|CBI21040.3|  unnamed protein product                                391   9e-125   
ref|XP_004984143.1|  PREDICTED: phospholipase D alpha 1-like isof...    391   7e-124   
ref|XP_004984141.1|  PREDICTED: phospholipase D alpha 1-like isof...    390   2e-123   
ref|XP_004984142.1|  PREDICTED: phospholipase D alpha 1-like isof...    390   2e-123   
ref|XP_006581358.1|  PREDICTED: phospholipase D alpha 1-like            389   3e-123   
ref|XP_004984144.1|  PREDICTED: phospholipase D alpha 1-like isof...    389   4e-123   
ref|XP_004979743.1|  PREDICTED: phospholipase D alpha 2-like            387   2e-122   
ref|XP_001753756.1|  predicted protein                                  387   3e-122   
ref|XP_006406921.1|  hypothetical protein EUTSA_v10020083mg             379   4e-121   
ref|XP_001767482.1|  predicted protein                                  384   5e-121   
ref|XP_006657113.1|  PREDICTED: phospholipase D alpha 2-like            383   1e-120   
ref|XP_001753255.1|  predicted protein                                  374   3e-117   
ref|XP_010696306.1|  PREDICTED: phospholipase D alpha 1-like            372   1e-116   
ref|XP_007137026.1|  hypothetical protein PHAVU_009G093400g             370   1e-116   
ref|XP_010942074.1|  PREDICTED: phospholipase D alpha 1-like            368   3e-115   
dbj|BAE79734.1|  phospholipase D alpha 1                                367   6e-115   
gb|EEE59186.1|  hypothetical protein OsJ_11122                          368   7e-115   
ref|XP_008810306.1|  PREDICTED: phospholipase D alpha 1-like            366   2e-114   
gb|AAP50498.1|  phospholipase D                                         365   2e-114   
emb|CDX80505.1|  BnaC07g29390D                                          365   2e-114   
ref|XP_002451299.1|  hypothetical protein SORBIDRAFT_05g027210          360   5e-112   
gb|EMT15739.1|  Phospholipase D alpha 2                                 352   2e-109   
gb|EEC80931.1|  hypothetical protein OsI_23625                          350   3e-108   
emb|CBI28205.3|  unnamed protein product                                340   9e-107   
ref|XP_004956847.1|  PREDICTED: phospholipase D alpha 1-like            334   4e-102   
ref|XP_003576533.1|  PREDICTED: phospholipase D alpha 1-like            334   5e-102   
gb|EAZ09131.1|  hypothetical protein OsI_31401                          328   7e-100   
ref|NP_001063203.1|  Os09g0421300                                       327   1e-99    
ref|XP_002462392.1|  hypothetical protein SORBIDRAFT_02g024910          323   9e-98    
emb|CDX88175.1|  BnaA06g27660D                                          319   3e-97    
ref|XP_009381793.1|  PREDICTED: phospholipase D alpha 1-like            318   4e-96    
gb|KDO43384.1|  hypothetical protein CISIN_1g0011262mg                  306   5e-96    
ref|XP_008670197.1|  PREDICTED: phospholipase D alpha 1-like isof...    318   5e-96    
gb|KCW72878.1|  hypothetical protein EUGRSUZ_E01326                     319   7e-96    
ref|XP_009410696.1|  PREDICTED: phospholipase D delta-like              316   3e-95    
ref|XP_002320087.2|  hypothetical protein POPTR_0014s07070g             321   3e-95    
ref|XP_006341816.1|  PREDICTED: phospholipase D delta-like isofor...    315   7e-95    
emb|CDY13284.1|  BnaC09g23720D                                          305   9e-95    
ref|NP_001234108.1|  phospholipase PLDb2                                316   1e-94    
ref|XP_010058437.1|  PREDICTED: phospholipase D gamma 1                 320   2e-94    
emb|CDY54926.1|  BnaAnng13600D                                          316   6e-94    
ref|XP_011628580.1|  PREDICTED: phospholipase D delta isoform X6        312   8e-94    
gb|KEH18998.1|  phospholipase D alpha 1                                 312   9e-94    
ref|XP_011628576.1|  PREDICTED: phospholipase D delta isoform X2        312   1e-93    
ref|XP_007159572.1|  hypothetical protein PHAVU_002G2487000g            308   1e-93    
ref|XP_006858490.1|  PREDICTED: phospholipase D delta isoform X1        312   1e-93    
gb|AAB63542.2|  phospholipase D                                         311   1e-93    
ref|XP_001773645.1|  predicted protein                                  312   1e-93    
ref|XP_004492672.1|  PREDICTED: phospholipase D beta 1-like isofo...    311   2e-93    
ref|XP_011628577.1|  PREDICTED: phospholipase D delta isoform X3        312   2e-93    
emb|CDX90066.1|  BnaA10g00160D                                          314   2e-93    
ref|XP_011628579.1|  PREDICTED: phospholipase D delta isoform X5        312   2e-93    
ref|XP_011628578.1|  PREDICTED: phospholipase D delta isoform X4        311   2e-93    
ref|XP_003611170.1|  Phospholipase D                                    311   2e-93    
ref|XP_010517711.1|  PREDICTED: phospholipase D beta 1-like             312   2e-93    
gb|AES94127.2|  phospholipase D alpha 1                                 311   3e-93    
emb|CDY52961.1|  BnaCnng23890D                                          314   3e-93    
ref|XP_008670092.1|  PREDICTED: phospholipase D delta-like isofor...    307   3e-93    
ref|XP_009128477.1|  PREDICTED: phospholipase D beta 2 isoform X1       314   3e-93    
ref|XP_010323957.1|  PREDICTED: phospholipase PLDb2 isoform X1          315   4e-93    
ref|XP_006341817.1|  PREDICTED: phospholipase D delta-like isofor...    310   4e-93    
ref|XP_010911813.1|  PREDICTED: phospholipase D delta-like isofor...    312   5e-93    
ref|XP_003611169.1|  Phospholipase D                                    311   5e-93    
ref|XP_010911814.1|  PREDICTED: phospholipase D delta-like isofor...    312   5e-93    
ref|XP_009119747.1|  PREDICTED: phospholipase D beta 1                  314   6e-93    
emb|CDY15144.1|  BnaC05g00230D                                          314   6e-93    
ref|XP_003623811.1|  Phospholipase D                                    315   6e-93    
ref|XP_008670198.1|  PREDICTED: phospholipase D alpha 1-like isof...    309   6e-93    
ref|XP_006418468.1|  hypothetical protein EUTSA_v10006647mg             314   7e-93    
ref|XP_009796632.1|  PREDICTED: phospholipase D delta-like              310   7e-93    
ref|XP_004248600.1|  PREDICTED: phospholipase D delta-like              310   9e-93    
gb|AER41581.1|  phospholipase+D                                         309   1e-92    
ref|XP_006657599.1|  PREDICTED: phospholipase D delta-like              309   1e-92    
gb|KEH18997.1|  phospholipase D alpha 1                                 313   1e-92    
gb|KDO43378.1|  hypothetical protein CISIN_1g0011262mg                  306   1e-92    
gb|AAC49656.2|  phospholipase D                                         309   2e-92    
ref|XP_010272594.1|  PREDICTED: phospholipase D beta 1-like             309   2e-92    
ref|XP_004956880.1|  PREDICTED: phospholipase D delta-like isofor...    309   2e-92    
emb|CDP08909.1|  unnamed protein product                                313   2e-92    
gb|KFK30609.1|  hypothetical protein AALP_AA6G003800                    313   2e-92    
ref|XP_006339497.1|  PREDICTED: phospholipase D beta 1-like             313   2e-92    
gb|KHN04601.1|  Phospholipase D beta 1                                  312   3e-92    
ref|XP_003532794.1|  PREDICTED: phospholipase D delta-like isofor...    309   3e-92    
ref|XP_003529972.1|  PREDICTED: phospholipase D beta 1-like             312   3e-92    
ref|XP_010272593.1|  PREDICTED: phospholipase D beta 1-like isofo...    308   3e-92    
ref|XP_002881817.1|  phospholipase D beta 1                             312   4e-92    
ref|XP_006295936.1|  hypothetical protein CARUB_v10025073mg             312   4e-92    
ref|XP_009600603.1|  PREDICTED: phospholipase D delta-like              308   4e-92    
ref|XP_002461794.1|  hypothetical protein SORBIDRAFT_02g008130          308   5e-92    
ref|XP_004492671.1|  PREDICTED: phospholipase D beta 1-like isofo...    312   6e-92    
ref|XP_010272591.1|  PREDICTED: phospholipase D beta 1-like isofo...    308   7e-92    
ref|NP_565963.2|  phospholipase D beta 1                                311   7e-92    
ref|XP_010508631.1|  PREDICTED: phospholipase D beta 1 isoform X2       311   7e-92    
ref|XP_008670089.1|  PREDICTED: phospholipase D delta-like isofor...    307   9e-92    
ref|XP_010272589.1|  PREDICTED: phospholipase D beta 1-like isofo...    308   1e-91    
ref|XP_010508627.1|  PREDICTED: phospholipase D beta 1 isoform X1       311   1e-91    
ref|XP_011023457.1|  PREDICTED: phospholipase D beta 2-like isofo...    311   1e-91    
ref|XP_008803289.1|  PREDICTED: phospholipase D beta 1-like             296   1e-91    
ref|XP_009593225.1|  PREDICTED: phospholipase D beta 1-like             307   1e-91    
gb|EEC81825.1|  hypothetical protein OsI_25571                          306   1e-91    
ref|XP_003551823.1|  PREDICTED: phospholipase D beta 1-like isofo...    311   2e-91    
ref|XP_003524234.1|  PREDICTED: phospholipase D delta-like isofor...    306   2e-91    
ref|XP_001782222.1|  predicted protein                                  305   2e-91    
ref|XP_009355262.1|  PREDICTED: phospholipase D delta-like              306   2e-91    
gb|EMT19808.1|  Phospholipase D alpha 2                                 306   2e-91    
ref|XP_007227049.1|  hypothetical protein PRUPE_ppa001322mg             306   3e-91    
ref|XP_011074721.1|  PREDICTED: phospholipase D delta-like              306   3e-91    
ref|XP_011023456.1|  PREDICTED: phospholipase D beta 2-like isofo...    310   3e-91    
ref|XP_008218590.1|  PREDICTED: phospholipase D delta-like              306   3e-91    
ref|XP_009766427.1|  PREDICTED: phospholipase D beta 1-like             306   3e-91    
ref|XP_006287264.1|  hypothetical protein CARUB_v10000454mg             300   4e-91    
ref|XP_006396843.1|  hypothetical protein EUTSA_v10028422mg             306   4e-91    
ref|XP_010426771.1|  PREDICTED: phospholipase D beta 2-like             308   4e-91    
ref|NP_001059324.1|  Os07g0260400                                       305   4e-91    
gb|AES95217.2|  phospholipase D alpha 1                                 306   4e-91    
gb|EMS46791.1|  Phospholipase D beta 1                                  303   4e-91    
ref|XP_007051966.1|  Phospholipase D beta 1 isoform 2                   306   5e-91    
ref|XP_010496901.1|  PREDICTED: phospholipase D beta 2 isoform X2       305   5e-91    
ref|XP_010244835.1|  PREDICTED: phospholipase D delta-like isofor...    305   5e-91    
ref|XP_010244834.1|  PREDICTED: phospholipase D delta-like isofor...    305   5e-91    
ref|XP_008357632.1|  PREDICTED: phospholipase D delta-like              305   5e-91    
gb|KHN13886.1|  Phospholipase D beta 2                                  309   5e-91    
gb|AER41647.1|  phospholipase+D                                         305   6e-91    
ref|XP_006828836.1|  PREDICTED: phospholipase D delta                   305   6e-91    
ref|XP_010523062.1|  PREDICTED: phospholipase D beta 1                  309   7e-91    
gb|AER41566.1|  phospholipase+D                                         305   8e-91    
ref|XP_010540447.1|  PREDICTED: phospholipase D gamma 1-like            305   8e-91    
ref|XP_010244833.1|  PREDICTED: phospholipase D delta-like isofor...    305   8e-91    
ref|XP_010244830.1|  PREDICTED: phospholipase D delta-like isofor...    305   8e-91    
ref|XP_004510892.1|  PREDICTED: phospholipase D beta 1-like             308   8e-91    
ref|XP_006341798.1|  PREDICTED: phospholipase D beta 1-like             308   9e-91    
ref|XP_010496900.1|  PREDICTED: phospholipase D beta 2 isoform X1       304   1e-90    
gb|ACB98704.1|  phospholipase D gamma 1                                 305   1e-90    
ref|XP_006590738.1|  PREDICTED: phospholipase D delta-like              305   1e-90    
ref|XP_010419560.1|  PREDICTED: phospholipase D beta 2-like             307   1e-90    
ref|XP_009128478.1|  PREDICTED: phospholipase D beta 2 isoform X2       303   1e-90    
gb|KJB47452.1|  hypothetical protein B456_008G027300                    304   1e-90    
gb|ABR17779.1|  unknown                                                 304   1e-90    
ref|XP_012071286.1|  PREDICTED: phospholipase D delta-like              303   1e-90    
ref|XP_009776072.1|  PREDICTED: phospholipase D delta-like              304   1e-90    
ref|XP_006573536.1|  PREDICTED: phospholipase D delta-like isofor...    300   2e-90    
ref|XP_004145051.1|  PREDICTED: phospholipase D gamma 1-like            308   2e-90    
gb|KDO38448.1|  hypothetical protein CISIN_1g002960mg                   296   2e-90    
ref|XP_012083503.1|  PREDICTED: phospholipase D beta 2                  308   2e-90    
ref|XP_002301317.2|  PHOSPHOLIPASE D BETA 1 family protein              308   3e-90    
gb|KDP38812.1|  hypothetical protein JCGZ_04969                         303   3e-90    
ref|XP_010497121.1|  PREDICTED: phospholipase D beta 1-like             301   3e-90    
emb|CDX86742.1|  BnaA09g21320D                                          303   3e-90    
ref|XP_009102711.1|  PREDICTED: phospholipase D gamma 1                 303   4e-90    
ref|XP_003629955.1|  Phospholipase D2                                   303   4e-90    
ref|NP_192922.1|  phospholipase D gamma 1                               303   4e-90    
gb|KFK31940.1|  hypothetical protein AALP_AA6G179600                    303   4e-90    
ref|XP_003520025.1|  PREDICTED: phospholipase D beta 1-like             306   5e-90    
gb|KJB48276.1|  hypothetical protein B456_008G061600                    303   5e-90    
ref|NP_567160.1|  phospholipase D beta 2                                304   6e-90    
ref|XP_007051965.1|  Phospholipase D beta 1 isoform 1                   306   6e-90    
ref|XP_002304050.2|  hypothetical protein POPTR_0003s01070g             300   6e-90    
ref|XP_009604374.1|  PREDICTED: phospholipase D beta 1-like             302   6e-90    
ref|XP_003612259.1|  Phospholipase D delta isoform                      306   6e-90    
gb|EYU36813.1|  hypothetical protein MIMGU_mgv1a001300mg                302   6e-90    
ref|XP_002872960.1|  PLDBETA2                                           305   6e-90    
ref|XP_004504195.1|  PREDICTED: phospholipase D delta-like              302   6e-90    
gb|KDO38446.1|  hypothetical protein CISIN_1g002960mg                   297   6e-90    
ref|XP_006441123.1|  hypothetical protein CICLE_v10018583mg             306   7e-90    
ref|XP_011083418.1|  PREDICTED: phospholipase D delta-like isofor...    301   7e-90    
ref|XP_009602808.1|  PREDICTED: phospholipase D delta-like              302   7e-90    
ref|XP_007042278.1|  Phospholipase D                                    302   8e-90    
gb|AAN05432.1|  phospholipase D delta isoform 1b                        302   8e-90    
gb|ADM21349.1|  phospholipase D                                         303   8e-90    
gb|AAN34820.1|  phospholipase D delta isoform                           302   9e-90    
gb|KDO38447.1|  hypothetical protein CISIN_1g002960mg                   297   9e-90    
ref|XP_008445312.1|  PREDICTED: phospholipase D delta-like              302   9e-90    
gb|KJB41190.1|  hypothetical protein B456_007G094100                    306   1e-89    
ref|XP_006491998.1|  PREDICTED: phospholipase D beta 1-like isofo...    306   1e-89    
ref|XP_012065321.1|  PREDICTED: phospholipase D delta-like              302   1e-89    
ref|XP_008460150.1|  PREDICTED: phospholipase D beta 2-like             305   1e-89    
gb|KHG15087.1|  Phospholipase D delta -like protein                     301   1e-89    
ref|XP_002266693.2|  PREDICTED: phospholipase D delta-like isofor...    301   1e-89    
ref|XP_002510602.1|  phospholipase d delta, putative                    301   1e-89    
ref|XP_007046582.1|  Phospholipase D delta isoform 4                    296   1e-89    
gb|KJB41189.1|  hypothetical protein B456_007G094100                    305   1e-89    
gb|EMS68435.1|  Phospholipase D alpha 2                                 301   1e-89    
ref|XP_011035015.1|  PREDICTED: phospholipase D beta 2-like             306   2e-89    
ref|XP_007046581.1|  Phospholipase D delta isoform 3                    296   2e-89    
gb|AEQ02412.1|  phospholipase D                                         297   2e-89    
ref|XP_010529524.1|  PREDICTED: phospholipase D gamma 1                 301   2e-89    
ref|XP_011083417.1|  PREDICTED: phospholipase D delta-like isofor...    301   2e-89    
gb|KDO38444.1|  hypothetical protein CISIN_1g002960mg                   298   2e-89    
ref|XP_002509685.1|  phospholipase d beta, putative                     301   2e-89    
gb|EMT21985.1|  Phospholipase D beta 1                                  298   3e-89    
ref|XP_004248573.2|  PREDICTED: phospholipase D gamma 1-like            305   3e-89    
ref|XP_006435265.1|  hypothetical protein CICLE_v10000269mg             300   3e-89    



>emb|CDP10414.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/375 (82%), Positives = 339/375 (90%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YE+DK+K     NL HKIVEG ERVVGFN TASRLYAT+DLEKARV
Sbjct  1     MAQILLHGTLHATIYEIDKLKGGFGQNLLHKIVEGIERVVGFNNTASRLYATVDLEKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLL+   NPRWYESFHIYCAHMASNV+F+VKVDNPIGAELIGRAY+P + LLG EE+
Sbjct  61    GRTRLLEGDSNPRWYESFHIYCAHMASNVIFTVKVDNPIGAELIGRAYLPVQELLGEEEI  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             D WLP+L +D  PIH HSKIHVK+Q+ DV RER W RG+K+ARFPGVPYTFF Q  GCKV
Sbjct  121   DRWLPILGDDHKPIHGHSKIHVKVQYFDVTRERNWSRGIKSARFPGVPYTFFSQHNGCKV  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQDAH+P+NFIP+IPLAGG+FYEP RCWED+FDAITKAKHL+YITGWSVYTEITLVRD
Sbjct  181   TLYQDAHIPDNFIPKIPLAGGKFYEPHRCWEDMFDAITKAKHLIYITGWSVYTEITLVRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD T+GELLKKKA+EGVRVLMLVWDDRTSV LLK+DGLMATHDEETG YF+ T
Sbjct  241   SRRPKPGGDMTIGELLKKKANEGVRVLMLVWDDRTSVKLLKEDGLMATHDEETGAYFEGT  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVD EMP+G+TERRRIVSF+GGIDLC
Sbjct  301   EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDSEMPNGNTERRRIVSFVGGIDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+PFH LFRTL
Sbjct  361   DGRYDTPFHSLFRTL  375



>ref|XP_009760786.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=807

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/375 (81%), Positives = 342/375 (91%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GF+KTASRLYATIDL+KARV
Sbjct  1     MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFSKTASRLYATIDLQKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLL+EHKNPRWYESFHIYCAHMA++V+F+VK+DNPIGAELIGRAY+P R LL GEEV
Sbjct  61    GRTRLLNEHKNPRWYESFHIYCAHMAADVIFTVKIDNPIGAELIGRAYLPVRELLDGEEV  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             D+WL +LD +R P+H HSKIHVKLQF DV RE  W RG+K  RFPGVPYTFF QR+GCKV
Sbjct  121   DKWLEILDTERKPVHGHSKIHVKLQFFDVTREYNWNRGIKVTRFPGVPYTFFSQRQGCKV  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQDAHVP+NFIP+IPLAGG+FYEPQRCWEDIFDAIT AKHL+YITGWSVYTEITL+RD
Sbjct  181   TLYQDAHVPDNFIPKIPLAGGKFYEPQRCWEDIFDAITNAKHLIYITGWSVYTEITLIRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD TLGELLKKKA+EGVRVLMLVWDDRTSVG+LK+DGLMATHDEET N+F+DT
Sbjct  241   TRRPKPGGDITLGELLKKKANEGVRVLMLVWDDRTSVGVLKQDGLMATHDEETANFFRDT  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             EV+CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP+GD E+RRIVS+IGGIDLC
Sbjct  301   EVNCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPNGDKEKRRIVSYIGGIDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FH LFRTL
Sbjct  361   DGRYDTQFHSLFRTL  375



>ref|XP_009613360.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana tomentosiformis]
Length=807

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/375 (81%), Positives = 340/375 (91%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GFNKTASRLYATIDL+KARV
Sbjct  1     MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFNKTASRLYATIDLQKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLLDEHKNPRWYESFHIYCAHMA++V+F+VKVDNPIGAELIGRAY+P + LL GEEV
Sbjct  61    GRTRLLDEHKNPRWYESFHIYCAHMAADVIFTVKVDNPIGAELIGRAYLPVQELLDGEEV  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             D+WL +LD +R P+H HSKIHVKLQF DV RE  W RG+K  RFPGVPYTFF QR+GCKV
Sbjct  121   DKWLEILDTERKPVHGHSKIHVKLQFFDVTREYNWNRGIKVTRFPGVPYTFFSQRQGCKV  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQD+HVP+NFIP+IPLAGG+FYEPQRCWEDIFDAIT A+HL+YITGWSVYTEITLVRD
Sbjct  181   TLYQDSHVPDNFIPKIPLAGGKFYEPQRCWEDIFDAITNARHLIYITGWSVYTEITLVRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD  LGELLKKKA+EGVRVLMLVWDDRTSVG+LK+DGLMATHDEET N+F+DT
Sbjct  241   TRRPKPGGDIMLGELLKKKANEGVRVLMLVWDDRTSVGVLKQDGLMATHDEETANFFRDT  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             EV+CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIV+VD EMP+GD E+RRIVS+IGGIDLC
Sbjct  301   EVNCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVIVDSEMPNGDNEKRRIVSYIGGIDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FH LFRTL
Sbjct  361   DGRYDTQFHSLFRTL  375



>ref|XP_011078373.1| PREDICTED: phospholipase D alpha 1-like [Sesamum indicum]
Length=808

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/376 (81%), Positives = 337/376 (90%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG LH  +YE+DK+ T  L   FHK+VEG E V+GF  TAS+LYATIDL KARV
Sbjct  1     MAQILLHGDLHATIYEIDKLHTGTLTKFFHKVVEGIEEVLGFGDTASKLYATIDLGKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTRLL  +H NPRWYESFHIYCAHMAS VVF+VKVDNPIGAELIGRAY+P   LL GEE
Sbjct  61    GRTRLLAHQHSNPRWYESFHIYCAHMASQVVFTVKVDNPIGAELIGRAYLPVEELLAGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD WL +L++D  PIH HSKIHVKLQF DV RERCW RG+K+ +FPGVP+TFFPQR+GC+
Sbjct  121   VDRWLEILNDDHKPIHGHSKIHVKLQFYDVTRERCWARGLKSPKFPGVPFTFFPQRKGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAHVP+NFIPRIPL+GG++YEP RCWEDIFDAI+ AKHL+YITGWSVYTEITLVR
Sbjct  181   VTLYQDAHVPDNFIPRIPLSGGKYYEPHRCWEDIFDAISNAKHLIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKA+EGVRVLMLVWDDRTSVGLLK+DGLMATHDEETGNYF+D
Sbjct  241   DTRRPKPGGDITLGELLKKKANEGVRVLMLVWDDRTSVGLLKQDGLMATHDEETGNYFRD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVD E+P+GD ERRRIVSFIGGIDL
Sbjct  301   TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDSELPNGDAERRRIVSFIGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  361   CDGRYDTQFHSLFRTL  376



>ref|XP_006367508.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006367509.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=807

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/375 (79%), Positives = 340/375 (91%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV ++EVDK++T+   ++F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1     MAQILLHGTLHVTIFEVDKLRTNFGRDIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLLDEHKNPRWYESFHIYCAHMAS+V+F+VK DNPIGAELIGRAY+P  RL+ GE V
Sbjct  61    GRTRLLDEHKNPRWYESFHIYCAHMASDVIFTVKADNPIGAELIGRAYLPVERLIDGEVV  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             DEWL +LD +R P+  HSKIHVKLQ+ DV RE  W RG++  RFPGVPYTFF QR+GCKV
Sbjct  121   DEWLEILDTERKPVQGHSKIHVKLQYFDVTREYNWNRGIRVTRFPGVPYTFFSQRQGCKV  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQD+HVP+NF+P+IPLAGG+FYEPQRCWEDIFDAIT AKH++YITGWSVYTEITL+RD
Sbjct  181   TLYQDSHVPDNFVPKIPLAGGKFYEPQRCWEDIFDAITNAKHMIYITGWSVYTEITLIRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD TLGELLKKKA+EGVRVLMLVWDDRTSV +LK+DGLMATHD+ET  YF D+
Sbjct  241   TRRPKPGGDITLGELLKKKANEGVRVLMLVWDDRTSVPVLKQDGLMATHDQETATYFDDS  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             EVHCVLCPRNPDDGRSIIQNI+IGTMFTHHQKIVVVDGE+P+GDTERRRIVS+IGGIDLC
Sbjct  301   EVHCVLCPRNPDDGRSIIQNIQIGTMFTHHQKIVVVDGELPNGDTERRRIVSYIGGIDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FHPLFRTL
Sbjct  361   DGRYDTQFHPLFRTL  375



>ref|NP_001289824.1| uncharacterized protein LOC101257989 [Solanum lycopersicum]
 gb|AAG48162.1|AF154425_1 phospholipase D [Solanum lycopersicum]
Length=807

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/375 (79%), Positives = 339/375 (90%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1     MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61    GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             DEWL +LD +R P+H HSKIHVKLQ+ DV RE  W RG++  RFPGVPYTFF QR+GCK+
Sbjct  121   DEWLEILDTERKPVHGHSKIHVKLQYFDVTREYNWNRGIRVTRFPGVPYTFFSQRQGCKI  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQD+HVP+NF+P+IPLAGG FYEPQRCWEDIFDAIT AKHL+YITGWSVYTEITL+RD
Sbjct  181   TLYQDSHVPDNFVPKIPLAGGNFYEPQRCWEDIFDAITNAKHLIYITGWSVYTEITLIRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD TLGELLKKKA+EGVRVLMLVWDDRTSV +LK+DGLMATHD+ET  YF+++
Sbjct  241   MRRPKPGGDITLGELLKKKANEGVRVLMLVWDDRTSVPVLKEDGLMATHDQETAAYFENS  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGE+P+GDTERRRIVS+IGGIDLC
Sbjct  301   EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGELPNGDTERRRIVSYIGGIDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FH LFRTL
Sbjct  361   DGRYDTQFHSLFRTL  375



>ref|XP_010325100.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum lycopersicum]
Length=807

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/375 (79%), Positives = 339/375 (90%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1     MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61    GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             DEWL +LD +R P+H HSKIHVKLQ+ DV RE  W RG++  RFPGVPYTFF QR+GCK+
Sbjct  121   DEWLEILDTERKPVHGHSKIHVKLQYFDVTREYNWNRGIRVTRFPGVPYTFFSQRQGCKI  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQD+HVP+NF+P+IPLAGG FYEPQRCWEDIFDAIT AKHL+YITGWSVYTEITL+RD
Sbjct  181   TLYQDSHVPDNFVPKIPLAGGNFYEPQRCWEDIFDAITNAKHLIYITGWSVYTEITLIRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD TLGELLKKKA+EGVRVLMLVWDDRTSV +LK+DGLMATHD+ET  YF+++
Sbjct  241   MRRPKPGGDITLGELLKKKANEGVRVLMLVWDDRTSVPVLKEDGLMATHDQETAAYFENS  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGE+P+GDTERRRIVS+IGGIDLC
Sbjct  301   EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGELPNGDTERRRIVSYIGGIDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FH LFRTL
Sbjct  361   DGRYDTQFHSLFRTL  375



>ref|NP_001234863.1| phospholipase PLDa2 [Solanum lycopersicum]
 gb|AAG45486.1| phospholipase PLDa2 [Solanum lycopersicum]
Length=806

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/375 (75%), Positives = 334/375 (89%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1     MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61    GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             DEWL +L+ +R P+H HSKIHVKLQ+ DV R+  W RG+K  RFPGVPYTFF QR+GC+V
Sbjct  121   DEWLEILNTERKPLHGHSKIHVKLQYFDVTRDYNWNRGIKVTRFPGVPYTFFRQRQGCRV  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQD HVP+NFIP+IPL+ G+FY+PQRCWEDIFDA+T AKHL+YITGWS+YTE+TL+RD
Sbjct  181   TLYQDCHVPDNFIPKIPLSDGKFYKPQRCWEDIFDAVTNAKHLIYITGWSIYTEVTLIRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD +LGELLK+KA+EGVRVLMLVWDDRTS+ +L++DGLMATHDEET NYF+ T
Sbjct  241   RRRPKPGGDISLGELLKRKANEGVRVLMLVWDDRTSIPVLQQDGLMATHDEETANYFRGT  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             +V CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIV+VDGEMP+GD ERRRIVS+IGG+DLC
Sbjct  301   QVSCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVIVDGEMPNGDRERRRIVSYIGGLDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FH LFRTL
Sbjct  361   DGRYDTQFHSLFRTL  375



>ref|XP_006367510.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=807

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/375 (75%), Positives = 335/375 (89%), Gaps = 0/375 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1     MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61    GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             DEWL +L+ ++ P+H HSKIHVKLQ+ DV RE  W RG+K  RFPGVPYTFF QR+GC+V
Sbjct  121   DEWLEILNTEQKPVHGHSKIHVKLQYFDVTREYNWNRGIKVTRFPGVPYTFFRQRQGCRV  180

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQD HVP+NFIP+IPL+ G+FY+PQRCWEDIFDAIT AKHL+YITGWS+YTEITL+RD
Sbjct  181   TLYQDCHVPDNFIPKIPLSDGKFYKPQRCWEDIFDAITNAKHLIYITGWSIYTEITLIRD  240

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD +LGELLK+KA+EGVRVLMLVWDDRTS+ +L++DGLMATHDEET NYF+ T
Sbjct  241   RRRPKPGGDISLGELLKRKANEGVRVLMLVWDDRTSIPVLQQDGLMATHDEETANYFRGT  300

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             +V+CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIV+VDGE+P+GD ERRRIVS+IGG+DLC
Sbjct  301   QVNCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVIVDGELPNGDRERRRIVSYIGGLDLC  360

Query  1269  DGRYDSPFHPLFRTL  1313
             DGR+D+ FH LFRTL
Sbjct  361   DGRFDTQFHSLFRTL  375



>gb|EYU23016.1| hypothetical protein MIMGU_mgv1a001487mg [Erythranthe guttata]
Length=810

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/377 (76%), Positives = 327/377 (87%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG LH  +YE+DK+       LFHK+VEG E V+GF +TAS+LYATIDL +ARV
Sbjct  1     MAHILLHGDLHATIYEIDKLHIGAASKLFHKVVEGVEEVLGFKETASKLYATIDLGQARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTRLL  EH NPRWYESFHIYCAH AS V+F++KVDNPIGAELIGRA++P   L+ G+E
Sbjct  61    GRTRLLKHEHTNPRWYESFHIYCAHTASQVIFTIKVDNPIGAELIGRAHIPVSDLMSGDE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D WLP+L  +  P+H H KIHVKL F DV RERCW RG+K+ +FPGVP+TFF QR+GC+
Sbjct  121   IDTWLPILHTNNKPVHGHPKIHVKLHFFDVARERCWSRGLKSPKFPGVPFTFFQQRKGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAHVP++FIP+IPLAGG+FYEP RCWEDIFDAI  AKH++YITGWSVYTEITLVR
Sbjct  181   VTLYQDAHVPDDFIPKIPLAGGKFYEPHRCWEDIFDAIYNAKHMIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLKKKA+EGVRVL+LVWDDRTSVGLLKKDGLM THDEETG YF++
Sbjct  241   DRRRQKPGGDLTLGELLKKKANEGVRVLLLVWDDRTSVGLLKKDGLMMTHDEETGEYFRN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGID  1262
             TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP+ G ++ RR+VSFIGGID
Sbjct  301   TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPNGGGSDVRRLVSFIGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+ FH LFRTL
Sbjct  361   LCDGRYDTQFHSLFRTL  377



>dbj|BAE79735.1| phospholipase D alpha 2 [Arachis hypogaea]
 dbj|BAE79737.1| phospholipase D alpha 2 [Arachis hypogaea]
Length=807

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/376 (75%), Positives = 331/376 (88%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVDK+KT G  N+F K+V+  E  VGF K  ++LYATIDLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDKLKTSG-GNVFTKLVQNIEETVGFGKGVTKLYATIDLEKARV  59

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ +H NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60    GRTRIIEKDHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEDVLDGEE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPIH +SKIHVKLQ+ DV +++ W RGV++A+FPGVPYTFF QRRGCK
Sbjct  120   VDRWVEILDEDKNPIHGNSKIHVKLQYFDVTKDKNWARGVRSAKFPGVPYTFFSQRRGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P+IPLAGG+ Y+P RCWED+FDAI KA+HL+YITGWSVYTEITLVR
Sbjct  180   VSLYQDAHVPDNFVPKIPLAGGQTYQPHRCWEDVFDAIEKARHLIYITGWSVYTEITLVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKA+EGVRVLMLVWDDRTSV LLKKDGLMATHDEET  YF+ 
Sbjct  240   DSRRPKPGGDLTIGELLKKKANEGVRVLMLVWDDRTSVPLLKKDGLMATHDEETEKYFQG  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHC+LCPRNPDDG SIIQ+++I TMFTHHQKIVVVD +MP GD+ +RRIVSF+GGIDL
Sbjct  300   TEVHCILCPRNPDDGGSIIQDLQISTMFTHHQKIVVVDSDMPSGDSGKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  360   CDGRYDTQFHSLFRTL  375



>ref|XP_002517625.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF44789.1| phopholipase d alpha, putative [Ricinus communis]
Length=808

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/376 (73%), Positives = 330/376 (88%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1     MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+G++++++PGVPYT+F QR+GCK
Sbjct  121   IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQGIRSSKYPGVPYTYFSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG +YEP RCWED+FDAIT AKHL+YITGWSVYTEI+L+R
Sbjct  181   VSLYQDAHIPDKFVPQIPLAGGNYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEISLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET ++F++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEHFFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVSF+GG+DL
Sbjct  301   TDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDSAMPNGDSQRRRIVSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYDSPFH LFRTL
Sbjct  361   CDGRYDSPFHSLFRTL  376



>gb|AAG50297.1| phospholipase PLDa3 [Solanum lycopersicum]
Length=678

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/343 (82%), Positives = 312/343 (91%), Gaps = 3/343 (1%)
 Frame = +3

Query  285   VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  464
             +EGA   +GFNKTAS LYATIDL KARVGRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+
Sbjct  3     IEGA---IGFNKTASTLYATIDLGKARVGRTRLLDEHKNPRWYESFHIYCAHMASDVVFT  59

Query  465   VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  644
             VK DNPIGAELIGRAY+P  +L+ GE VDEWL +LD +R P+H HSKIHVKLQ+ DV RE
Sbjct  60    VKADNPIGAELIGRAYLPVEQLIVGEVVDEWLEILDTERKPVHGHSKIHVKLQYFDVTRE  119

Query  645   RCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWED  824
               W RG++  RFPGVPYTFF QR+GCK+TLYQD+HVP+NF+P+IPLAGG FYEPQRCWED
Sbjct  120   YNWNRGIRVTRFPGVPYTFFSQRQGCKITLYQDSHVPDNFVPKIPLAGGNFYEPQRCWED  179

Query  825   IFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWD  1004
             IFDAIT AKHL+YITGWSVYTEITL+RD RRPKPGGD TLGELLKKKA+EGVRVLMLVWD
Sbjct  180   IFDAITNAKHLIYITGWSVYTEITLIRDMRRPKPGGDITLGELLKKKANEGVRVLMLVWD  239

Query  1005  DRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQK  1184
             DRTSV +LK+DGLMATHD+ET  YF+++EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQK
Sbjct  240   DRTSVPVLKEDGLMATHDQETAAYFENSEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQK  299

Query  1185  IVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             IVVVDGE+P+GDTERRRIVS+IGGIDLCDGRYD+ FH LFRTL
Sbjct  300   IVVVDGELPNGDTERRRIVSYIGGIDLCDGRYDTQFHSLFRTL  342



>sp|Q41142.1|PLDA1_RICCO RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Ricinus communis]
 gb|AAB04095.1| phospholipase D [Ricinus communis]
Length=808

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/376 (73%), Positives = 330/376 (88%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1     MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+G++++++PGVPYT+F QR+GCK
Sbjct  121   IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQGIRSSKYPGVPYTYFSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG +YEP RCWED+FDAIT AKHL+YITGWSVYTEI+L+R
Sbjct  181   VSLYQDAHIPDKFVPQIPLAGGNYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEISLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET ++F++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEHFFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVSF+GG+DL
Sbjct  301   TDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDSAMPNGDSQRRRIVSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYDSPFH LFRTL
Sbjct  361   CDGRYDSPFHSLFRTL  376



>gb|AAB37305.1| phospholipase D [Ricinus communis]
Length=808

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 330/376 (88%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1     MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+G++++++PGVPYT+F QR+GCK
Sbjct  121   IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQGIRSSKYPGVPYTYFSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG +YEP RCWED+FDAIT AKHL+YITGWSVYTEI+L+R
Sbjct  181   VSLYQDAHIPDKFVPQIPLAGGNYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEISLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRV+MLVWDDRTSVGLLKKDGLMATHDEET ++F++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVIMLVWDDRTSVGLLKKDGLMATHDEETEHFFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVSF+GG+DL
Sbjct  301   TDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDSAMPNGDSQRRRIVSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYDSPFH LFRTL
Sbjct  361   CDGRYDSPFHSLFRTL  376



>ref|XP_010254401.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
 ref|XP_010254402.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
Length=802

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/375 (75%), Positives = 323/375 (86%), Gaps = 5/375 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHGSLHV +YEVDK+ +      FH+IVE     +G  K   +LYAT+DLEKARV
Sbjct  1     MAQILLHGSLHVTIYEVDKLSSRH-GGFFHQIVEN----IGIGKGTPQLYATVDLEKARV  55

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTR+L E+ NP+W ESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   +L GEEV
Sbjct  56    GRTRMLKENANPQWNESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVEEILNGEEV  115

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             D W+ +LD DRNPIH HSKIHV+LQF DV  +R W  G+K++RFPGVPYTFF QR+GCKV
Sbjct  116   DRWVEILDEDRNPIHGHSKIHVRLQFFDVTHDRNWSMGIKSSRFPGVPYTFFTQRQGCKV  175

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQDAHVP+ FIP+IPL+G +FYEP RCWEDIFDAIT AKHL+YITGWSVYTEI+L+RD
Sbjct  176   TLYQDAHVPDGFIPKIPLSGDKFYEPHRCWEDIFDAITNAKHLIYITGWSVYTEISLIRD  235

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET NYF +T
Sbjct  236   TRRPKPGGDITLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETANYFHNT  295

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             +VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVDGEMP G +E+RRIVSF+GGIDLC
Sbjct  296   DVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDGEMPTGASEQRRIVSFVGGIDLC  355

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FH LFRTL
Sbjct  356   DGRYDTAFHSLFRTL  370



>ref|XP_007150746.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
 gb|ESW22740.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
Length=807

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 326/376 (87%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVDK+K  G  N   KIV   E  VGF K  ++LYATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDKLKIGG-GNFLSKIVHNIEETVGFGKGVTKLYATIDLEKARV  59

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60    GRTRIIEKEHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NPIH +SKIHVKLQ+ D+ ++R W  G+++ +FPGVPYTFF QRRGCK
Sbjct  120   IDRWIEILDVDKNPIHGNSKIHVKLQYFDISKDRNWALGIRSPKFPGVPYTFFSQRRGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P+IPL+GG+ Y+P RCWED+FDAITKA+HL+YITGWSVYTEI+LVR
Sbjct  180   VSLYQDAHVPDNFVPKIPLSGGQTYQPHRCWEDVFDAITKAQHLIYITGWSVYTEISLVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSV LLKKDGLMATHD+ET  YF+ 
Sbjct  240   DSRRPKPGGDETLGELLKKKASEGVRVLMLVWDDRTSVPLLKKDGLMATHDQETEQYFRG  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHCVLCPRNPDDG S +Q++EI TMFTHHQKIVVVD ++P G++E+RRIVSF+GGIDL
Sbjct  300   TEVHCVLCPRNPDDGGSFVQDLEISTMFTHHQKIVVVDSDLPSGESEKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>ref|XP_012073195.1| PREDICTED: phospholipase D alpha 1 [Jatropha curcas]
 gb|ADA72022.1| phospholipase D [Jatropha curcas]
 gb|KDP37092.1| hypothetical protein JCGZ_06148 [Jatropha curcas]
Length=808

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/376 (72%), Positives = 329/376 (88%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVDK+ + G  + F K++E  E  VGF K  ++LYATIDL KARV
Sbjct  1     MAQILLHGTLHATIYEVDKLHSGGGPHFFRKLMENIEETVGFGKGVTKLYATIDLGKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L +EH NPRWYESFHIYCAH AS+V+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRILENEHSNPRWYESFHIYCAHQASDVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD ++NP+   SKIHVKLQ+ D+ ++R WGRG+++ ++PGVPYTF+ QR+GC+
Sbjct  121   IDRWVEILDEEKNPVSGGSKIHVKLQYFDISKDRNWGRGIRSPKYPGVPYTFYSQRQGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+ F+P+IPLAGG++YEP RCWED+FDAIT AKHL+YITGWSVYTEITLVR
Sbjct  181   VSLYQDAHVPDKFVPKIPLAGGKYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET ++F++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEHFFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  +P+GD+E+RRIVSF+GG+DL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSALPNGDSEKRRIVSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYDSPFH LFRTL
Sbjct  361   CDGRYDSPFHSLFRTL  376



>ref|XP_003604419.1| Phospholipase D alpha [Medicago truncatula]
Length=665

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 322/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61    GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++A+FPGVPYTFF QR+GCK
Sbjct  121   IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKDRSWARGIQSAKFPGVPYTFFSQRKGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQD+HVP+NFIP+IPL+GG+ Y+P RCWEDIFDAIT AKH++YITGWSVYTEI+LVR
Sbjct  181   VSLYQDSHVPDNFIPKIPLSGGKTYQPHRCWEDIFDAITNAKHMIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPK GGD T+GELLKKK+SEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET N+F+ 
Sbjct  241   DSRRPKAGGDTTIGELLKKKSSEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETANFFEG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SIIQ++++ TMFTHHQKIVVVD E+P G + +RRIVSF+GG+DL
Sbjct  301   TDVHCVLCPRNPDDGGSIIQDLQVSTMFTHHQKIVVVDSELPGGGSNKRRIVSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_011073436.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
 ref|XP_011073437.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=808

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/376 (72%), Positives = 321/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD++   G  N   K +E  E  +GF K   ++YATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDRLHAGGGGNFLSKFMENVEEKIGFGKGTPKIYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHELLDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPIH  SKIHV+LQF DV R+R W RG+K+A++PGVPYTF+PQR GC+
Sbjct  121   VDRWVEILDEDKNPIHEGSKIHVRLQFFDVPRDRNWARGIKSAKYPGVPYTFYPQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPL+GG  YEP RCWED+FDAIT AKH +YITGWSVYTEITL+R
Sbjct  181   VSLYQDAHVPDNFIPKIPLSGGIHYEPHRCWEDVFDAITNAKHFIYITGWSVYTEITLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLK KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET ++F+ 
Sbjct  241   DSRRSKPGGDITLGELLKNKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEHFFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD ++P G++E+RR+VSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDSDLPSGESEKRRVVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>gb|KCW70692.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=673

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/376 (74%), Positives = 323/376 (86%), Gaps = 3/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1     MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61    GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD +RNPI S  KIHVKL + DV ++R +GRG+++A+FPGVPYTFF QR+GCK
Sbjct  121   LDRWVEILDKERNPIGS--KIHVKLHYFDVSKDRIYGRGIRSAKFPGVPYTFFSQRQGCK  178

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQD+H+P+NFIP+IPLAGG+ YEP RCWEDIFDAI+ AKHL+YITGWSVYTEI+LVR
Sbjct  179   VSLYQDSHIPDNFIPKIPLAGGKHYEPHRCWEDIFDAISNAKHLIYITGWSVYTEISLVR  238

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKA+EGVRVLMLVWDDRTSVGLLKKDGLMATHDEET +YF D
Sbjct  239   DSRRPKPGGDITIGELLKKKANEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEHYFHD  298

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP   ++RRRIVSF+GGIDL
Sbjct  299   TEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSEMPSEGSQRRRIVSFVGGIDL  358

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  359   CDGRYDTPFHSLFRTL  374



>gb|EPS65578.1| hypothetical protein M569_09194 [Genlisea aurea]
Length=808

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 323/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD++   G  N F K+ E  E  VG  K  S++YATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDRLHVGGGRNFFSKLKENFEEAVGIGKGTSKIYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E +NPRWYESFHIYCAH+AS+V+F+VK +NPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRMIENEPENPRWYESFHIYCAHLASDVIFTVKDNNPIGATLIGRAYVPVSELLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NPIH  SKIHVKLQ+ DV R+R W RG+K+A++PGVPYTFF QR GC+
Sbjct  121   IDRWVEILDEDKNPIHGESKIHVKLQYFDVSRDRNWARGIKSAKYPGVPYTFFSQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIPRIPL+GG+ YEP RCWED+FDAI+ AKHL+YITGWSVYTEI+LVR
Sbjct  181   VSLYQDAHVPDNFIPRIPLSGGQSYEPHRCWEDVFDAISNAKHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD T+GELLKKKA+EGVRVL+LVWDDRTSVGLLKKDGLMATHDEET +YFKD
Sbjct  241   DNRRQKPGGDMTIGELLKKKANEGVRVLLLVWDDRTSVGLLKKDGLMATHDEETEHYFKD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHCVLCPRNPDDG S +Q+++I TMFTHHQKI+VVD   P G++ERRRIVSF+GGIDL
Sbjct  301   TEVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIIVVDHGFPSGESERRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  361   CDGRYDTQFHSLFRTL  376



>ref|XP_006385316.1| phospholipase D family protein [Populus trichocarpa]
 gb|ERP63113.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/376 (72%), Positives = 323/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV ++EVDK+   G H   HK+VE     VG     S+LYATIDLE+ARV
Sbjct  1     MAQVLLHGTLHVTIFEVDKLGDGGGHGFLHKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61    GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NPI S SKIHVKLQ+ DV ++R WG G+++A++PGVPYTF+PQR+GCK
Sbjct  121   IDRWVEMLDEDKNPIQSSSKIHVKLQYFDVTKDRNWGGGIRSAKYPGVPYTFYPQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+ FIP+IPLA G  Y P RCWED+FD+IT AKH +YITGWSVYTEI+LVR
Sbjct  181   VSLYQDAHVPDKFIPKIPLASGEDYNPHRCWEDVFDSITNAKHFIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVL+L+WDDRTSV LLKKDGLMATHDEET NYF++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVLILIWDDRTSVDLLKKDGLMATHDEETENYFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVS++GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSAMPNGDSQRRRIVSYVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_009799916.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
 ref|XP_009799917.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
Length=808

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/376 (73%), Positives = 323/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +G  K    +YAT+DLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGLGKGTPEIYATVDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E KNPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRKIKNEPKNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D+W+ +LD + NPI   SKIHVKLQF DV R+  W RG++++++PGVPYTFF QR GC+
Sbjct  121   IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWARGIRSSKYPGVPYTFFAQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V LYQDAHVP+NFIP+IPLAGG++YEP RCWEDIFDAIT AKHL+YITGWSVYTEITLVR
Sbjct  181   VNLYQDAHVPDNFIPKIPLAGGKYYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHD+ET  +F+ 
Sbjct  241   DSRRQKPGGDITLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDQETEQFFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEV+CVLCPRNPDDG SI+Q+++IGTMFTHHQKIVVVD E+P G++E+RRI+SF+GGIDL
Sbjct  301   TEVNCVLCPRNPDDGGSIVQSLQIGTMFTHHQKIVVVDSELPSGESEKRRILSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>sp|P86387.1|PLDA1_CARPA RecName: Full=Phospholipase D alpha 1; Short=CpPLD1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Carica papaya]
Length=808

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/376 (72%), Positives = 320/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA  L+HG+LH  VYEVDK+ + G+   F KI+   E  +G  K  ++LYATIDLE+ARV
Sbjct  1     MAHYLMHGTLHATVYEVDKLHSGGISGFFGKILANVEGTIGIGKGVTQLYATIDLERARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR++ DE  NP+WYESFHIYCAHMASNVVF+VK DNPIGA LIGRAY+P   L+ G++
Sbjct  61    GRTRIIKDEPNNPKWYESFHIYCAHMASNVVFTVKDDNPIGATLIGRAYVPVEELIRGDQ  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPI   SKIHVKLQF DV ++  W  G+K AR+ GVPYTF+ QRRGC+
Sbjct  121   VDRWVEILDEDKNPIEGDSKIHVKLQFFDVKKDSNWNMGIKGARYLGVPYTFYSQRRGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+ FIP+IPLAGG++YEP RCWED+FDAIT A+HL+YITGWSVYTEITL+R
Sbjct  181   VSLYQDAHVPDGFIPKIPLAGGKYYEPHRCWEDVFDAITNARHLIYITGWSVYTEITLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLK+KASEGV+VLMLVWDDRTSVGLLKKDGLMATHDEET NYF++
Sbjct  241   DSRRPKPGGDVTLGELLKQKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDEETANYFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG S +Q ++I TMFTHHQKIVVVDGEMP G+++ RRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSFVQGLQISTMFTHHQKIVVVDGEMPSGESQMRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>gb|AES86616.2| phospholipase D alpha 1 [Medicago truncatula]
Length=808

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 322/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61    GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++A+FPGVPYTFF QR+GCK
Sbjct  121   IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKDRSWARGIQSAKFPGVPYTFFSQRKGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQD+HVP+NFIP+IPL+GG+ Y+P RCWEDIFDAIT AKH++YITGWSVYTEI+LVR
Sbjct  181   VSLYQDSHVPDNFIPKIPLSGGKTYQPHRCWEDIFDAITNAKHMIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPK GGD T+GELLKKK+SEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET N+F+ 
Sbjct  241   DSRRPKAGGDTTIGELLKKKSSEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETANFFEG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SIIQ++++ TMFTHHQKIVVVD E+P G + +RRIVSF+GG+DL
Sbjct  301   TDVHCVLCPRNPDDGGSIIQDLQVSTMFTHHQKIVVVDSELPGGGSNKRRIVSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_003528334.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006583126.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/377 (73%), Positives = 321/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1     MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61    VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             E+D W+ +LD ++NPIH  SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121   EIDRWVEILDEEKNPIHEGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAHVP+NF+P+IPLAGG+ YE  RCWEDIFDAIT AKH +YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHVPDNFVPKIPLAGGKNYEAHRCWEDIFDAITDAKHFIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHDEET  +F 
Sbjct  241   RDSRRPKPGGDQTLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDEETAQFFD  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              TEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVDG MP G ++RRRIVSF+GGID
Sbjct  301   GTEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDGAMPGGGSDRRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+ FH LFRTL
Sbjct  361   LCDGRYDTAFHSLFRTL  377



>ref|XP_010063458.1| PREDICTED: phospholipase D alpha 1 [Eucalyptus grandis]
Length=805

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/376 (74%), Positives = 323/376 (86%), Gaps = 3/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1     MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61    GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD +RNPI S  KIHVKL + DV ++R +GRG+++A+FPGVPYTFF QR+GCK
Sbjct  121   LDRWVEILDKERNPIGS--KIHVKLHYFDVSKDRIYGRGIRSAKFPGVPYTFFSQRQGCK  178

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQD+H+P+NFIP+IPLAGG+ YEP RCWEDIFDAI+ AKHL+YITGWSVYTEI+LVR
Sbjct  179   VSLYQDSHIPDNFIPKIPLAGGKHYEPHRCWEDIFDAISNAKHLIYITGWSVYTEISLVR  238

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKA+EGVRVLMLVWDDRTSVGLLKKDGLMATHDEET +YF D
Sbjct  239   DSRRPKPGGDITIGELLKKKANEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEHYFHD  298

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP   ++RRRIVSF+GGIDL
Sbjct  299   TEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSEMPSEGSQRRRIVSFVGGIDL  358

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  359   CDGRYDTPFHSLFRTL  374



>ref|XP_003543677.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006595164.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
 gb|KHN44174.1| Phospholipase D alpha 1 [Glycine soja]
Length=807

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/376 (73%), Positives = 322/376 (86%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVDK+K  G  N   KIV+  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDKLKIGG-GNFLTKIVQNIEETVGIGKGVTKLYATIDLEKARV  59

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E KNPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  60    GRTRIIEKEIKNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVQEILHGEE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD  +NPIH HSKIHVKLQ+ DV ++R W  G+++ +FPGVPYTFF QRRGCK
Sbjct  120   IDRWVEILDEHKNPIHGHSKIHVKLQYFDVSKDRNWALGIRSPKFPGVPYTFFSQRRGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P+I L+GG+ Y+  RCWED+FDAITKA+HL+YITGWSVYTEI+LVR
Sbjct  180   VSLYQDAHVPDNFVPKIQLSGGQTYQAHRCWEDVFDAITKAQHLIYITGWSVYTEISLVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKA EGVRVLMLVWDDRTSV LLKKDGLMATHD+ET  YF+ 
Sbjct  240   DSRRPKPGGDETLGELLKKKAREGVRVLMLVWDDRTSVPLLKKDGLMATHDQETEEYFRG  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHCVLCPRNPDDG S +Q++EI TMFTHHQKIVVVDGE+P GD+ +RRIVSF+GGIDL
Sbjct  300   TEVHCVLCPRNPDDGGSFVQDLEISTMFTHHQKIVVVDGELPSGDSNKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  360   CDGRYDTQFHSLFRTL  375



>ref|XP_011008452.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011008453.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=808

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/376 (72%), Positives = 323/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV ++EVDK+   G H    K+VE     VG     S+LYATIDLE+ARV
Sbjct  1     MAQILLHGTLHVTIFEVDKLGDGGGHGFLRKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61    GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NPI S SKIHVKLQ+ DV ++R WG G+++ ++PGVPYTF+PQR+GCK
Sbjct  121   IDRWVEMLDEDKNPIDSGSKIHVKLQYFDVTKDRNWGGGIRSPKYPGVPYTFYPQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+ FIP+IPLA G +Y P RCWED+FD+IT AKH +YITGWSVYTEI+LVR
Sbjct  181   VSLYQDAHVPDKFIPKIPLASGEYYNPHRCWEDVFDSITNAKHFIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVL+L+WDDRTSVGLLK+DGLMATHDEET NYF++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVLILIWDDRTSVGLLKEDGLMATHDEETENYFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVS++GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSAMPNGDSQRRRIVSYVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>gb|KDO48582.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
 gb|KDO48583.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=662

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 321/376 (85%), Gaps = 7/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55    GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115   VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P IPLAGG++YEP RCWEDIFDAIT A+H++YITGWSVYTEI+LVR
Sbjct  175   VSLYQDAHVPDNFVPEIPLAGGKYYEPHRCWEDIFDAITNARHMIYITGWSVYTEISLVR  234

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLKKKASEGVRV MLVWDDRTSV LLKKDGLMATHDEET  +F+ 
Sbjct  235   DSRRPKPGGDIMLGELLKKKASEGVRVCMLVWDDRTSVSLLKKDGLMATHDEETEKFFQG  294

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHC+LCPRNPDDG S IQ+I+I  MFTHHQKIVVVD  MP+GD ERRRI+SF+GGIDL
Sbjct  295   TDVHCILCPRNPDDGGSFIQDIQISAMFTHHQKIVVVDSPMPNGDPERRRIMSFVGGIDL  354

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  355   CDGRYDTPFHSLFRTL  370



>ref|XP_011012164.1| PREDICTED: phospholipase D alpha 1 [Populus euphratica]
Length=808

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 325/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1     MAQILLHGNLHVTIYEVDKIGDGGGHGFFHKLVGSIGEKVGVGNGISRLYATIDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L +E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61    GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NPIH+ SKIHVKLQ+ D+ ++  WGRG++ +++PGVPYTFF QR+GC+
Sbjct  121   IDRWVEILDGDKNPIHAGSKIHVKLQYFDISKDHNWGRGIRGSKYPGVPYTFFSQRQGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ FIP+IPLA G +YEP RCWED+FDAIT AKHL+YITGWSVYTEI+LVR
Sbjct  181   VSLYQDAHIPDKFIPKIPLASGEYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET +YF++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETEHYFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVS++GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSAMPNGDSQRRRIVSYVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_009625689.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625690.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625691.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625692.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=808

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/376 (72%), Positives = 323/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D+W+ +LD + NPI   SKIHVKLQF DV R+  W RG++++++PGVPYTFF QR GC+
Sbjct  121   IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWERGIRSSKYPGVPYTFFAQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPL+GG++YEP RCWEDIFDAI  AKHL+YITGWSVYTEITLVR
Sbjct  181   VSLYQDAHVPDNFIPKIPLSGGKYYEPHRCWEDIFDAIINAKHLIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHD+ET  +F+ 
Sbjct  241   DSRRQKPGGDITLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDQETEQFFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEV+CVLCPRNPDDG SI+Q+++IGTMFTHHQKIVVVD E+P G++E+RRI+SF+GGIDL
Sbjct  301   TEVNCVLCPRNPDDGGSIVQSLQIGTMFTHHQKIVVVDSELPSGESEKRRILSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>sp|P93400.2|PLDA1_TOBAC RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Nicotiana tabacum]
 emb|CAB06620.1| phospholipase D [Nicotiana tabacum]
Length=808

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/376 (72%), Positives = 323/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D+W+ +LD + NPI   SKIHVKLQF DV R+  W RG++++++PGVPYTFF QR GC+
Sbjct  121   IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWERGIRSSKYPGVPYTFFAQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPL+GG++YEP RCWEDIFDAI  AKHL+YITGWSVYTEITLVR
Sbjct  181   VSLYQDAHVPDNFIPKIPLSGGKYYEPHRCWEDIFDAIINAKHLIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHD+ET  +F+ 
Sbjct  241   DSRRQKPGGDITLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDQETEQFFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEV+CVLCPRNPDDG SI+Q+++IGTMFTHHQKIVVVD E+P G++E+RRI+SF+GGIDL
Sbjct  301   TEVNCVLCPRNPDDGGSIVQSLQIGTMFTHHQKIVVVDSELPSGESEKRRILSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>gb|KHN01336.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/377 (72%), Positives = 320/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1     MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61    VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121   EIDRWVEILDEEKNPIREGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAHVP+NF+P+IPLAGG+ YE  RCWEDIFDAIT AKH +YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHVPDNFVPKIPLAGGKNYEAHRCWEDIFDAITDAKHFIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHDEET  +F 
Sbjct  241   RDSRRPKPGGDQTLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDEETAQFFD  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              TEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVDG MP G ++RRRIVSF+GGID
Sbjct  301   GTEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDGAMPGGGSDRRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+ FH LFRTL
Sbjct  361   LCDGRYDTAFHSLFRTL  377



>ref|XP_004506968.1| PREDICTED: phospholipase D alpha 1-like [Cicer arietinum]
Length=793

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 320/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVDK++  G  N+F  I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDKLQAGGGGNIFSMIRQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NP+WYESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61    GRTRIIENEHTNPKWYESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVDEILDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++A+FPGVPYTFF QR+GC 
Sbjct  121   IDRWVEILDEEKNPIPEGSKIHVKLQYFDVTKDRSWARGIQSAKFPGVPYTFFSQRQGCN  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P+I L+GG+ Y+P RCWEDIFDAIT AKHL+YITGWSVYTEI+LVR
Sbjct  181   VSLYQDAHVPDNFVPKISLSGGKTYKPHRCWEDIFDAITNAKHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPK GGD TLGELLKKK+SEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  +F  
Sbjct  241   DSRRPKAGGDVTLGELLKKKSSEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETAQFFDG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD E+P G +++RRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSELPRGGSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  361   CDGRYDTAFHSLFRTL  376



>ref|XP_008461111.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
Length=833

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/394 (70%), Positives = 322/394 (82%), Gaps = 6/394 (2%)
 Frame = +3

Query  135   LPVLCFILSASS*PPLSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGF  314
             L   CF L          M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG 
Sbjct  13    LNFYCFSLQIQV-----RMEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGI  67

Query  315   NKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  491
              K  ++LYATIDLEKARVGRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA
Sbjct  68    GKGQTKLYATIDLEKARVGRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGA  127

Query  492   ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKA  671
              LIGRAY+P   ++ GEEVD W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+K+
Sbjct  128   TLIGRAYVPVEDIVDGEEVDRWVPILDENQNPIEGESKIHVKLQYFSVTKDRNWGRGIKS  187

Query  672   ARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAK  851
              +FPGVPYT++ QR+GCKV+LYQDAHVP+NFIP+IPLAGG+ Y P RCWEDIFDAI  AK
Sbjct  188   RKFPGVPYTYYSQRQGCKVSLYQDAHVPDNFIPKIPLAGGKNYTPARCWEDIFDAIKNAK  247

Query  852   HLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLK  1031
             H++YITGWSVYTEI LVRD RRPKPGGD  LGELLK+KASEGVRVLMLVWDDRTSVGLLK
Sbjct  248   HMIYITGWSVYTEIALVRDSRRPKPGGDTMLGELLKQKASEGVRVLMLVWDDRTSVGLLK  307

Query  1032  KDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP  1211
             KDGLMATHDEET  YF+DT+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP
Sbjct  308   KDGLMATHDEETERYFQDTDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSPMP  367

Query  1212  DGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             +GD++RRRIVSF+GGIDLCDGRYD+PFH LFRTL
Sbjct  368   NGDSDRRRIVSFVGGIDLCDGRYDTPFHSLFRTL  401



>ref|XP_006427267.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
 gb|ESR40507.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
Length=802

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 321/376 (85%), Gaps = 7/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55    GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115   VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P IPLAGG++YEP RCWEDIFDAIT A+H++YITGWSVYTEI+LVR
Sbjct  175   VSLYQDAHVPDNFVPEIPLAGGKYYEPHRCWEDIFDAITNARHMIYITGWSVYTEISLVR  234

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLKKKASEGVRV MLVWDDRTSV LLKKDGLMATHDEET  +F+ 
Sbjct  235   DSRRPKPGGDIMLGELLKKKASEGVRVCMLVWDDRTSVSLLKKDGLMATHDEETEKFFQG  294

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHC+LCPRNPDDG S IQ+I+I  MFTHHQKIVVVD  MP+GD ERRRI+SF+GGIDL
Sbjct  295   TDVHCILCPRNPDDGGSFIQDIQISAMFTHHQKIVVVDSPMPNGDPERRRIMSFVGGIDL  354

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  355   CDGRYDTPFHSLFRTL  370



>ref|XP_004486668.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Cicer arietinum]
 ref|XP_004486669.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Cicer arietinum]
 ref|XP_004486670.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Cicer arietinum]
Length=809

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/377 (72%), Positives = 322/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG LH  +YEVDKIK  G  N+F KI +  E  +GF    ++LYATIDLEKARV
Sbjct  1     MAQILLHGFLHATIYEVDKIKNIGGRNIFSKIKQNFEETIGFGDGVTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61    GRTRIIEKEHTNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D+W+ +LD  +NPIH  SKIHVKLQF DV  +R W  G+++ +FPGVPYTFF QR+GCK
Sbjct  121   IDKWVEILDEHKNPIHGDSKIHVKLQFFDVTHDRNWALGIRSPKFPGVPYTFFTQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQD+H+P+NF+P I LAGG+ Y+P RCWEDIFDAITKA+HL+YITGWSVYTEI+LVR
Sbjct  181   VSLYQDSHIPDNFVPNIQLAGGQTYKPHRCWEDIFDAITKARHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKA EGVRVLMLVWDDRTSVGLLKKDGLMATHD+ET  +F+ 
Sbjct  241   DSRRPKPGGDTTLGELLKKKAQEGVRVLMLVWDDRTSVGLLKKDGLMATHDQETAEFFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGGID  1262
             +EV+CVLCPRNPD+G S IQ+IEIGTMFTHHQKIVVVD E+P +   ++RRIVSF+GGID
Sbjct  301   SEVNCVLCPRNPDNGGSFIQDIEIGTMFTHHQKIVVVDSELPNEAGLDKRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>ref|XP_002299756.1| phospholipase D family protein [Populus trichocarpa]
 gb|EEE84561.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 323/376 (86%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1     MAQILLHGNLHVTIYEVDKIGEGGGHGFFHKLVGKVGEKVGIGNGISRLYATIDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L +E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61    GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD D+NPI + SKIHVKLQ+ D+  +  WGRG++ +++PGVPYTF+ QR+GC+
Sbjct  121   IDRWVEILDGDKNPIRAGSKIHVKLQYFDITNDHNWGRGIRGSKYPGVPYTFYSQRQGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ FIP+IPLA G +YEP RCWED+FDAIT AKHL+YITGWSVYTEI+LVR
Sbjct  181   VSLYQDAHIPDKFIPKIPLASGEYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGVRVLML+WDDRTSVGLLK+DGLMATHDEET +YF++
Sbjct  241   DSRRPKPGGDITLGELLKKKASEGVRVLMLIWDDRTSVGLLKRDGLMATHDEETEHYFQN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHC+LCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVS+IGGIDL
Sbjct  301   TDVHCILCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSAMPNGDSQRRRIVSYIGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|NP_001275827.1| phospholipase D alpha [Citrus sinensis]
 gb|ACA49723.1| phospholipase D alpha [Citrus sinensis]
Length=802

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/376 (73%), Positives = 320/376 (85%), Gaps = 7/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P    LGGEE
Sbjct  55    GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEALGGEE  114

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115   VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P IPLAGG++YEP RCWEDIFDAIT A+H++YITGWSVYTEI+LVR
Sbjct  175   VSLYQDAHVPDNFVPEIPLAGGKYYEPHRCWEDIFDAITNARHMIYITGWSVYTEISLVR  234

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGG  TLGELLKKKASEGVRV MLVWDDRTSV LLKKDGLMATHDEET  +F+ 
Sbjct  235   DSRRPKPGGGITLGELLKKKASEGVRVCMLVWDDRTSVSLLKKDGLMATHDEETEKFFQG  294

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHC+LCPRNPDDG S IQ+I+I  MFTHHQKIVVVD  MP+GD ERRRI+SF+GGIDL
Sbjct  295   TDVHCILCPRNPDDGGSFIQDIQISAMFTHHQKIVVVDSPMPNGDPERRRIMSFVGGIDL  354

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  355   CDGRYDTPFHSLFRTL  370



>emb|CAB43063.1| phospholipase D1 [Craterostigma plantagineum]
Length=807

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/376 (71%), Positives = 319/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD++ + G  N F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDQLHSGGGGNFFTKLKANIEETVGFGKGTPKIYASIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  61    GRTRMIEHEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVQEILDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LDND+NPI   SKIHVKLQ+ DV R+  W RG+K+ ++PGVPYTFF QR GCK
Sbjct  121   IDRWVEILDNDKNPISGESKIHVKLQYFDVTRDLNWNRGIKSVKYPGVPYTFFAQRTGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP++FIP IPL+G   Y+P RCWED+FDAI+ AKHL+YITGWSVYTEITL+R
Sbjct  181   VSLYQDAHVPDSFIPDIPLSGSNNYDPHRCWEDVFDAISNAKHLIYITGWSVYTEITLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLKKKASEGV VLMLVWDDRTSVGLLKKDGLMATHDEET +YF+ 
Sbjct  241   DSRREKPGGDITLGELLKKKASEGVNVLMLVWDDRTSVGLLKKDGLMATHDEETEHYFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG S +Q+++I TMFTHHQKI+VVD ++P G +++RRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIIVVDSDLPSGGSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_011081358.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=807

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/376 (72%), Positives = 320/376 (85%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M+Q+LLHG+LH  ++EVD +K  G   +F K++E  E  VG  K  S+LYATIDLEK+RV
Sbjct  1     MSQILLHGTLHATIFEVDNLKGGG-GGIFSKLMENIEETVGIGKGVSQLYATIDLEKSRV  59

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTRL+ +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL G+E
Sbjct  60    GRTRLIENEPSNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHDLLEGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W  +LD D+NPI   SKIHVKLQF D+ R+R W  G+++++ PGVPYTFF QR GC+
Sbjct  120   VDRWAEILDEDKNPITEGSKIHVKLQFFDITRDRNWAHGIQSSKNPGVPYTFFAQRTGCQ  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+L+QDAHVP+NFIP+IPL+GG+ YEPQRCWED+F+AIT AKHL+YITGWSVYTEI L+R
Sbjct  180   VSLFQDAHVPDNFIPKIPLSGGKHYEPQRCWEDVFEAITNAKHLIYITGWSVYTEIELIR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR K GGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHDEET NYF+D
Sbjct  240   DSRRQKSGGDTTLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDEETYNYFQD  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEV+CVLCPRNPDDG SI+QN++I TMFTHHQKIVVVD  MP G +++RR+VSF+GGIDL
Sbjct  300   TEVNCVLCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSAMPRGGSQKRRLVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>ref|XP_006465340.1| PREDICTED: phospholipase D alpha 1 [Citrus sinensis]
Length=802

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/376 (72%), Positives = 321/376 (85%), Gaps = 7/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1     MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55    GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115   VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P IPLAGG++YEP RCWEDIFDAIT A+H++YITGWSVYTEI+LVR
Sbjct  175   VSLYQDAHVPDNFVPEIPLAGGKYYEPHRCWEDIFDAITNARHMIYITGWSVYTEISLVR  234

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLKKKASEGVRV MLVWDDRTSV LLK+DGLMATHDEET  +F+ 
Sbjct  235   DSRRPKPGGDIMLGELLKKKASEGVRVCMLVWDDRTSVSLLKRDGLMATHDEETEKFFQG  294

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHC+LCPRNPDDG S IQ+I+I  MFTHHQKIVVVD  MP+GD ERRRI+SF+GGIDL
Sbjct  295   TDVHCILCPRNPDDGGSFIQDIQISAMFTHHQKIVVVDSPMPNGDPERRRIMSFVGGIDL  354

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  355   CDGRYDTPFHSLFRTL  370



>ref|XP_003531710.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006585630.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/377 (72%), Positives = 320/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1     MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61    VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121   EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAHVP+NF+P+IPLAGG+ YE  RCWEDIFDAIT A+H +YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHVPDNFVPKIPLAGGKNYEAHRCWEDIFDAITNARHFIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKA+EGV+VLMLVWDDRTSVGLLKKDGLMATHDEET  +F+
Sbjct  241   RDSRRPKPGGDQTLGELLKKKANEGVKVLMLVWDDRTSVGLLKKDGLMATHDEETAQFFE  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              TEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVDG MP   ++RRRIVSF+GGID
Sbjct  301   GTEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDGAMPGEGSDRRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+ FH LFRTL
Sbjct  361   LCDGRYDTAFHSLFRTL  377



>gb|ABB82551.1| phospholipase D-alpha [Cucumis melo var. inodorus]
Length=808

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/376 (72%), Positives = 317/376 (84%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGR Y+P   ++ GEE
Sbjct  61    GRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGATLIGRTYVPVEDIVDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+K+ +FPGVPYT++ QR+GCK
Sbjct  121   VDRWVPILDENQNPIEGESKIHVKLQYFSVTKDRNWGRGIKSRKFPGVPYTYYSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPLAGG+ Y P RCWEDIFDAI  AKH++YITGWSVYTEI LVR
Sbjct  181   VSLYQDAHVPDNFIPKIPLAGGKNYTPARCWEDIFDAIKNAKHMIYITGWSVYTEIALVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  YF+D
Sbjct  241   DSRRPKPGGDTMLGELLKQKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETERYFQD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+GD++RRRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSPMPNGDSDRRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_009146200.1| PREDICTED: phospholipase D alpha 1 [Brassica rapa]
Length=810

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/378 (71%), Positives = 324/378 (86%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1     MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61    VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ A+H++YITGWSVYTEI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAQHMIYITGWSVYTEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDMTVGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+QN+++  MFTHHQKIVVVD EMP  G ++ RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEMPSQGGSQMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>gb|KHN47766.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/377 (72%), Positives = 319/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1     MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61    VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121   EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAHVP+NF+P+IPLAGG+ YE  RCWEDIFDAIT A+H +YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHVPDNFVPKIPLAGGKNYEAHRCWEDIFDAITNARHFIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKA+EGV+VLMLVWDDRTSVGLLKKDGLMATHDEET  +F 
Sbjct  241   RDSRRPKPGGDQTLGELLKKKANEGVKVLMLVWDDRTSVGLLKKDGLMATHDEETAQFFD  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              TEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVDG MP   ++RRRIVSF+GGID
Sbjct  301   GTEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDGAMPGEGSDRRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+ FH LFRTL
Sbjct  361   LCDGRYDTAFHSLFRTL  377



>sp|O82549.1|PLDA1_BRAOC RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78487.1| phospholipase D1 [Brassica oleracea var. capitata]
 gb|AAD17208.1| phospholipase D1 [Brassica oleracea var. capitata]
 emb|CDY30108.1| BnaC05g37540D [Brassica napus]
Length=810

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 324/378 (86%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1     MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61    VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ A+H++YITGWSVYTEI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAQHMIYITGWSVYTEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDVTVGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+QN+++  MFTHHQKIVVVD EMP  G ++ RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEMPSRGGSQMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>emb|CDY21865.1| BnaC01g35830D [Brassica napus]
Length=812

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/380 (72%), Positives = 320/380 (84%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             MAQ LLHG+LH  +YEVD + T GL +     KI+   E  VGF K  ++LYATIDL+KA
Sbjct  1     MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETVGFGKGETQLYATIDLQKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61    RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+G
Sbjct  121   EEVEKWVEILDNDRNPIHGESKIHVKLQYFGVEADRNWNMGVKSAKFPGVPYTFFSQRQG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQ AHVP+NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEITL
Sbjct  181   CKVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPKPGGD TLGELLKKKA+EGVRVL+LVWDDRTSV +LKKDGLMATHDE+T NYF
Sbjct  241   VRDSRRPKPGGDMTLGELLKKKATEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD--GDTERRRIVSFIG  1253
               +EVHCVLCPRNPDDG SI+QN+++  MFTHHQKIVVVD E+P   G +E RRI+SF+G
Sbjct  301   NGSEVHCVLCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEVPSQGGGSEMRRIMSFVG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+PFH LFRTL
Sbjct  361   GIDLCDGRYDTPFHSLFRTL  380



>gb|AIE90138.1| phospholipase D1, partial [Brassica napus]
Length=810

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 324/378 (86%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1     MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61    VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ A+H++YITGWSVYTEI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAQHMIYITGWSVYTEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDVTVGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+QN+++  MFTHHQKIVVVD EMP  G ++ RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEMPSRGGSQMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_010907269.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
 ref|XP_010907270.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
Length=813

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 322/381 (85%), Gaps = 6/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LHV ++E + +      + G      ++VEG E  +G  K +S+LYATIDL
Sbjct  1     MAQILLHGTLHVTIFEANSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTRL+  E  NPRWYESFHIYCAHM++NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61    EKARVGRTRLITKEPVNPRWYESFHIYCAHMSANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEEVD W+ + D DRNP+   ++IHVK+Q+ D+ ++R W RG+++A++PGVPYTFF Q
Sbjct  121   LNGEEVDRWIEICDEDRNPLDGGARIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NFIP+IPLA G++YEP RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  181   RQGCKVTLYQDAHVPDNFIPKIPLADGKYYEPHRCWEDIFDAISNAQHLIYITGWSVYTE  240

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD +R KPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  241   ITLVRDAKRQKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  300

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+DT+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSF+
Sbjct  301   NYFQDTDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDHEMPNKSSQQRRIVSFV  360

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ FH LFRTL
Sbjct  361   GGIDLCDGRYDTQFHSLFRTL  381



>ref|XP_010097235.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB67302.1| Phospholipase D alpha 1 [Morus notabilis]
Length=808

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/376 (71%), Positives = 318/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHGSLH  +YEVDK++  G  N F K+V+  +  VG     ++LYATIDLEKARV
Sbjct  1     MAHILLHGSLHATIYEVDKLRGKGGGNFFSKLVDNIQETVGLGDGVTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NPRW+ESFHIYCAH+ASNVVF+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61    GRTRIIEKEHSNPRWFESFHIYCAHLASNVVFTVKDDNPIGATLIGRAYVPVADILDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPIH +SKIHVKLQF DV ++R WG G+++ +FPGVPYTFF QR+GCK
Sbjct  121   VDRWVEILDEDKNPIHGNSKIHVKLQFFDVTKDRNWGLGIRSLKFPGVPYTFFSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP IPLA G+ YE  RCWEDIFDAI+ AKHL+YITGWSVYTEI+LVR
Sbjct  181   VSLYQDAHVPDNFIPPIPLASGKNYEAHRCWEDIFDAISNAKHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LG+LL KKASEGV+VLMLVWDDRTSV LLKKDGLMATHDE+T N+F++
Sbjct  241   DSRRPKPGGDIKLGDLLNKKASEGVKVLMLVWDDRTSVDLLKKDGLMATHDEDTENFFRN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             ++VHCVLCPRNPDD  S IQN++I TMFTHHQKIVVVD E+P   +++RRIVSF+GGIDL
Sbjct  301   SDVHCVLCPRNPDDAGSFIQNVQISTMFTHHQKIVVVDSELPGSGSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  361   CDGRYDTAFHSLFRTL  376



>gb|AGN71006.1| phospholipase D2 [Brassica napus]
Length=812

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/380 (72%), Positives = 321/380 (84%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL + F  KI    E+ +GF K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEKAIGFGKGETQLYATIDLQKAR  60

Query  366   VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61    VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121   EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +V+LYQ AHVP+NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEITLV
Sbjct  181   RVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDE+T NYF 
Sbjct  241   RDSRRPKPGGDMTLGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYFN  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD---GDTERRRIVSFIG  1253
              +EVHCVLCPRNPDDG SI+QN+++  MFTHHQKIVVVD E+P    G +E RRI+SF+G
Sbjct  301   GSEVHCVLCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEVPSQGGGGSEMRRIMSFVG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+PFH LFRTL
Sbjct  361   GIDLCDGRYDTPFHSLFRTL  380



>gb|AGN71005.1| phospholipase D1 [Brassica napus]
Length=810

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 323/378 (85%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1     MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61    VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+  LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVETLDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ A+H++YITGWSVYTEI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAQHMIYITGWSVYTEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDVTVGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+QN+++  MFTHHQKIVVVD EMP  G ++ RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEMPSRGGSQMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_006842069.1| PREDICTED: phospholipase D alpha 1 [Amborella trichopoda]
 gb|ERN03744.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
Length=815

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/381 (70%), Positives = 319/381 (84%), Gaps = 6/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LHV +YE + +      T G      ++VEG E  +GF K A +LYATIDL
Sbjct  1     MAQILLHGTLHVTIYEAESLSNPHRATGGAPKFIRQLVEGIEETIGFGKGAGKLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR+L +E  NPRWYESFHIYCAHMAS+++F+VK DNPIGA LIGRA++P   +
Sbjct  61    EKARVGRTRILTNESVNPRWYESFHIYCAHMASDIIFTVKDDNPIGASLIGRAHVPVEEV  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             + G+EVD W  + D +R PI   +KIHVKLQ+ DV +++ W RG+++ +FPGVPYTFF Q
Sbjct  121   INGDEVDTWAEICDENRKPIGGGAKIHVKLQYFDVTKDQNWSRGIRSPKFPGVPYTFFSQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKV+LYQDAHVP+NFIP+IPLAGG++YEP RCWED+FDAI  AKHL+YITGWSVYTE
Sbjct  181   RQGCKVSLYQDAHVPDNFIPKIPLAGGKYYEPHRCWEDVFDAINNAKHLIYITGWSVYTE  240

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITL+RDP+RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  241   ITLIRDPKRPKPGGDTTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETE  300

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF DT+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD  +P+   E+RRIVSF+
Sbjct  301   NYFHDTDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDATLPNPANEQRRIVSFV  360

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ FH LFRTL
Sbjct  361   GGIDLCDGRYDTQFHSLFRTL  381



>gb|AGV22364.1| phospholipase D4 [Brassica napus]
Length=812

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/380 (72%), Positives = 320/380 (84%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  366   VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61    VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121   EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +V+LYQ AHVP+NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEITLV
Sbjct  181   RVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDE+T NYF 
Sbjct  241   RDSRRPKPGGDMTLGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYFN  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD---GDTERRRIVSFIG  1253
              +EVHCVLCPRNPDDG SI+QN+++  MFTHHQKIVVVD E+P    G +E RRI+SF+G
Sbjct  301   GSEVHCVLCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEVPSQGGGGSEMRRIMSFVG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+PFH LFRTL
Sbjct  361   GIDLCDGRYDTPFHSLFRTL  380



>ref|XP_009115281.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/380 (72%), Positives = 320/380 (84%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  366   VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61    VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121   EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +V+LYQ AHVP+NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEITLV
Sbjct  181   RVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDE+T NYF 
Sbjct  241   RDSRRPKPGGDMTLGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYFN  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD---GDTERRRIVSFIG  1253
              +EVHCVLCPRNPDDG SI+QN+++  MFTHHQKIVVVD E+P    G +E RRI+SF+G
Sbjct  301   GSEVHCVLCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEVPSQGGGGSEMRRIMSFVG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+PFH LFRTL
Sbjct  361   GIDLCDGRYDTPFHSLFRTL  380



>sp|P55939.2|PLDA2_BRAOC RecName: Full=Phospholipase D alpha 2; Short=PLD 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78486.1| phospholipase D2 [Brassica oleracea var. capitata]
 gb|AAC79125.1| phospholipase D [Brassica oleracea var. capitata]
 gb|AAD17209.1| phospholipase D2 [Brassica oleracea var. capitata]
Length=812

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/380 (72%), Positives = 320/380 (84%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             MAQ LLHG+LH  +YEVD + T GL +     KI+   E  +GF K  ++LYATIDL+KA
Sbjct  1     MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETIGFGKGETQLYATIDLQKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61    RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEV++W+ +LD+DRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+G
Sbjct  121   EEVEKWVEILDDDRNPIHGESKIHVKLQYFAVEADRNWNMGVKSAKFPGVPYTFFSQRQG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQ AHVP+NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEITL
Sbjct  181   CKVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPKPGGD TLGELLKKKA+EGVRVL+LVWDDRTSV +LKKDGLMATHDE+T NYF
Sbjct  241   VRDSRRPKPGGDMTLGELLKKKATEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD--GDTERRRIVSFIG  1253
               +EVHCVLCPRNPDDG SI+QN+++  MFTHHQKIVVVD E+P   G +E RRI+SF+G
Sbjct  301   NGSEVHCVLCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEVPSQGGGSEMRRIMSFVG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+PFH LFRTL
Sbjct  361   GIDLCDGRYDTPFHSLFRTL  380



>gb|AHN53202.1| phospholipase D alpha 1-like protein [Cocos nucifera]
Length=813

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 321/381 (84%), Gaps = 6/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LHV ++E D +      + G      ++VEG E  +G  K +++LYATIDL
Sbjct  1     MAQILLHGTLHVTIFEADSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSTKLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              KARVGRTRL+ +E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61    GKARVGRTRLITNEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEEVD W+ + D DRNP+   +KIHVK+Q+ D+ ++  W RG+++A++PGVPYTFF Q
Sbjct  121   LDGEEVDRWIEIWDEDRNPLDGGAKIHVKVQYFDISKDHNWARGIRSAKYPGVPYTFFSQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVT YQDAHVP+NFIP+IPLA G++YEP RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  181   RQGCKVTFYQDAHVPDNFIPKIPLADGKYYEPHRCWEDIFDAISNAQHLIYITGWSVYTE  240

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD +R KPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  241   ITLVRDAKRQKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  300

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+DT+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSF+
Sbjct  301   NYFQDTDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDHEMPNKSSQQRRIVSFV  360

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ FH LFRTL
Sbjct  361   GGIDLCDGRYDTQFHSLFRTL  381



>emb|CDO98145.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/377 (71%), Positives = 321/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M  +LLHG+LHV ++EVDK+  +G   ++F K++   E  VGF K   ++YATIDLEKAR
Sbjct  1     MDPVLLHGTLHVTIFEVDKLHGEGGGPSVFRKLMANIEETVGFGKGTPKIYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GE
Sbjct  61    VGRTRMIENEPNNPRWYESFHIYCAHEASNVIFTVKDDNPIGATLIGRAYVPVHELLEGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             E+D W+ +LD D+NPI   SKIHVKLQ+ DV R+R W RG+++++FPGVPYTF+ QR GC
Sbjct  121   EIDRWVEILDEDKNPIKEESKIHVKLQYFDVTRDRNWARGIRSSKFPGVPYTFYSQRTGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +V+LYQDAH+P+NF+PRIPLAGG+ YEP RCWEDIFDAI+ AKH++YITGWSVYTEITL+
Sbjct  181   RVSLYQDAHIPDNFVPRIPLAGGKLYEPHRCWEDIFDAISNAKHMIYITGWSVYTEITLI  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RR KPGGD T+GELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  +F+
Sbjct  241   RDSRRQKPGGDVTIGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEQFFQ  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD +MP G+ ++RRIVSF+GGID
Sbjct  301   GTDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDSDMPGGEPQKRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>emb|CDX97705.1| BnaA05g23740D [Brassica napus]
Length=810

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 323/378 (85%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1     MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61    VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVEILDNDRNPIPGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ A+H++YITGWSVYTEI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAQHMIYITGWSVYTEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDMTVGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+QN+++  MFTHHQKIVVVD EMP  G ++ RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEMPSQGGSQMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_008454241.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
 gb|ABS86615.1| phospholipase D alpha [Cucumis melo var. inodorus]
Length=807

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/376 (70%), Positives = 318/376 (85%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1     MAHILLHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60    GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+P+LD  + PI    KIHVKLQF DV +++ WGRG+K+ +FPGVPYT+F QRRGCK
Sbjct  120   VDKWVPILDEQKKPIRGEPKIHVKLQFFDVTKDQNWGRGIKSPKFPGVPYTYFSQRRGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAHVP+NFIP+IPLAGG+FYEP RCWED+FDAI  AKHL+YI+GWSVYTEI+LVR
Sbjct  180   VTLYQDAHVPDNFIPKIPLAGGKFYEPHRCWEDVFDAIMNAKHLIYISGWSVYTEISLVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLKKKA EGV VL+L+W+D TSV   K++GLMATHDE+T  +F +
Sbjct  240   DKRRPKPGGDIMLGELLKKKAGEGVTVLLLIWNDTTSVPFFKEEGLMATHDEDTAKFFAN  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG ++IQ+I +GTMFTHHQKIVVVD  +P+GD  +RRIVSF+GG+DL
Sbjct  300   TDVHCVLCPRNPDDGANVIQDIAVGTMFTHHQKIVVVDSALPNGDPSKRRIVSFVGGLDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>ref|XP_008805616.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
 ref|XP_008805617.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=810

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 319/378 (84%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             MA +LLHG+LHV ++E D +   + G      ++V G E  +G  K +S+LYATIDLEKA
Sbjct  1     MAHILLHGTLHVTIFEADSLSRASAGAPKFIRQLVGGIEDAIGLGKGSSKLYATIDLEKA  60

Query  363   RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTRL+ DE  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61    RVGRTRLITDEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVAEILDG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EE D WL + D DRNP+   +KIHVK+Q+ D+ ++R W RG+++A++PGVPYTFF QRRG
Sbjct  121   EEADRWLEICDEDRNPLDGGAKIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQRRG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKVTLYQDAHVP+NFIP+IPLA G++Y P RCWEDIFDAI+ A+HL+YITGWSVYTEITL
Sbjct  181   CKVTLYQDAHVPDNFIPKIPLADGKYYGPHRCWEDIFDAISNAQHLIYITGWSVYTEITL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             +RD +R KPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE+T NYF
Sbjct  241   LRDSKRQKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEDTANYF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGI  1259
             + T+VHCVLCPRNPDDG SI+Q++EI TMFTHHQKIVVVD EMP+  +++RRIVSFIGGI
Sbjct  301   QGTDVHCVLCPRNPDDGGSIVQDLEISTMFTHHQKIVVVDHEMPNKGSQQRRIVSFIGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+ FH LFRTL
Sbjct  361   DLCDGRYDTQFHSLFRTL  378



>ref|XP_007023176.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
 gb|EOY25798.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
Length=670

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/377 (71%), Positives = 317/377 (84%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1     MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61    VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+R W RG+ + +FPGVP+TF+ QR+GC
Sbjct  121   EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRDRNWNRGIISRKFPGVPFTFYSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+ F+P+IPLAGG+++EP RCWED+FDAIT AKHL+ ITGWSVYTEITLV
Sbjct  181   KVSLYQDAHIPDGFVPKIPLAGGKYFEPHRCWEDVFDAITNAKHLICITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLG+LLKKKASEGVRV MLVWDDRTSVGLLKKDGLMATHDEET N+FK
Sbjct  241   RDSRRPKPGGDITLGDLLKKKASEGVRVNMLVWDDRTSVGLLKKDGLMATHDEETENFFK  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
             DT+V+CVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD  MP+GDTE RRIVSF+GGID
Sbjct  301   DTDVNCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDAAMPNGDTETRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>emb|CAB43062.1| phospholipase D2 [Craterostigma plantagineum]
Length=807

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 318/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA++LLHG+LHV VYEVD++   G  N+F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1     MARILLHGTLHVTVYEVDRLHAGGGGNIFSKLRANIEEKVGFGKGTPKIYASIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAH+ASN++F+VK DNPIGA LIGRAY+P R +L GEE
Sbjct  61    GRTRMIEHEPTNPRWYESFHIYCAHLASNIIFTVKDDNPIGATLIGRAYVPVRDVLDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ LLDN++NPI   SKIHVKLQF DV R+  W RG+K+ ++PGVPYTFF QR+GCK
Sbjct  121   LDRWVELLDNNKNPIRGESKIHVKLQFFDVARDLNWNRGIKSIKYPGVPYTFFAQRKGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAH+P+NFIP IPL+G   Y P RCWED+FDAI+ AKHL+YITGWSVYTEI L+R
Sbjct  181   VTLYQDAHIPDNFIPEIPLSGSNSYSPHRCWEDVFDAISNAKHLIYITGWSVYTEIPLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGG+ TLGELLKKKA+EGV VLMLVWDDRTSVGLLK+DGLMATHDEET NYF+ 
Sbjct  241   DSRREKPGGEITLGELLKKKANEGVNVLMLVWDDRTSVGLLKRDGLMATHDEETQNYFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHC+LCPRNPDDG S +Q+++I TMFTHHQKI+VVD ++P G +++RRIVSF+GGIDL
Sbjct  301   TDVHCILCPRNPDDGGSFVQDLQISTMFTHHQKIIVVDSDLPSGGSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>gb|KJB70611.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=665

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 315/376 (84%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1     MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60    GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPI S  KIHVKLQ+  V ++R W RG+ + +FPGVPYTF+PQR+GCK
Sbjct  120   VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKDRNWDRGIVSRKFPGVPYTFYPQRKGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG+ YEP RCWEDIFDAIT AKH++YITGWSVYTEI+LVR
Sbjct  180   VSLYQDAHIPDGFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHMIYITGWSVYTEISLVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKASEGVRV MLVWDDRTSVGLLKKDGLMATHDEET  +FKD
Sbjct  240   DSRRPKPGGDITIGELLKKKASEGVRVNMLVWDDRTSVGLLKKDGLMATHDEETEQFFKD  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+V+CVLCPRNPDDG S +Q ++I TMFTHHQKIVVVD  MP+GD E+RRIVSF+GGIDL
Sbjct  300   TDVNCVLCPRNPDDGGSFVQELQISTMFTHHQKIVVVDAAMPNGDPEKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>ref|XP_006356207.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356208.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006356209.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Solanum tuberosum]
Length=809

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/377 (71%), Positives = 321/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ+ LHG+LHV ++EVD ++  +G  + F KI +  E  VG  K   +LYATIDLEKAR
Sbjct  1     MAQIQLHGTLHVTIFEVDNLQGEEGGGHFFSKIKQHFEETVGVGKGTPKLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL GE
Sbjct  61    VGRTRMIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             E+D+W+ +LD + NPI   SKIHVKLQF DV R+  WGRG++++R+PGVPYTFF QR G 
Sbjct  121   EIDKWVEILDKEMNPIAEGSKIHVKLQFFDVSRDPNWGRGIRSSRYPGVPYTFFSQRAGS  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +V+LYQDAHVP+NFIP+IPL+GG++YEP RCWEDIFDAIT AKHL+YITGWSVYTEITLV
Sbjct  181   RVSLYQDAHVPDNFIPKIPLSGGKYYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RR KPGGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHD+ET  +F+
Sbjct  241   RDSRRQKPGGDITLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDQETEQFFQ  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+VHCVLCPRNPD+G S +Q+I+I TMFTHHQKI+VVD  +P G++E+RRI+SF+GGID
Sbjct  301   GTDVHCVLCPRNPDNGGSFVQDIQISTMFTHHQKIIVVDSALPSGESEKRRILSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>ref|XP_004152203.1| PREDICTED: phospholipase D alpha 1 [Cucumis sativus]
 gb|KGN52888.1| hypothetical protein Csa_4G004970 [Cucumis sativus]
Length=807

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 319/376 (85%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +L+HG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1     MAHILIHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60    GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+P+LD  + PI    KIHVKLQF DV +++ WG G+K+ +FPGVPYT+F QRRGCK
Sbjct  120   VDKWVPILDESKKPIRGAPKIHVKLQFFDVTKDQNWGHGIKSPKFPGVPYTYFSQRRGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAHVP+NFIP+IPLAGG+FYEP RCWED+FDAI  AKHL+YI+GWSVYTEI+LVR
Sbjct  180   VTLYQDAHVPDNFIPKIPLAGGKFYEPHRCWEDVFDAIMNAKHLIYISGWSVYTEISLVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLKKKA EGV VL+L+W+D TSV +LK++GLMATHDE+T  +F +
Sbjct  240   DKRRPKPGGDVMLGELLKKKAGEGVTVLLLIWNDTTSVPILKEEGLMATHDEDTAKFFAN  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG ++IQ+I +GTMFTHHQKIVVVD  +P+GD  +RRIVSF+GG+DL
Sbjct  300   TDVHCVLCPRNPDDGANVIQDIAVGTMFTHHQKIVVVDSALPNGDPSKRRIVSFVGGLDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>ref|XP_010691149.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=809

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 318/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LHV +YE   +       +F K++   E  VG  +   ++YATIDLEKAR 
Sbjct  1     MAQILLHGTLHVTIYEASDLHHGNDPGVFRKLMANIEETVGLGQGTPKMYATIDLEKARA  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61    GRTRIIENEPANPRWYESFHIYCAHLASSIIFTVKDDNPIGATLIGRAYVPVEEILGGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ + D D+NP+ S +KIHVKLQF ++ +ER +  G+++ ++PGVPYTFFPQR GCK
Sbjct  121   VDRWVEICDRDKNPLDSGAKIHVKLQFFEITQERSFNHGIRSGKYPGVPYTFFPQRTGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+NFIP+IPLAGG++YEP RCWEDIFDAIT AKH++YITGWSVYTEI L+R
Sbjct  181   VSLYQDAHIPDNFIPKIPLAGGKYYEPHRCWEDIFDAITNAKHMIYITGWSVYTEIALIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKA EGV+V MLVWDDRTSVG+LKKDGLMATHDEETG +F+D
Sbjct  241   DSRRPKPGGDITIGELLKKKAREGVKVCMLVWDDRTSVGVLKKDGLMATHDEETGQFFRD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+G +++RRIVSF+GGIDL
Sbjct  301   TEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSAMPEGGSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_009619857.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=810

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 320/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG+LHV V+EVD+++  G  N F KI E  E  VG  K AS++YAT+DLEKARV
Sbjct  1     MAPILLHGTLHVTVHEVDRLREKGGGNFFSKIKETVEETVGVGKGASKIYATVDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR++ +E  NPRW ESFHIYCAHMASNVVF+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61    GRTRVIENEPSNPRWNESFHIYCAHMASNVVFTVKDNNSIGATLIGRAYLPVNELLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VDEW+ +LD D+NPI   SKIHV+LQF D+ R+R WG G+   ++PGVPYTFFPQR GC+
Sbjct  121   VDEWIEILDEDKNPIKEGSKIHVRLQFFDISRDRNWGHGIGNPKYPGVPYTFFPQRSGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ FIP+IPL+GG++YEP RCWED+FDAIT AKHL+YITGWSVYTEI L+R
Sbjct  181   VSLYQDAHIPDKFIPKIPLSGGKYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEINLLR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLKKKAS+GV+VLMLVWDDRTSV LLKKDGLMATHDEET  +FK 
Sbjct  241   DSRRQKPGGDITLGELLKKKASDGVKVLMLVWDDRTSVRLLKKDGLMATHDEETEEFFKG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPR+PDDG SI+++++I TMFTHHQK+V+VD +MP+G+++ RRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRDPDDGGSIVKDLQISTMFTHHQKLVIVDSDMPNGESDMRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|NP_001267897.1| phospholipase D alpha [Vitis vinifera]
 gb|ABC59316.1| phospholipase D alpha [Vitis vinifera]
Length=809

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 320/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  ++ +D++ + G    F K+VE  E  VGF K  S+LYATID+ +ARV
Sbjct  1     MAQILLHGTLHATIFGIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGRARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LGGEE
Sbjct  61    GRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILGGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ +++ +  PIH  SKIHVKLQ+ +V  +R WGRG+++ +FPGVP+TFF QR+GC 
Sbjct  121   VDKWVEIVNEELKPIHGGSKIHVKLQYFEVTADRSWGRGIRSLKFPGVPFTFFSQRKGCH  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+P+IPLA G++YEP+RCWED+FDAI  AKHL+YITGWSVYTEITLVR
Sbjct  181   VSLYQDAHVPDNFVPKIPLADGKYYEPRRCWEDVFDAINNAKHLIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKASEGVRVLMLVWDDRTSV LLKKDGLM THDEET +YF D
Sbjct  241   DSRRPKPGGDLTIGELLKKKASEGVRVLMLVWDDRTSVPLLKKDGLMGTHDEETEHYFHD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP G +E+RRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSEMPSGGSEKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  361   CDGRYDTQFHSLFRTL  376



>ref|XP_002882959.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59218.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/378 (71%), Positives = 321/378 (85%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDRWVEILDNDRNPIHGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ AKHL+YITGWSVY EI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDVTIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP+ G +E RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQSLQISTMFTHHQKIVVVDSEMPNRGGSEMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_004135845.1| PREDICTED: phospholipase D alpha 1 [Cucumis sativus]
 gb|KGN45278.1| hypothetical protein Csa_7G432600 [Cucumis sativus]
Length=808

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/376 (70%), Positives = 317/376 (84%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61    GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+++ +FPGVPYT++ QR+GCK
Sbjct  121   VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGRGIRSRKFPGVPYTYYSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPLAGG+ Y P RCWEDIFDAI  AKH++YITGWSVYTEI LVR
Sbjct  181   VSLYQDAHVPDNFIPKIPLAGGKNYAPARCWEDIFDAIKNAKHMIYITGWSVYTEIALVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLK KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  YF+D
Sbjct  241   DSRRPKPGGDTMLGELLKNKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETERYFQD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+GD+++RRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSPMPNGDSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>gb|KHG06123.1| Phospholipase D alpha 1 [Gossypium arboreum]
Length=807

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/376 (71%), Positives = 314/376 (84%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1     MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60    GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W RG+   +FPGVPYTF+PQR+GCK
Sbjct  120   VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWARGIVNRKFPGVPYTFYPQRKGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG+ YEP RCWEDIFDAIT AKH++YITGWSVYTEI LVR
Sbjct  180   VSLYQDAHIPDGFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHMIYITGWSVYTEIALVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKASEGVRV MLVWDDRTSVGLLKKDGLMATHDEET  +FKD
Sbjct  240   DSRRPKPGGDITIGELLKKKASEGVRVNMLVWDDRTSVGLLKKDGLMATHDEETEQFFKD  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+V+CVLCPRNPDDG S +Q ++I TMFTHHQKIVVVD  MP+GD E+RRIVSF+GGIDL
Sbjct  300   TDVNCVLCPRNPDDGGSFVQELQISTMFTHHQKIVVVDAAMPNGDPEKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>gb|ADP23922.1| phospholipase D alpha [Litchi chinensis]
Length=800

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/376 (71%), Positives = 320/376 (85%), Gaps = 8/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD++ T G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDQLDTGGGGHFFRKLI-------GLGKGQSKIYATIDLEKARV  53

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54    GRTRIIEKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ LLD  +NPI + SKIHVKLQ+ DV ++R + RG+ +A++PGVP+TFF QR GCK
Sbjct  114   VDKWVELLDEHKNPIEAGSKIHVKLQYFDVTKDRNFSRGLISAKYPGVPFTFFAQRHGCK  173

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPLAGG+ Y+P RCWEDIFDAIT AKHL+YITGWSVYTEI+LVR
Sbjct  174   VSLYQDAHVPDNFIPKIPLAGGKNYQPHRCWEDIFDAITNAKHLIYITGWSVYTEISLVR  233

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLG LLKKKASEGVR  MLVWDDRTSVGLLKKDGLMATHDEET  +F+D
Sbjct  234   DSRRPKPGGDVTLGNLLKKKASEGVRFCMLVWDDRTSVGLLKKDGLMATHDEETEQFFRD  293

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             TEV+CVLCPRNPDDG S +Q+ +I TMFTHHQKIVVVD E+P+GD+ERRRIVSF+GGIDL
Sbjct  294   TEVNCVLCPRNPDDGGSFVQDFQIATMFTHHQKIVVVDSELPNGDSERRRIVSFVGGIDL  353

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  354   CDGRYDTAFHSLFRTL  369



>gb|AGV22363.1| phospholipase D3 [Brassica napus]
Length=810

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/378 (70%), Positives = 322/378 (85%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYAT DL++ R
Sbjct  1     MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATTDLQRVR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE +NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61    VGRTRKIKDEAENPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ A+H++YITGWSVYTEI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAQHMIYITGWSVYTEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDMTVGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+QN+++  MFTHHQKIVVVD EMP  G ++ RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEMPSRGGSQMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_008792036.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
 ref|XP_008792037.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
Length=813

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/381 (70%), Positives = 320/381 (84%), Gaps = 6/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E D +      + G    F ++VEG E  +G  K +S+LYATIDL
Sbjct  1     MAQILLHGTLHATIFEADSLSNPNRSSGGAPKFFRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              KARVGRTRL+  E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61    GKARVGRTRLITKEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L G+EVD+W+ + D DRNP+   +KIHVK+Q+ D+ ++R W RG+++A++PGVPYTFF Q
Sbjct  121   LYGQEVDKWIEICDEDRNPLDGGAKIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NFIP+IPLA G++YE  RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  181   RQGCKVTLYQDAHVPDNFIPKIPLADGKYYEQHRCWEDIFDAISNAQHLIYITGWSVYTE  240

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD +R KPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  241   ITLVRDSKRQKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  300

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+DT+V CVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSF+
Sbjct  301   NYFQDTDVQCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDHEMPNKSSQQRRIVSFV  360

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ FH LFRTL
Sbjct  361   GGIDLCDGRYDTQFHSLFRTL  381



>ref|XP_009381115.1| PREDICTED: phospholipase D alpha 1 [Musa acuminata subsp. malaccensis]
Length=812

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/381 (70%), Positives = 322/381 (85%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E + +      + G      K+VEG E  VG  K +S+LYATIDL
Sbjct  1     MAQILLHGTLHATIFEAESLTNPHRASGGAPKFLRKLVEGIEDTVGIGKGSSKLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  +PRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61    EKARVGRTRMITNEPVSPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVMEI  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEEVD WL + D DRNP+   +KIHVK+Q+ D+ ++R W RGV++A++PGVPYTFF Q
Sbjct  121   LDGEEVDRWLEICDADRNPV-GDAKIHVKVQYFDISKDRNWARGVRSAKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP++FIP+IPLA GR+YEP RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDDFIPQIPLADGRYYEPHRCWEDIFDAISNAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             I L+RD +RPKPGGD TLGELLK++ASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  240   IRLIRDSKRPKPGGDVTLGELLKRRASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+DT+VHCVLCPRNPDDG S +++++I TMFTHHQKIV+VD EMP+   ++RRIVSF+
Sbjct  300   NYFRDTDVHCVLCPRNPDDGGSFVKDLQIATMFTHHQKIVIVDHEMPNKSLQQRRIVSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GG+DLCDGRYD+PFH LFRTL
Sbjct  360   GGLDLCDGRYDTPFHSLFRTL  380



>gb|ABN13537.2| phospholipase D [Cucumis sativus]
Length=808

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 317/376 (84%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61    GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+++ +FPGVPYT++ QR+GCK
Sbjct  121   VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGRGIRSRKFPGVPYTYYSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPLAGG+ Y P RCWEDIFDAI  AKH++YITGWSVYTEI LVR
Sbjct  181   VSLYQDAHVPDNFIPKIPLAGGKNYAPARCWEDIFDAIKNAKHMIYITGWSVYTEIALVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLK KASEGVRVLMLVWDDRTSVGLLKKDGL+ATHDEET  YF+D
Sbjct  241   DSRRPKPGGDTMLGELLKNKASEGVRVLMLVWDDRTSVGLLKKDGLVATHDEETERYFQD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  MP+GD+++RRIVSF+GGIDL
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSPMPNGDSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|NP_188194.1| phospholipase D alpha 1 [Arabidopsis thaliana]
 sp|Q38882.2|PLDA1_ARATH RecName: Full=Phospholipase D alpha 1; Short=AtPLDalpha1; Short=PLD 
alpha 1; AltName: Full=Choline phosphatase 1; AltName: 
Full=PLDalpha; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Arabidopsis thaliana]
 dbj|BAB02304.1| phospholipase D [Arabidopsis thaliana]
 dbj|BAE98964.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE75720.1| phospholipase D alpha 1 [Arabidopsis thaliana]
Length=810

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/378 (71%), Positives = 320/378 (85%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W  G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNMGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ AKHL+YITGWSVY EI LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDVTIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP  G +E RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQSLQISTMFTHHQKIVVVDSEMPSRGGSEMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>gb|AGW22212.1| phospholipase D alpha [Chorispora bungeana]
Length=809

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/377 (71%), Positives = 315/377 (84%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ LLHG+LH  +YEVD++          K++   E  +G  K  ++LY TIDL+KARV
Sbjct  1     MAQHLLHGTLHATIYEVDELHGGVRSGFLGKMLANVEEKIGVGKGETQLYTTIDLQKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E KNP+WYESFHIYC HMAS+++F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61    GRTRKIKNEPKNPKWYESFHIYCGHMASDIIFTVKDDNPIGATLIGRAYVPVDDVINGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GCK
Sbjct  121   VDRWVEILDNDRNPIHGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+PENF+P+IPLAGG+ YEPQRCWE IFDAI+ AKH++YITGWSVYTEI LVR
Sbjct  181   VSLYQDAHIPENFVPKIPLAGGKNYEPQRCWEGIFDAISNAKHMIYITGWSVYTEIALVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD +LGELLKKKASEGVRVLMLVWDDRTSV +LKKDGLMATHDEET NYF+ 
Sbjct  241   DSRRPKPGGDVSLGELLKKKASEGVRVLMLVWDDRTSVDVLKKDGLMATHDEETENYFRG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGID  1262
             +EVHCVLCPRNPDDG SI+QN+++ TMFTHHQKIVVVD EMP    +E RRIVSF+GGID
Sbjct  301   SEVHCVLCPRNPDDGGSIVQNLQVSTMFTHHQKIVVVDSEMPSQSGSEMRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYDSPFH LFRTL
Sbjct  361   LCDGRYDSPFHSLFRTL  377



>gb|EYU21635.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
 gb|EYU21636.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
Length=809

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/377 (72%), Positives = 320/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD +      N F K++E  E  VGF K  +++YA+IDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDTLHAGKGGNFFGKLMENIEETVGFGKGTAKIYASIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ +LD D NP+   SKIHVKLQF DV R+R W RG+K+A++PGVPYTFF QR GC+
Sbjct  121   VDKWVEILDTDMNPVSEGSKIHVKLQFFDVTRDRNWARGIKSAKYPGVPYTFFSQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPL+GG++YEP RCWEDIFDAIT AKH +YITGWSVYTE+TL+R
Sbjct  181   VSLYQDAHVPDNFIPKIPLSGGKYYEPHRCWEDIFDAITNAKHFIYITGWSVYTEVTLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD TLGELLKKKASEGVRVLMLVWDDRTSV LLKKDGLMATHDEET NYF  
Sbjct  241   DSRREKPGGDITLGELLKKKASEGVRVLMLVWDDRTSVDLLKKDGLMATHDEETENYFNG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGGID  1262
             T+V+C+LCPRNPDDG S +Q+++I TMFTHHQKIVVVD ++P +G  E+RRIVSF+GG+D
Sbjct  301   TDVNCILCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDSDLPVEGGPEKRRIVSFVGGLD  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYDSPFH LFRTL
Sbjct  361   LCDGRYDSPFHSLFRTL  377



>ref|XP_009408983.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408984.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=809

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/378 (70%), Positives = 318/378 (84%), Gaps = 4/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTD--GLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             MAQ+LLHG+LH  +++ + +     G       +VEG E  +G  K  ++ YATIDLEKA
Sbjct  1     MAQILLHGTLHATIFDAESLTNPQRGSGGFLRMVVEGIEDTIGLGKGTTKHYATIDLEKA  60

Query  363   RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR+L DE  NPRWYESFHIYCAHMA+NV+F++K DNPIGA LIGRAY+P   +L G
Sbjct  61    RVGRTRMLSDEPVNPRWYESFHIYCAHMAANVIFTIKFDNPIGATLIGRAYLPVMEILDG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             +EVD WL + D DRNP+   +KIHVKLQ+ DV+++R W RGV++ ++PGVPYTFF QR+G
Sbjct  121   DEVDRWLEICDEDRNPV-GDAKIHVKLQYFDVLKDRNWARGVRSTKYPGVPYTFFSQRQG  179

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKVTLYQDAHVP++FIPRIPLA G++YEP RCWEDIFDAI+ A+HL+YITGWSVYTEITL
Sbjct  180   CKVTLYQDAHVPDDFIPRIPLADGKYYEPHRCWEDIFDAISNAQHLIYITGWSVYTEITL  239

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             +RD +RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET NYF
Sbjct  240   LRDNKRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETENYF  299

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGI  1259
              DT+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD EMP+  ++RRRIVSF+GG+
Sbjct  300   HDTDVHCVLCPRNPDDGGSFVQDLQIATMFTHHQKIVVVDHEMPNKASQRRRIVSFVGGL  359

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+ FH LFRTL
Sbjct  360   DLCDGRYDTQFHSLFRTL  377



>gb|ACG63795.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACG70839.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACV70145.1| phospholipase D [Gossypium raimondii]
 gb|ADD83101.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83102.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83103.1| PLDalpha isoform 1 [Gossypium hirsutum]
 gb|ADD83105.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|KJB70610.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70614.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=807

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 315/376 (84%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1     MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60    GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPI S  KIHVKLQ+  V ++R W RG+ + +FPGVPYTF+PQR+GCK
Sbjct  120   VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKDRNWDRGIVSRKFPGVPYTFYPQRKGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG+ YEP RCWEDIFDAIT AKH++YITGWSVYTEI+LVR
Sbjct  180   VSLYQDAHIPDGFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHMIYITGWSVYTEISLVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKASEGVRV MLVWDDRTSVGLLKKDGLMATHDEET  +FKD
Sbjct  240   DSRRPKPGGDITIGELLKKKASEGVRVNMLVWDDRTSVGLLKKDGLMATHDEETEQFFKD  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+V+CVLCPRNPDDG S +Q ++I TMFTHHQKIVVVD  MP+GD E+RRIVSF+GGIDL
Sbjct  300   TDVNCVLCPRNPDDGGSFVQELQISTMFTHHQKIVVVDAAMPNGDPEKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>gb|ACG63794.1| phospholipase D alpha [Gossypium arboreum]
 gb|ACG70840.1| phospholipase D alpha [Gossypium arboreum]
 gb|ADD83098.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|ADD83099.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83100.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83104.1| PLDalpha isoform 1 [Gossypium hirsutum]
Length=807

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/376 (71%), Positives = 313/376 (83%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1     MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60    GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W RG+   +FPGVPYTF+PQR+GCK
Sbjct  120   VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWARGIVNRKFPGVPYTFYPQRKGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG+ YEP RCWEDIFDAIT AKH++YITGWSVYTEI LVR
Sbjct  180   VSLYQDAHIPDGFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHMIYITGWSVYTEIALVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKASEGVRV MLVWDDRTSVGLLKKDGLMATHDEET  +FKD
Sbjct  240   DSRRPKPGGDITIGELLKKKASEGVRVNMLVWDDRTSVGLLKKDGLMATHDEETEQFFKD  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+V+CVLCPRNPDDG S +Q ++I TMFTHHQKIVVVD  MP+GD E+RRIVSF+GGIDL
Sbjct  300   TDVNCVLCPRNPDDGGSFVQELQISTMFTHHQKIVVVDAAMPNGDPEKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>ref|XP_007023174.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 ref|XP_007023175.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25796.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25797.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
Length=809

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/377 (71%), Positives = 317/377 (84%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1     MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61    VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+R W RG+ + +FPGVP+TF+ QR+GC
Sbjct  121   EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRDRNWNRGIISRKFPGVPFTFYSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+ F+P+IPLAGG+++EP RCWED+FDAIT AKHL+ ITGWSVYTEITLV
Sbjct  181   KVSLYQDAHIPDGFVPKIPLAGGKYFEPHRCWEDVFDAITNAKHLICITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLG+LLKKKASEGVRV MLVWDDRTSVGLLKKDGLMATHDEET N+FK
Sbjct  241   RDSRRPKPGGDITLGDLLKKKASEGVRVNMLVWDDRTSVGLLKKDGLMATHDEETENFFK  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
             DT+V+CVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD  MP+GDTE RRIVSF+GGID
Sbjct  301   DTDVNCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDAAMPNGDTETRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>ref|XP_003597894.1| Phospholipase D alpha [Medicago truncatula]
 gb|ABD28731.1| C2; Peptidase, cysteine peptidase active site [Medicago truncatula]
 gb|AES68145.1| phospholipase D alpha 1 [Medicago truncatula]
Length=809

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/377 (70%), Positives = 320/377 (85%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  ++EVDK+K  G  N+  KI +  E  VGF K  ++LYATIDLEKARV
Sbjct  1     MAQILLHGTLHATIFEVDKLKNIGGGNILSKIRQNFEETVGFGKGTTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61    GRTRIIEKEHVNPQWNESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVEEVLGGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD ++ PIH +SKIHVKLQF DV ++R W  G+++ +FPGVPY F+ QR+GCK
Sbjct  121   VDRWVEILDVNKEPIHGNSKIHVKLQFFDVSKDRNWALGIRSPKFPGVPYAFYTQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQD+H+ +NF+P I LAGG+ Y+P RCWED+FDAITKA+HL+YITGWSVYTEI+LVR
Sbjct  181   VSLYQDSHISDNFVPNIQLAGGQTYQPHRCWEDVFDAITKARHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKA EGVRVLMLVWDDRTSV LLKKDGLMATHD+ET  +F+ 
Sbjct  241   DSRRPKPGGDITLGELLKKKAQEGVRVLMLVWDDRTSVPLLKKDGLMATHDQETEEFFRG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDG-DTERRRIVSFIGGID  1262
             +EVHCVLCPRNPDDG SI+QNIEIGTMFTHHQKI+VVD E+P+     +RRIVSF+GGID
Sbjct  301   SEVHCVLCPRNPDDGGSIVQNIEIGTMFTHHQKILVVDSELPNEVGLNKRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>ref|XP_006364210.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
Length=811

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 319/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG+LHV ++EVD++      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1     MAPILLHGTLHVTIHEVDRLHGKHGRNFFSKIKDSVEETVGMGKGASRIYATVDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61    GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VDEW+ +LD D NPI + SKIHV LQ+ ++ R+R WGRG+ ++++PGVPYTFFPQR GC+
Sbjct  121   VDEWIEILDEDENPIEAGSKIHVTLQYFEISRDRNWGRGIGSSKYPGVPYTFFPQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ FIP+IPL+GG++YEP RCWEDIFDAIT AKH++YITGWSVYTEITL+R
Sbjct  181   VSLYQDAHIPDKFIPKIPLSGGKYYEPHRCWEDIFDAITNAKHMIYITGWSVYTEITLLR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD ++GELLKKKA EGV+VLMLVWDDRTSV LLKKDGLMATHDEET  YFKD
Sbjct  241   DSRREKPGGDDSVGELLKKKAKEGVKVLMLVWDDRTSVRLLKKDGLMATHDEETEEYFKD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPR+PDDG SI+++++   MFTHHQKIV+VD +MP+G++E RR++SF+GG+DL
Sbjct  301   TDVHCVLCPRDPDDGGSIVKDLQTSAMFTHHQKIVIVDTDMPNGESETRRLMSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>gb|ACV70146.1| phospholipase D [Gossypium arboreum]
Length=807

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 312/376 (83%), Gaps = 2/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G      ++YATIDLE+ARV
Sbjct  1     MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGIGVPKIYATIDLERARV  59

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR + +E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60    GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W RG+   +FPGVPYTF+PQR+GCK
Sbjct  120   VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWARGIVNRKFPGVPYTFYPQRKGCK  179

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ F+P+IPLAGG+ YEP RCWEDIFDAIT AKH++YITGWSVYTEI LVR
Sbjct  180   VSLYQDAHIPDGFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHMIYITGWSVYTEIALVR  239

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD T+GELLKKKASEGVRV MLVWDDRTSVGLLKKDGLMATHDEET  +FKD
Sbjct  240   DSRRPKPGGDITIGELLKKKASEGVRVNMLVWDDRTSVGLLKKDGLMATHDEETEQFFKD  299

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+V+CVLCPRNPDDG S +Q ++I TMFTHHQKIVVVD  MP+GD E+RRIVSF+GGIDL
Sbjct  300   TDVNCVLCPRNPDDGGSFVQELQISTMFTHHQKIVVVDAAMPNGDPEKRRIVSFVGGIDL  359

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  360   CDGRYDTPFHSLFRTL  375



>gb|ABU54776.1| phospholipase D alpha 1 precursor [Helianthus annuus]
Length=810

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/377 (70%), Positives = 314/377 (83%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLL-LHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ   LHG+LHV +YEVDKI   G  N+F KIV   E  +GF K   ++YAT+DLEKAR
Sbjct  1     MAQKTHLHGTLHVTIYEVDKIHVAGGGNIFSKIVANIEETIGFGKGTPKMYATVDLEKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR++ DE + P+W ESFHIYCAH ASNV+F+VK DNP+GA LIGRAY+P   +L GE
Sbjct  61    VGRTRMITDEPETPKWNESFHIYCAHSASNVIFTVKDDNPVGATLIGRAYIPVEEILDGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             E+D W+ +LD D+NPI + SKIHVK+Q+ DV ++R W RG+K+A++PGVPYTFF QR GC
Sbjct  121   ELDRWVEILDEDKNPISAGSKIHVKVQYFDVTQDRNWDRGIKSAKYPGVPYTFFGQRNGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +V+LYQDAHVP+ FIP+IPLA G FYEP RCWED+FDAIT AKH +YITGWSVYTEITL+
Sbjct  181   RVSLYQDAHVPDGFIPKIPLANGEFYEPHRCWEDVFDAITNAKHFIYITGWSVYTEITLI  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RR K GGD TLGELLK+KASEGVRVLMLVWDDRTSV + K+DGLMATHDE+T NYF+
Sbjct  241   RDSRRQKAGGDTTLGELLKRKASEGVRVLMLVWDDRTSVDIFKRDGLMATHDEDTENYFQ  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
             +++VHCVLCPRNPDDG S IQ+++I TMFTHHQKIVVVD  MP GD+  RR+VSF+GGID
Sbjct  301   NSDVHCVLCPRNPDDGASFIQDLQISTMFTHHQKIVVVDAAMPTGDSTNRRVVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>ref|XP_007135745.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
 gb|ESW07739.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
Length=809

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/377 (70%), Positives = 316/377 (84%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVDK+   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDKLHAGGGGNFFTKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61    GRTRIIENEHTNPKWEESFHIYCAHVASDIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD ++ PI   SKIHVKLQ+ DV ++R W RG+++ ++PGVPYTFF QR+GCK
Sbjct  121   IDRWVEILDTEKKPIQEGSKIHVKLQYFDVSKDRNWARGIRSPKYPGVPYTFFSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V LYQDAHVP+NF+P+IPL+GG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+LVR
Sbjct  181   VFLYQDAHVPDNFVPKIPLSGGKNYEAHRCWEDIFDAITNAKHLIYITGWSVYTEISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHDEET  +F  
Sbjct  241   DSRRPKPGGDQTLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDEETQQFFSG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGGID  1262
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  +P  G +E+RRIVSF+GGID
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSALPGGGGSEKRRIVSFVGGID  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+ FH LFRTL
Sbjct  361   LCDGRYDTAFHSLFRTL  377



>ref|NP_001234102.1| phospholipase PLDa1 [Solanum lycopersicum]
 gb|AAG45485.1| phospholipase PLDa1 [Solanum lycopersicum]
Length=809

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/378 (70%), Positives = 319/378 (84%), Gaps = 4/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1     MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  363   RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60    RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EE+D+W+ ++D + NPI   SKIHVKLQF DV R+  WGRG++++R+PGVPYTFF QR G
Sbjct  120   EEIDKWVEIMDKEMNPIAEGSKIHVKLQFFDVSRDPNWGRGIRSSRYPGVPYTFFAQRPG  179

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
              +V+LYQDAHVP+NFIP+IPL+GG++YEP RCWEDIFDAIT AKHL+YITGWSVYTEI L
Sbjct  180   SRVSLYQDAHVPDNFIPKIPLSGGKYYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIAL  239

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RR KPGGD  LGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHD+ET  YF
Sbjct  240   VRDSRRQKPGGDIMLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDQETEQYF  299

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGI  1259
             + T+V+CVLCPRNPD+G S +Q+I+I TMFTHHQKI+VVD  +P G++E+RRI+SF+GGI
Sbjct  300   QGTDVNCVLCPRNPDNGGSFVQDIQISTMFTHHQKIIVVDSALPSGESEKRRILSFVGGI  359

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  360   DLCDGRYDTPFHSLFRTL  377



>gb|ADY75750.1| phospholipase D alpha [Dimocarpus longan]
Length=800

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/376 (70%), Positives = 319/376 (85%), Gaps = 8/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD++   G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDQLDRGGGGHFFRKLI-------GLGKGESKIYATIDLEKARV  53

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR++  +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54    GRTRIIGKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ LLD  +NPI + SKIHVKLQ+ D+ ++R + RG+ +A++PGVP+TFF QR GCK
Sbjct  114   VDKWVELLDEHKNPIEAGSKIHVKLQYFDIRKDRNFSRGLISAKYPGVPFTFFTQRHGCK  173

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+IPLAGG+ Y+P RCWEDIFDAIT AKHL+YITGWSVYTEI+LVR
Sbjct  174   VSLYQDAHVPDNFIPKIPLAGGKNYQPHRCWEDIFDAITNAKHLIYITGWSVYTEISLVR  233

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD TLG LLKKKASEG RV MLVWDDRTSVGLLKKDGLMATHDEET  +F+D
Sbjct  234   DSRRPKPGGDVTLGNLLKKKASEGARVCMLVWDDRTSVGLLKKDGLMATHDEETEQFFRD  293

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+V+CVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD E+P+GD+ERRRIVSF+GGIDL
Sbjct  294   TDVNCVLCPRNPDDGGSFVQDLQIATMFTHHQKIVVVDSELPNGDSERRRIVSFVGGIDL  353

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  354   CDGRYDTAFHSLFRTL  369



>ref|XP_006297003.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
 gb|EOA29901.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
Length=810

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/378 (70%), Positives = 319/378 (84%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESFHIYCAH+AS+++F++K DNPIGA LIGRAY+P   ++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTIKDDNPIGATLIGRAYIPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDNDRNPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDRWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+P IPLAGG+ YEPQRCWEDIFDAI+ AKH++YITGWSVY EI+LV
Sbjct  181   KVSLYQDAHIPDNFVPNIPLAGGKNYEPQRCWEDIFDAISNAKHMIYITGWSVYAEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD ++GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDMSIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+Q++++ TMFTHHQKIVVVD EMP  G +E RRIVSF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQSLQVSTMFTHHQKIVVVDSEMPSRGGSEMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_009348321.1| PREDICTED: phospholipase D alpha 1 [Pyrus x bretschneideri]
Length=810

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 314/379 (83%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1     MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NPRWYESFHIYCAH  +NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60    ARVGRTRVIEKEPSNPRWYESFHIYCAHTTANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120   GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GCKV+LYQDAH+P+ FIP+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEI+
Sbjct  180   GCKVSLYQDAHIPDKFIPKIPLAGGKRYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             LVRD RRPKPGG+ T+GELLKKKASEGVRVLMLVWDDRTSV LLKKDGLMATHDEET  +
Sbjct  240   LVRDSRRPKPGGEITIGELLKKKASEGVRVLMLVWDDRTSVSLLKKDGLMATHDEETAKF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F+ T+VHCVLCPRNPD G SIIQ  ++ TMFTHHQKIVVVD +MP+G++ERRRIVSF+GG
Sbjct  300   FQGTDVHCVLCPRNPDGGGSIIQGAQVSTMFTHHQKIVVVDHDMPNGESERRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH LFRTL
Sbjct  360   LDLCDGRYDTPFHSLFRTL  378



>ref|XP_004235964.1| PREDICTED: phospholipase D alpha 1 [Solanum lycopersicum]
Length=811

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 317/376 (84%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG+LHV ++EVDK+      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1     MAPILLHGTLHVTIHEVDKLHGKQGRNFFSKIKDSVEEKVGMGKGASRIYATVDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR++ +E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61    GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VDEW+ +LD D NP+ + SKIHV LQ+ ++ R+R WGRG+  +++PGVPYTFFPQR GC+
Sbjct  121   VDEWIEILDEDENPVEAGSKIHVTLQYFEISRDRNWGRGIGTSKYPGVPYTFFPQRTGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LY DAH+P+NFIP+IPL+GG++YEP RCWEDIFDAI+ AKH++YITGWSVYTEITL+R
Sbjct  181   VSLYHDAHIPDNFIPKIPLSGGKYYEPHRCWEDIFDAISNAKHMIYITGWSVYTEITLMR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGG  T+GELLKKKA EGV+VLMLVWDDRTSV LLKKDGLMATHDEET  YFKD
Sbjct  241   DSRREKPGGGDTVGELLKKKAKEGVKVLMLVWDDRTSVRLLKKDGLMATHDEETEEYFKD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             ++VHCVLCPR+PDDG SI+++I+  TMFTHHQKIV+VD  MP+G++E RR++SF+GG+DL
Sbjct  301   SDVHCVLCPRDPDDGGSIVKDIQTSTMFTHHQKIVIVDTVMPNGESETRRLMSFVGGLDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|XP_008360327.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=810

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 315/379 (83%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  SRLYAT+DLE+
Sbjct  1     MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKITGKLEETVGIGKGISRLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60    ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD+W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120   GEEVDQWAEILDGKKEPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GCKV+LYQDAH+P+ FIP+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEI+
Sbjct  180   GCKVSLYQDAHIPDKFIPKIPLAGGKHYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             LVRD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSVGLLK+DGLMATHDEET  +
Sbjct  240   LVRDSRRPKPGGDITIGELLKKKASEGVRVLVLVWDDRTSVGLLKRDGLMATHDEETAQF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F++T+VHCVLCPRNPD G SIIQ  ++ TMFTHHQKIVVVD +MP+G++ERRRIVSF+GG
Sbjct  300   FQNTDVHCVLCPRNPDGGGSIIQGAQVSTMFTHHQKIVVVDHDMPNGESERRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH LFRTL
Sbjct  360   LDLCDGRYDTPFHSLFRTL  378



>ref|XP_008243731.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243732.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243733.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
Length=810

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/379 (69%), Positives = 315/379 (83%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1     MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60    ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120   GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GCKV LYQDAH+P+ FIP+IPLAGG+FYEP RCWEDIFDAI+ AKHL+YITGWSVYTEI+
Sbjct  180   GCKVNLYQDAHIPDKFIPKIPLAGGKFYEPHRCWEDIFDAISNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             LVRD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSVGLLKKDGLMATHDEET  +
Sbjct  240   LVRDSRRPKPGGDITIGELLKKKASEGVRVLVLVWDDRTSVGLLKKDGLMATHDEETAQF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F++T+VHCVLCPRNPD G SI+Q  +I TMFTHHQKIVVVD +MP+G +ERRRIVSF+GG
Sbjct  300   FQNTDVHCVLCPRNPDGGGSIVQGAQISTMFTHHQKIVVVDNDMPNGGSERRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH +FRTL
Sbjct  360   LDLCDGRYDTPFHSIFRTL  378



>ref|XP_007217042.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
 gb|EMJ18241.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
Length=810

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/379 (69%), Positives = 315/379 (83%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1     MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60    ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120   GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GCKV LYQDAH+P+ FIP+IPLAGG+FYEP RCWEDIFDAI+ AKHL+YITGWSVYTEI+
Sbjct  180   GCKVNLYQDAHIPDKFIPKIPLAGGKFYEPHRCWEDIFDAISNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             LVRD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSVGLLKKDGLMATHDEET  +
Sbjct  240   LVRDSRRPKPGGDITIGELLKKKASEGVRVLVLVWDDRTSVGLLKKDGLMATHDEETAQF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F++T+VHCVLCPRNPD G SI+Q  +I TMFTHHQKIVVVD +MP+G +ERRRIVSF+GG
Sbjct  300   FQNTDVHCVLCPRNPDGGGSIVQGAQISTMFTHHQKIVVVDNDMPNGGSERRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH +FRTL
Sbjct  360   LDLCDGRYDTPFHSIFRTL  378



>sp|Q70EW5.2|PLDA1_CYNCA RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Cynara cardunculus]
 emb|CAE47482.2| phospholipase D alpha [Cynara cardunculus]
Length=808

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/376 (68%), Positives = 319/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M+++LLHG+LHV VYEVDK++  G  N+F K++   +  VGF +   ++YATIDLEK+RV
Sbjct  1     MSKVLLHGTLHVTVYEVDKLREGGGPNVFGKLMANIQETVGFGEGTPKIYATIDLEKSRV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR++ +E +NPRWYESFHIYCAH ASN++F+VK DNPIGA L+GRAYMP R LL G+E
Sbjct  61    GRTRMIENEPQNPRWYESFHIYCAHHASNIIFTVKDDNPIGATLLGRAYMPVRELLDGDE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ ++D D NP  + SKIHVKLQ+ DV ++R W RG+K  ++PGVPYTFF QR+GC+
Sbjct  121   VDKWIEIMDEDNNPTPAGSKIHVKLQYFDVTQDRNWDRGIKTGKYPGVPYTFFAQRQGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NFIP+I LAGG++YEP RCWEDIFDAI+ AKH +YITGWSVYT+I L+R
Sbjct  181   VSLYQDAHVPDNFIPKISLAGGKYYEPHRCWEDIFDAISDAKHFIYITGWSVYTQIPLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             DP R KPGGD  LG+LLKKKA EGVRV MLVWDDRTSV + K+DGLMATHDEET N+FKD
Sbjct  241   DPNRQKPGGDVLLGQLLKKKADEGVRVAMLVWDDRTSVNVFKEDGLMATHDEETENFFKD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHC+LCPR+PDDG SIIQ++++ TMFTHHQKIVVVD E+P G +++RR++SF+GGIDL
Sbjct  301   TDVHCILCPRDPDDGGSIIQDLKVSTMFTHHQKIVVVDHELPRGGSQKRRVMSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYDS FHPLF TL
Sbjct  361   CDGRYDSAFHPLFSTL  376



>ref|XP_010487412.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Camelina sativa]
Length=810

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/378 (69%), Positives = 319/378 (84%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YE+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYIPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFDAI+ AKHL+YITGWSVY EI+LV
Sbjct  181   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD ++GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDMSIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+Q++++ TMFTHHQKIVVVD EMP  G +E RRI+SF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQSLQVSTMFTHHQKIVVVDTEMPSSGGSEMRRIMSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>sp|O04865.1|PLDA1_VIGUN RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Vigna unguiculata]
 gb|AAB51392.1| phospholipase D [Vigna unguiculata]
Length=809

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/377 (69%), Positives = 318/377 (84%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ+LLHG+LH  +YEVD++   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1     MAQILLHGTLHATIYEVDELHGGGGGNFFSKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR++ +E  NP+W ESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61    GRTRIIENETTNPKWNESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D+W+ +LD ++NPI   SKIHV+LQ+ DV+++R W RG+++ ++PGVPYTFF QR+GCK
Sbjct  121   IDKWVEILDTEKNPIEGGSKIHVRLQYFDVLKDRNWARGIRSPKYPGVPYTFFSQRQGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V LYQDAHVP+NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+L+R
Sbjct  181   VFLYQDAHVPDNFVPKIPLAGGKNYEAHRCWEDIFDAITNAKHLIYITGWSVYTEISLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPK GGD T+GELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  +F+D
Sbjct  241   DSRRPKAGGDQTIGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEQFFRD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGGID  1262
             T+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD  +P  G +++RRIVSF+GG+D
Sbjct  301   TDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSALPGGGGSDKRRIVSFVGGLD  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+ FH LFRTL
Sbjct  361   LCDGRYDTAFHSLFRTL  377



>ref|XP_010322318.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322320.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322321.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 gb|AAF17557.1|AF201661_1 phospholipase D alpha [Solanum lycopersicum]
Length=809

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/378 (70%), Positives = 317/378 (84%), Gaps = 4/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1     MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  363   RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60    RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EE+D+W+ ++D + NP    SKIHVKLQF DV R+  WGRG++++R+PGVPYTFF QR G
Sbjct  120   EEIDKWVEIMDKEMNPTAEGSKIHVKLQFFDVSRDPNWGRGIRSSRYPGVPYTFFAQRPG  179

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
              +V+LYQDAHVP+NFIP+IPL+GG++YEP RCWEDIFDAIT AKHL+YITGWSVYTEI L
Sbjct  180   SRVSLYQDAHVPDNFIPKIPLSGGKYYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIAL  239

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RR KPGGD  LGELLKKKASEGV+VLMLVWDDRTSVGLLKKDGLMATHD+ET  YF
Sbjct  240   VRDSRRQKPGGDIMLGELLKKKASEGVKVLMLVWDDRTSVGLLKKDGLMATHDQETEQYF  299

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGI  1259
             + T+V+CVLCPRNPD+G S +Q+I+I TMFTHHQKI+VVD  +P G+ E+RRI+SF+GGI
Sbjct  300   QGTDVNCVLCPRNPDNGGSFVQDIQISTMFTHHQKIIVVDSALPSGELEKRRILSFVGGI  359

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  360   DLCDGRYDTPFHSLFRTL  377



>ref|XP_008673445.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 ref|XP_008673446.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 gb|ACN25900.1| unknown [Zea mays]
 gb|ACN27927.1| unknown [Zea mays]
 gb|ACN28359.1| unknown [Zea mays]
 gb|ACN29073.1| unknown [Zea mays]
 tpg|DAA53244.1| TPA: phospholipase D family protein [Zea mays]
Length=812

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 319/381 (84%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1     MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61    EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NF+PRI LA G+ YEP RCWEDIFDAI+KA+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFVPRIQLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  240   ITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  T+V+CVLCPRNPDD  S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSFI
Sbjct  300   NYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHEMPNQGSQQRRIVSFI  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  360   GGIDLCDGRYDTQYHSLFRTL  380



>gb|ACR35730.1| unknown [Zea mays]
Length=812

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 319/381 (84%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1     MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61    EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NF+PRI LA G+ YEP RCWEDIFDAI+KA+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFVPRIQLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  240   ITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  T+V+CVLCPRNPDD  S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSFI
Sbjct  300   NYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHEMPNQRSQQRRIVSFI  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  360   GGIDLCDGRYDTQYHSLFRTL  380



>gb|ACG80607.1| phospholipase D alpha [Prunus persica]
Length=810

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 315/379 (83%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1     MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60    ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120   GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GCKV LYQDAH+P+ FIP+IPLAGG+FY+P RCWEDIFDAI+ AKHL+YITGWSVYTEI+
Sbjct  180   GCKVNLYQDAHIPDKFIPKIPLAGGKFYDPHRCWEDIFDAISNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             LVRD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSVGLLKKDGLMATHDEET  +
Sbjct  240   LVRDSRRPKPGGDITIGELLKKKASEGVRVLVLVWDDRTSVGLLKKDGLMATHDEETAQF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F++T+VHCVLCPRNPD G SI+Q  +I TMFTHHQKIVVVD +MP+G +ERRRIVSF+GG
Sbjct  300   FQNTDVHCVLCPRNPDGGGSIVQGAQISTMFTHHQKIVVVDNDMPNGGSERRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH +FRTL
Sbjct  360   LDLCDGRYDTPFHSIFRTL  378



>ref|XP_010250112.1| PREDICTED: phospholipase D alpha 1 [Nelumbo nucifera]
Length=815

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/383 (70%), Positives = 314/383 (82%), Gaps = 8/383 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHN----LFHKIVEGAERVVGFNKTASRLYATIDLE  356
             M+ +LLHGSLHV +YEVD++ + G         H+IVE     VG  K   ++YAT+DLE
Sbjct  1     MSDILLHGSLHVTIYEVDRLSSGGGGGGPGGFLHQIVENIGEAVGIGKDTPKIYATVDLE  60

Query  357   KARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  533
             KARVGRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK D+ IGA L GRAY+P   +L
Sbjct  61    KARVGRTRIIENERVNPRWYESFHIYCAHMASNVIFTVKDDDAIGATLYGRAYVPVEEIL  120

Query  534   GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQR  713
              GEEVD WL +LD+DRNP+   SKIHV+LQF DV R+R W  G+++A+FPGVPYTFF QR
Sbjct  121   NGEEVDRWLEILDDDRNPVREGSKIHVRLQFFDVTRDRNWSMGIRSAKFPGVPYTFFSQR  180

Query  714   RGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEI  893
             +GC+V+LYQDAH+P  FIP+I L G  FYEP RCWEDIFDAIT AKHLVYITGWSVYTEI
Sbjct  181   KGCRVSLYQDAHIPNGFIPKIALDGNEFYEPHRCWEDIFDAITNAKHLVYITGWSVYTEI  240

Query  894   TLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGN  1073
              L+RD RRPKPGGD TLGELLKKKA EGVRVLMLVWDDRTSV LLKKDGLMATHDEET N
Sbjct  241   HLIRDNRRPKPGGDITLGELLKKKAGEGVRVLMLVWDDRTSVDLLKKDGLMATHDEETEN  300

Query  1074  YFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDG---DTERRRIVS  1244
             +F+ T+V+C+LCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP G    +ERRRIVS
Sbjct  301   FFQGTDVNCILCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSEMPIGSGASSERRRIVS  360

Query  1245  FIGGIDLCDGRYDSPFHPLFRTL  1313
             FIGGIDLCDGRYD+PFH LFRTL
Sbjct  361   FIGGIDLCDGRYDAPFHSLFRTL  383



>gb|ACL53693.1| unknown [Zea mays]
Length=812

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 319/381 (84%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1     MAQILLHGTLHATIFEAESLSNPHRATGGAPKFTRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61    EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NF+PRI LA G+ YEP RCWEDIFDAI+KA+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFVPRIQLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  240   ITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  T+V+CVLCPRNPDD  S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSFI
Sbjct  300   NYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHEMPNQGSQQRRIVSFI  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  360   GGIDLCDGRYDTQYHSLFRTL  380



>ref|XP_010465563.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/378 (69%), Positives = 319/378 (84%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+P+IPLAGG+ YEPQRCWEDIFDAI+ AKHL+YITGWSVY EI+LV
Sbjct  181   KVSLYQDAHIPDNFVPKIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD ++GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDMSIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDG-DTERRRIVSFIGGI  1259
              +EVHCVLCPRNPDDG SI+Q++++ TMFTHHQKIVVVD EMP    +E RRI+SF+GGI
Sbjct  301   GSEVHCVLCPRNPDDGGSIVQSLQVSTMFTHHQKIVVVDTEMPSSVGSEMRRIMSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_003569355.1| PREDICTED: phospholipase D alpha 1 [Brachypodium distachyon]
Length=811

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 319/380 (84%), Gaps = 6/380 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  356
             MAQ+LLHG+LHV ++E   +     + G      K VEG E  VG  K AS+LYATIDLE
Sbjct  1     MAQILLHGNLHVTIFEASSLSNPRASGGAPKFLRKFVEGIEDTVGVGKGASKLYATIDLE  60

Query  357   KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  533
             KARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P + LL
Sbjct  61    KARVGRTRMLSNEPVNPRWYESFHIYCAHLAADVIFTVKADNAIGATLIGRAYLPVQELL  120

Query  534   GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQR  713
              GEE+D WL + D++R P+   SKIHVKLQ+ D+ ++R W RGV+++++PGVPYTFF QR
Sbjct  121   DGEEIDRWLEVRDDNREPV-GESKIHVKLQYFDISKDRNWSRGVRSSKYPGVPYTFFSQR  179

Query  714   RGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEI  893
             +GCKVTLYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAI+ A+HL+YITGWSV+TEI
Sbjct  180   QGCKVTLYQDAHVPDNFIPKIPLADGKSYEPGRCWEDIFDAISNAQHLIYITGWSVHTEI  239

Query  894   TLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGN  1073
             TL+RD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET N
Sbjct  240   TLIRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETAN  299

Query  1074  YFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIG  1253
             YF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD EMP+  +++RRI+SF+G
Sbjct  300   YFQGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHEMPNQGSQQRRILSFVG  359

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+ +H LFRTL
Sbjct  360   GIDLCDGRYDTQYHSLFRTL  379



>ref|XP_006643814.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=812

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/381 (70%), Positives = 314/381 (82%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  + E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1     MAQMLLHGTLHATILEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+PA+ L
Sbjct  61    EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPAQEL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEE+D WL + DNDR P+   SKIHVKLQ+ DV ++R W RGV + ++PGVPYTFF Q
Sbjct  121   LSGEEIDRWLDICDNDRQPV-GESKIHVKLQYFDVAKDRNWARGVLSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDIFDAISNAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET 
Sbjct  240   ITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  ++V+CVLCPRNPDD  SI+Q++ I TMFTHHQKIVVVD EMP+  +++RRIVSF+
Sbjct  300   NYFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTHHQKIVVVDHEMPNQGSQQRRIVSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GG+DLCDGRYD+ +H LFRTL
Sbjct  360   GGLDLCDGRYDTQYHSLFRTL  380



>ref|XP_008654846.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008654847.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 gb|AFW80165.1| phospholipase D family protein [Zea mays]
Length=812

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/381 (70%), Positives = 318/381 (83%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K  +++YAT+DL
Sbjct  1     MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGIGKGTTKIYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMA++VVF+VK+DNPIGA LIGRAY+P   +
Sbjct  61    EKARVGRTRMVSNEPVNPRWYESFHIYCAHMAADVVFTVKIDNPIGASLIGRAYLPVEDI  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             LGG+E+D+WL + D  R PI   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LGGDEIDKWLEICDEKREPI-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NF+PRIPLA G+ YEP RCWEDIFDAI+KA+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFVPRIPLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  240   ITLVRDTSRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  T+V+CVLCPRNPDD  S +Q+++I TMFTHHQKIVVVD E+P+  +++RRIVSF+
Sbjct  300   NYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHELPNEGSQQRRIVSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  360   GGIDLCDGRYDTQYHSLFRTL  380



>ref|XP_010503392.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/378 (69%), Positives = 319/378 (84%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYVPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+P+IPLAGG+ YEPQRCWEDIFDAI+ AKHL+YITGWSVY EI+LV
Sbjct  181   KVSLYQDAHIPDNFVPKIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD ++GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDMSIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGGI  1259
              ++VHC+LCPRNPDDG SI+Q++++ TMFTHHQKIVVVD EMP  G +E RRI+SF+GGI
Sbjct  301   GSDVHCILCPRNPDDGGSIVQSLQVSTMFTHHQKIVVVDTEMPSSGGSEMRRIMSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_006406922.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 ref|XP_006406923.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48375.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48376.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=810

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/378 (69%), Positives = 319/378 (84%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  ++EVD +   G+   F  K++   E  +G  K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIFEVDALHGGGIRQGFLGKVLANVEEKIGVGKGETQLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W  G+K+A+FPGVPYTFF QR+GC
Sbjct  121   EVDQWVEILDNDRNPIEGGSKIHVKLQYFHVEEDRNWNMGIKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQ AH+P+NF+P+IPLAGG+ YEP RCWEDIFDAI+ AKHL+YITGWSVYTEITLV
Sbjct  181   KVSLYQGAHIPDNFVPKIPLAGGKNYEPHRCWEDIFDAISNAKHLIYITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+L+WDDRTSV +LKKDGLMATHDE+T N+F+
Sbjct  241   RDSRRPKPGGDMTIGELLKKKASEGVRVLLLIWDDRTSVDVLKKDGLMATHDEDTENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
              ++VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD EMP  G +E RRI+SF+GGI
Sbjct  301   GSDVHCVLCPRNPDDGGSFVQSLQISTMFTHHQKIVVVDTEMPSQGGSEMRRIMSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|NP_001105686.1| phospholipase D alpha 1 [Zea mays]
 sp|Q43270.1|PLDA1_MAIZE RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Zea mays]
 dbj|BAA11135.1| phospholipase D [Zea mays]
Length=812

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/381 (70%), Positives = 318/381 (83%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1     MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+  + L
Sbjct  61    EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLAVQDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LGGEEIDKWLEISDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NF+PRI LA G+ YEP RCWEDIFDAI+KA+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFVPRIQLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  240   ITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  T+V+CVLCPRNPDD  S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSFI
Sbjct  300   NYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHEMPNQGSQQRRIVSFI  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  360   GGIDLCDGRYDTQYHSLFRTL  380



>ref|XP_009365415.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=816

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/385 (68%), Positives = 315/385 (82%), Gaps = 8/385 (2%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1     MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG------RAYMP  518
             ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIG      RAY+P
Sbjct  60    ARVGRTRVIEKEPSNPRWYESFHIYCAHTATNVIFTVKESNPIGASLIGGASLIGRAYVP  119

Query  519   ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYT  698
              + L+ GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG G+++ +FPGVP+T
Sbjct  120   VQELIEGEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFT  179

Query  699   FFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWS  878
             FF QR+GCKV+LYQDAH+P+ FIP+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWS
Sbjct  180   FFSQRQGCKVSLYQDAHIPDKFIPKIPLAGGKRYEPHRCWEDIFDAITNAKHLIYITGWS  239

Query  879   VYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHD  1058
             VYTEI+LVRD RRPKPGG+ T+GELLKKKASEGVRVLMLVWDDRTSV LLKKDGLMATHD
Sbjct  240   VYTEISLVRDSRRPKPGGEITIGELLKKKASEGVRVLMLVWDDRTSVSLLKKDGLMATHD  299

Query  1059  EETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRI  1238
             EET  +F+ T+VHCVLCPRNPD G SIIQ  ++ TMFTHHQKIVVVD +MP+G++ERRRI
Sbjct  300   EETAKFFQGTDVHCVLCPRNPDGGGSIIQGAQVSTMFTHHQKIVVVDHDMPNGESERRRI  359

Query  1239  VSFIGGIDLCDGRYDSPFHPLFRTL  1313
             VSF+GG+DLCDGRYD+PFH LFRTL
Sbjct  360   VSFVGGLDLCDGRYDTPFHSLFRTL  384



>ref|XP_008373955.1| PREDICTED: phospholipase D alpha 1 [Malus domestica]
Length=810

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 312/379 (82%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1     MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKIAGKIEETVGIGKGISKLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60    ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120   GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GCKV+LYQDAH+P+ FIP+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEI+
Sbjct  180   GCKVSLYQDAHIPDKFIPKIPLAGGKRYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             LVRD RRPKPGGD T+GELLKKKASEGVRVL LVWDDRTSVGLLK DGLMATHDE T  +
Sbjct  240   LVRDSRRPKPGGDXTIGELLKKKASEGVRVLXLVWDDRTSVGLLKXDGLMATHDEXTAXF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F+ T+VHCVLCPRNPD G SIIQ  ++ TMFTHHQKIVVVD +MP+G++ERRRIVSF+GG
Sbjct  300   FQGTDVHCVLCPRNPDGGGSIIQGAQVSTMFTHHQKIVVVDHDMPNGESERRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH LFRTL
Sbjct  360   LDLCDGRYDTPFHSLFRTL  378



>ref|XP_007150745.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
 gb|ESW22739.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
Length=808

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/376 (68%), Positives = 319/376 (85%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MAQ++LHG+LH  +YEVD +K     N+  K++   E  +G  K  ++LYATIDLEKARV
Sbjct  1     MAQVVLHGTLHATIYEVDNLKAGNGGNILTKLLHNMEETIGIGKGITKLYATIDLEKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ EH NP+WYESFHIYCAH ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61    GRTRVIEKEHTNPKWYESFHIYCAHEASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             ++ W+ +LD  + PIH+ SKIHVKLQ+ DV ++  WG+G+K+ +FPGVPYT+F QR+GC+
Sbjct  121   IERWVEILDEHKKPIHTRSKIHVKLQYYDVSKDLNWGQGIKSPKFPGVPYTYFSQRQGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAHVP+NF+PRIPL+GG  Y+P+RCWED+FDAI  A+HL+YITGWSVYTEITLVR
Sbjct  181   VSLYQDAHVPDNFVPRIPLSGGHTYQPRRCWEDVFDAINHAQHLIYITGWSVYTEITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGDATL ELLK+KA +GVRVLMLVWDDRTSV LLK++G MATHDE+TGNYF D
Sbjct  241   DSRRPKPGGDATLCELLKRKARDGVRVLMLVWDDRTSVRLLKENGFMATHDEDTGNYFYD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             +EVHCVLCPRNPD+G S+IQ++EI +MFTHHQKIVVVD  +P+G +++RRIVSF+GGIDL
Sbjct  301   SEVHCVLCPRNPDNGGSVIQDMEIFSMFTHHQKIVVVDSALPNGRSDKRRIVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  361   CDGRYDTQFHSLFRTL  376



>ref|NP_001042153.1| Os01g0172400 [Oryza sativa Japonica Group]
 sp|Q43007.2|PLDA1_ORYSJ RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAF04067.1| Os01g0172400 [Oryza sativa Japonica Group]
 gb|EEE53959.1| hypothetical protein OsJ_00559 [Oryza sativa Japonica Group]
Length=812

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/381 (69%), Positives = 315/381 (83%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1     MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61    EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDIFDAISNAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET 
Sbjct  240   ITLVRDSNRPKPGGDVTLGELLKKKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETE  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  ++V+CVLCPRNPDD  SI+Q++ I TMFTHHQKIVVVD E+P+  +++RRIVSF+
Sbjct  300   NYFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTHHQKIVVVDHELPNQGSQQRRIVSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GG+DLCDGRYD+ +H LFRTL
Sbjct  360   GGLDLCDGRYDTQYHSLFRTL  380



>gb|ABX83202.2| phospholipase D [Lolium temulentum]
Length=811

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/380 (70%), Positives = 313/380 (82%), Gaps = 6/380 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTD----GLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  356
             MAQ+LLHG+LHV ++E   + T            KIVEG E  VG  K AS+LYATIDLE
Sbjct  1     MAQILLHGNLHVTIFEAQALSTGRASAAAPKFLRKIVEGLEDTVGVGKGASKLYATIDLE  60

Query  357   KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  533
             KARVGRTR+L +E  +PRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P   LL
Sbjct  61    KARVGRTRMLANEPVSPRWYESFHIYCAHLAADVIFTVKADNAIGAALIGRAYLPVSELL  120

Query  534   GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQR  713
              G+E+D WL + D DR PI   SKIHVKLQF +  ++R W RGV++A++PGVPYTFF QR
Sbjct  121   AGDEIDRWLEVCDTDRQPI-GESKIHVKLQFFEATKDRNWARGVRSAKYPGVPYTFFSQR  179

Query  714   RGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEI  893
             +GC V LYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAIT A+HL+YITGWSV T I
Sbjct  180   QGCNVRLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDIFDAITNAQHLIYITGWSVNTTI  239

Query  894   TLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGN  1073
             TL+RD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLK+DGLMATHDE+T N
Sbjct  240   TLIRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEDTAN  299

Query  1074  YFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIG  1253
             +F+DTEV+CVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD EMP+  +E+RRIVSF+G
Sbjct  300   FFRDTEVNCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDSEMPNQGSEQRRIVSFVG  359

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+ +H LFRTL
Sbjct  360   GIDLCDGRYDTQYHSLFRTL  379



>ref|XP_006364211.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=805

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/376 (69%), Positives = 316/376 (84%), Gaps = 7/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG+LHV ++EVD++      N F K        VG  K ASR+YAT+DLEKARV
Sbjct  1     MAPILLHGTLHVTIHEVDRLHGKHGRNFFSK------ETVGMGKGASRIYATVDLEKARV  54

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  55    GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  114

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VDEW+ +LD D NPI + SKIHV LQ+ ++ R+R WGRG+ ++++PGVPYTFFPQR GC+
Sbjct  115   VDEWIEILDEDENPIEAGSKIHVTLQYFEISRDRNWGRGIGSSKYPGVPYTFFPQRTGCR  174

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+LYQDAH+P+ FIP+IPL+GG++YEP RCWEDIFDAIT AKH++YITGWSVYTEITL+R
Sbjct  175   VSLYQDAHIPDKFIPKIPLSGGKYYEPHRCWEDIFDAITNAKHMIYITGWSVYTEITLLR  234

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR KPGGD ++GELLKKKA EGV+VLMLVWDDRTSV LLKKDGLMATHDEET  YFKD
Sbjct  235   DSRREKPGGDDSVGELLKKKAKEGVKVLMLVWDDRTSVRLLKKDGLMATHDEETEEYFKD  294

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPR+PDDG SI+++++   MFTHHQKIV+VD +MP+G++E RR++SF+GG+DL
Sbjct  295   TDVHCVLCPRDPDDGGSIVKDLQTSAMFTHHQKIVIVDTDMPNGESETRRLMSFVGGLDL  354

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  355   CDGRYDTPFHSLFRTL  370



>ref|XP_010545768.1| PREDICTED: phospholipase D alpha 1 [Tarenaya hassleriana]
Length=810

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/378 (70%), Positives = 315/378 (83%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  VYE+D +    G    F +++   E  +G  K  ++LYAT+DLEKAR
Sbjct  1     MAQRLLHGTLHATVYEIDHLHGGGGRSGFFGQLLANVEETIGVGKGETQLYATVDLEKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + D+  +P+W ESFHIYCAHMASN++F+VK  NPIGA LIGRAY+P   +  GE
Sbjct  61    VGRTRKIKDDPNSPKWNESFHIYCAHMASNIIFTVKDANPIGATLIGRAYVPVEEIWDGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EV++W+ +LD +RNPI   SKI V+LQ+ DV ++R W RG+++A+FPGVPYTFF QR+GC
Sbjct  121   EVEKWVEILDTNRNPIKGDSKIRVRLQYFDVTKDRNWNRGIRSAKFPGVPYTFFSQRKGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+PENF+PRIPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEI LV
Sbjct  181   KVSLYQDAHIPENFVPRIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIALV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKPGGDVTLGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER-RRIVSFIGGI  1259
              T+VHCVLCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G + + RRIVSF+GGI
Sbjct  301   GTDVHCVLCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGSSSQMRRIVSFVGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_004303313.1| PREDICTED: phospholipase D alpha 1 [Fragaria vesca subsp. vesca]
Length=810

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 314/379 (83%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1     MGDAAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NP+W+ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60    ARVGRTRVIEKEPSNPKWFESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD W  +LD+ + P+H   KIHVKLQF  V ++R WG+G+K+ +FPGVP+TFF QR+
Sbjct  120   GEEVDTWAEILDDKKKPVHGEPKIHVKLQFFHVSKDRSWGQGIKSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GC+V+L+QDAHVP+ FIP+IPLAGG++YEP RCWEDIFDAIT AKHL+YITGWSVYTEI+
Sbjct  180   GCRVSLFQDAHVPDKFIPKIPLAGGKYYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             L+RD RRPK GGD T+GELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  +
Sbjct  240   LIRDSRRPKSGGDITIGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETAQF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F++T+V+CVLCPRNPD G SI+Q  +I TMFTHHQKIVVVD EMP+G ++ RRIVSF+GG
Sbjct  300   FQNTDVNCVLCPRNPDGGGSIVQGAQISTMFTHHQKIVVVDSEMPNGGSQSRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH LFRTL
Sbjct  360   LDLCDGRYDTPFHSLFRTL  378



>gb|EEC70024.1| hypothetical protein OsI_00588 [Oryza sativa Indica Group]
Length=812

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/381 (69%), Positives = 315/381 (83%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1     MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61    EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAI+ A+HL+YITGWSVYT+
Sbjct  180   RQGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDIFDAISNAQHLIYITGWSVYTK  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET 
Sbjct  240   ITLVRDSNRPKPGGDVTLGELLKKKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETE  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  ++V+CVLCPRNPDD  SI+Q++ I TMFTHHQKIVVVD E+P+  +++RRIVSF+
Sbjct  300   NYFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTHHQKIVVVDHELPNQGSQQRRIVSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GG+DLCDGRYD+ +H LFRTL
Sbjct  360   GGLDLCDGRYDTQYHSLFRTL  380



>gb|AAW83125.1| phospholipase D alpha [Fragaria x ananassa]
Length=810

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 313/379 (83%), Gaps = 2/379 (1%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1     MGDSAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  360   ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR+++ E  NP W ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60    ARVGRTRVIEKEPSNPNWSESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD W  +LD+ +NP+H   KIHVKLQF  V ++R WG+G+K+ +FPGVP+TFF QR+
Sbjct  120   GEEVDTWAKILDDKKNPVHGEPKIHVKLQFFHVSKDRSWGQGIKSPKFPGVPFTFFSQRQ  179

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
             GC+V+L+QDAHVP+ FIP+IPLAGG++YEP RCWEDIFDAIT AKHL+YITGWSVYTEI+
Sbjct  180   GCRVSLFQDAHVPDKFIPKIPLAGGKYYEPHRCWEDIFDAITNAKHLIYITGWSVYTEIS  239

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             L+RD RRPK GGD T+GELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  +
Sbjct  240   LIRDSRRPKSGGDITIGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETAQF  299

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F++T+V+CVLCPRNPD G SI+Q  +I TMFTHHQKIVVVD EMP+G ++ RRIVSF+GG
Sbjct  300   FQNTDVNCVLCPRNPDGGGSIVQGAQISTMFTHHQKIVVVDSEMPNGGSQSRRIVSFVGG  359

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH LFRTL
Sbjct  360   LDLCDGRYDTPFHSLFRTL  378



>ref|XP_002894388.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70647.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/377 (69%), Positives = 312/377 (83%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1     MEEFLLHGRLHATIYEVDRLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  366   VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61    VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDND+NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121   EVDRWVDILDNDKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHIPGNFVPKIPLAGGKNYEPGRCWEDIFDAITNAKHLIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPK GGD T+GELLKKKASEGV+V++LVWDDRTSV LLKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKQGGDVTIGELLKKKASEGVKVILLVWDDRTSVDLLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+V+C+LCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G +  RRIVSF+GG+D
Sbjct  301   GTDVNCILCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGGSRSRRIVSFVGGLD  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>dbj|BAA11136.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAA19467.1| phospholipase D [Oryza sativa Japonica Group]
Length=812

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/381 (69%), Positives = 314/381 (82%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1     MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61    EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEE+D WL + DN+R  +   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LNGEEIDRWLDICDNNRESV-GESKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDIFDAISNAQHLIYITGWSVYTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RPKPGGD TLGELLKKKASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET 
Sbjct  240   ITLVRDSNRPKPGGDVTLGELLKKKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETE  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  ++V+CVLCPRNPDD  SI+Q++ I TMFTHHQKIVVVD E+P+  +++RRIVSF+
Sbjct  300   NYFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTHHQKIVVVDHELPNQGSQQRRIVSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GG+DLCDGRYD+ +H LFRTL
Sbjct  360   GGLDLCDGRYDTQYHSLFRTL  380



>ref|XP_010462102.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462103.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462104.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
Length=810

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/377 (69%), Positives = 312/377 (83%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M + LLHG LH  +YEVD++ T+G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1     MEEFLLHGRLHATIYEVDRLNTEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61    VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121   EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHIPGNFVPKIPLAGGKNYEASRCWEDIFDAITNAKHLIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPK GGD T+GELLKKKASEGV+V++LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKQGGDVTVGELLKKKASEGVKVILLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+V+C+LCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G +  RRIVSF+GG+D
Sbjct  301   GTDVNCILCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGGSRTRRIVSFVGGLD  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>ref|XP_010925209.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925210.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925211.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=810

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/378 (68%), Positives = 316/378 (84%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             MA +LLHG+LH+ ++E D + +   G      ++VEG    +G  K +S+LYATID+EKA
Sbjct  1     MAYILLHGTLHITIFEADSLSSASGGGPKFIRQLVEGIGDTIGLGKGSSQLYATIDVEKA  60

Query  363   RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTRL+ +E   PRWYESFHIYCAH+A++V+F+VK D PIGA L+GRAY+P   +L G
Sbjct  61    RVGRTRLITNEPVKPRWYESFHIYCAHLAASVIFTVKDDKPIGASLVGRAYLPVTEILDG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EE+D WL + D D  P+   +KIHVK+Q+ D+ ++R W RG+++A++PGVPYTFF QRRG
Sbjct  121   EEIDRWLEICDEDSKPLDGGAKIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQRRG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKVTLYQDAHVP+NFIP+IPLA G++Y P RCWEDIFDAI+ A+HL+YITGWSVYTEITL
Sbjct  181   CKVTLYQDAHVPDNFIPKIPLADGKYYGPHRCWEDIFDAISNAQHLIYITGWSVYTEITL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             +RD +R KPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE+T +YF
Sbjct  241   LRDSKRQKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEDTASYF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGI  1259
             +DT+VHCVLCPRNPDDG S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSFIGGI
Sbjct  301   QDTDVHCVLCPRNPDDGGSFVQDLQISTMFTHHQKIVVVDHEMPNKGSQQRRIVSFIGGI  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+ FH LFRTL
Sbjct  361   DLCDGRYDTQFHSLFRTL  378



>ref|XP_010687988.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687989.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=806

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/375 (70%), Positives = 304/375 (81%), Gaps = 2/375 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA++LLHG LHV +YE +++   G    FHK+VEG E V+G  K A +LYA+ID+E ARV
Sbjct  1     MAKILLHGVLHVTIYEANRLFGGGGGKFFHKVVEGLESVIG--KGAGKLYASIDIEGARV  58

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTRL++   NPRWYE FHI CAHMAS++VF++K D  IGA L+GRAY+PA  +LGGEEV
Sbjct  59    GRTRLVENDSNPRWYEQFHICCAHMASDIVFTLKEDEAIGATLLGRAYLPATDILGGEEV  118

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             D WL +LD D NPIH  SK+HV +QF DV R+  W  G+K  +FPGVPYT+F QR  CKV
Sbjct  119   DTWLDILDKDHNPIHKGSKVHVLVQFFDVTRDLNWNIGIKTPKFPGVPYTYFTQRNECKV  178

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
             TLYQDAHVP+NF+P+IPL+GG  YEP RCWEDIFDAIT A+HLVYI GWSVYT ITL+RD
Sbjct  179   TLYQDAHVPDNFVPKIPLSGGTHYEPHRCWEDIFDAITNARHLVYIAGWSVYTSITLIRD  238

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              RRPKPGGD TLGELLKKKA EGVRVLML+WDDRTSV  L +DGLMATHDEET  YF+ T
Sbjct  239   TRRPKPGGDMTLGELLKKKAMEGVRVLMLIWDDRTSVKGLHEDGLMATHDEETAKYFEGT  298

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             EVHCVLCPRNPD G+S IQNIEIGTMFTHHQKIV VD  +P   +++RRIVSF+GGIDLC
Sbjct  299   EVHCVLCPRNPDSGKSFIQNIEIGTMFTHHQKIVAVDSALPSQSSDKRRIVSFVGGIDLC  358

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+ FH LFRTL
Sbjct  359   DGRYDTQFHSLFRTL  373



>ref|XP_006306783.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
 gb|EOA39681.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
Length=813

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/378 (69%), Positives = 312/378 (83%), Gaps = 2/378 (1%)
 Frame = +3

Query  186   EMAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKA  362
             +M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKA
Sbjct  3     KMDEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKA  62

Query  363   RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L G
Sbjct  63    RVGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHG  122

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  123   EEVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  182

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+L
Sbjct  183   CKVSLYQDAHIPGNFVPKIPLAGGKNYEAHRCWEDIFDAITNAKHLIYITGWSVYTEISL  242

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPK GGD T+GELLKKKASEGV+V++LVWDDRTSV LLKKDGLMATHDEET N+F
Sbjct  243   VRDSRRPKQGGDVTIGELLKKKASEGVKVILLVWDDRTSVDLLKKDGLMATHDEETENFF  302

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGI  1259
             + T+V+C+LCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G +  RRIVSF+GG+
Sbjct  303   RGTDVNCILCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGGSRSRRIVSFVGGL  362

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  363   DLCDGRYDTPFHSLFRTL  380



>ref|NP_175666.1| phospholipase D alpha 2 [Arabidopsis thaliana]
 sp|Q9SSQ9.1|PLDA2_ARATH RecName: Full=Phospholipase D alpha 2; Short=AtPLDalpha2; Short=PLD 
alpha 2; AltName: Full=Choline phosphatase 2; AltName: 
Full=Phosphatidylcholine-hydrolyzing phospholipase D 2 [Arabidopsis 
thaliana]
 gb|AAD55607.1|AC008016_17 Similar to gb|AF090445 phospholipase D1 from Brassica oleacea 
[Arabidopsis thaliana]
 gb|AEE32825.1| phospholipase D alpha 2 [Arabidopsis thaliana]
Length=810

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/377 (69%), Positives = 311/377 (82%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M + LLHG LH  +YEVD +  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1     MEECLLHGRLHATIYEVDHLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  366   VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61    VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121   EVDRWVDILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHIPGNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPK GGD T+GELLKKKASEGV+V++LVWDDRTSV LLKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKQGGDVTVGELLKKKASEGVKVILLVWDDRTSVDLLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+V+C+LCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G +  RRIVSF+GG+D
Sbjct  301   GTDVNCILCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGGSRSRRIVSFVGGLD  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>emb|CDY20148.1| BnaA01g28540D [Brassica napus]
Length=399

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/377 (69%), Positives = 303/377 (80%), Gaps = 23/377 (6%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1     MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  366   VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61    VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121   EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +V+LYQ AHVP+NF+P+IPLAGG+ YEP RCWEDIFDAIT AKHL+YITGWSVYTEITLV
Sbjct  181   RVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD TLGELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDE+T NYF 
Sbjct  241   RDSRRPKPGGDMTLGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYFN  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              +EVHCVLCP              +  MFTHHQKIVVVD EM       RRI+SF+GGID
Sbjct  301   GSEVHCVLCP--------------LSAMFTHHQKIVVVDSEM-------RRIMSFVGGID  339

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  340   LCDGRYDTPFHSLFRTL  356



>gb|KCW70693.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=773

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/340 (76%), Positives = 300/340 (88%), Gaps = 3/340 (1%)
 Frame = +3

Query  297   ERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKV  473
             E  VG  K  S+LYATIDL KARVGRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K 
Sbjct  5     EETVGLGKGVSKLYATIDLGKARVGRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKD  64

Query  474   DNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  653
             DNPIGA LIGRAY+P   LLGGEE+D W+ +LD +RNPI S  KIHVKL + DV ++R +
Sbjct  65    DNPIGATLIGRAYVPVDELLGGEELDRWVEILDKERNPIGS--KIHVKLHYFDVSKDRIY  122

Query  654   GRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFD  833
             GRG+++A+FPGVPYTFF QR+GCKV+LYQD+H+P+NFIP+IPLAGG+ YEP RCWEDIFD
Sbjct  123   GRGIRSAKFPGVPYTFFSQRQGCKVSLYQDSHIPDNFIPKIPLAGGKHYEPHRCWEDIFD  182

Query  834   AITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRT  1013
             AI+ AKHL+YITGWSVYTEI+LVRD RRPKPGGD T+GELLKKKA+EGVRVLMLVWDDRT
Sbjct  183   AISNAKHLIYITGWSVYTEISLVRDSRRPKPGGDITIGELLKKKANEGVRVLMLVWDDRT  242

Query  1014  SVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVV  1193
             SVGLLKKDGLMATHDEET +YF DTEVHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVV
Sbjct  243   SVGLLKKDGLMATHDEETEHYFHDTEVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVV  302

Query  1194  VDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             VD EMP   ++RRRIVSF+GGIDLCDGRYD+PFH LFRTL
Sbjct  303   VDSEMPSEGSQRRRIVSFVGGIDLCDGRYDTPFHSLFRTL  342



>gb|EMT03624.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=812

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 312/381 (82%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1     MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61    EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVGEL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             LGGEE+D WL + D++R P+   SKIHVKLQ+  V ++R W RGV++ +FPGVPYTFF Q
Sbjct  121   LGGEEIDRWLEICDDNREPV-GESKIHVKLQYFGVDKDRNWARGVRSVKFPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GC V LYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAI+ A+HL+YITGWSV+TE
Sbjct  180   RQGCNVRLYQDAHVPDNFIPKIPLADGKNYEPARCWEDIFDAISNAQHLIYITGWSVHTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITL+RD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET 
Sbjct  240   ITLIRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIV VD  +P   +E+RRI+SF+
Sbjct  300   NYFQGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVCVDDALPSQGSEQRRILSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  360   GGIDLCDGRYDTQYHSLFRTL  380



>ref|XP_010500864.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500866.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500867.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
Length=811

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/378 (69%), Positives = 311/378 (82%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1     MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61    VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121   EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHIPGNFVPKIPLAGGKNYEASRCWEDIFDAITNAKHLIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPK GGD T+GELLKKKASEGV+V++LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKQGGDVTVGELLKKKASEGVKVILLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER-RRIVSFIGGI  1259
              T+V+C+LCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G   R RRIVSF+GG+
Sbjct  301   GTDVNCILCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGGGSRSRRIVSFVGGL  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_010500868.1| PREDICTED: phospholipase D alpha 2-like isoform X2 [Camelina 
sativa]
Length=811

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/378 (69%), Positives = 311/378 (82%), Gaps = 3/378 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1     MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61    VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121   EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHIPGNFVPKIPLAGGKNYEASRCWEDIFDAITNAKHLIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPK GGD T+GELLKKKASEGV+V++LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKQGGDVTVGELLKKKASEGVKVILLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER-RRIVSFIGGI  1259
              T+V+C+LCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G   R RRIVSF+GG+
Sbjct  301   GTDVNCILCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGGGSRSRRIVSFVGGL  360

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD+PFH LFRTL
Sbjct  361   DLCDGRYDTPFHSLFRTL  378



>ref|XP_010479770.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479771.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479772.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
Length=810

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/377 (68%), Positives = 310/377 (82%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1     MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61    VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LDN++ PI   SKIHVK+Q+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121   EVDRWVEILDNEKKPIAGGSKIHVKIQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHIPGNFVPKIPLAGGKNYEASRCWEDIFDAITNAKHLIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPK GGD T+GELLKKKASEGV+V++LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKQGGDVTVGELLKKKASEGVKVILLVWDDRTSVDVLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+V+C+LCPRNPDDG SI+QN++I TMFTHHQKIVVVD EMP G +  RRIVSF+GG+D
Sbjct  301   GTDVNCILCPRNPDDGGSIVQNLQISTMFTHHQKIVVVDSEMPSGGSRTRRIVSFVGGLD  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>gb|AAL48262.2|AF451980_1 phospholipase D2 [Papaver somniferum]
 gb|AAL48264.2|AF451982_1 phospholipase D2 [Papaver somniferum]
Length=813

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/381 (70%), Positives = 318/381 (83%), Gaps = 6/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1     MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61    DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDQV  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV +++ W RG+++A+FPGVPYTFF Q
Sbjct  121   LSGEEVDEWVEVVDEERNPVQGGCKIHVKLQYFDVGQDKNWARGIRSAKFPGVPYTFFTQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R GCKV+LYQDAHVP+NFIP+IPLAGG+ YEP RCWEDIFDAI+ AKH++YITGWSVYTE
Sbjct  181   RTGCKVSLYQDAHVPDNFIPKIPLAGGKIYEPARCWEDIFDAISNAKHMIYITGWSVYTE  240

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             + L+RD RR KPGGD TLGELLKKKA EGVRVLMLVWDDRTSVGLLKKDGLMATHDE+T 
Sbjct  241   VVLIRDSRRQKPGGDITLGELLKKKADEGVRVLMLVWDDRTSVGLLKKDGLMATHDEDTF  300

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+ T+V+CVLCPRNPDDG S IQ+++I TMFTHHQKIVV D  MP   +E+RRIVSF+
Sbjct  301   NYFQGTQVNCVLCPRNPDDGGSFIQDLQISTMFTHHQKIVVTDSAMPSAGSEQRRIVSFV  360

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ FH LFRTL
Sbjct  361   GGIDLCDGRYDTQFHSLFRTL  381



>emb|CDM81985.1| unnamed protein product [Triticum aestivum]
Length=812

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/381 (68%), Positives = 310/381 (81%), Gaps = 7/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1     MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61    EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVAEL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEE+D WL + D+ R P+   SKIHVKLQ+  V ++R W RGV++ +FPGVPYTFF Q
Sbjct  121   LEGEEIDRWLEICDDKREPV-GESKIHVKLQYFGVDKDRNWARGVRSVKFPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GC V LYQDAHVP+NFIP+IPLA G+ YEP RCWEDIFDAI+ A+HL+YITGWSV+TE
Sbjct  180   RQGCNVRLYQDAHVPDNFIPKIPLADGKNYEPARCWEDIFDAISNAQHLIYITGWSVHTE  239

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITL+RD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET 
Sbjct  240   ITLIRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETA  299

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIV VD  +P   +E+RRI+SF+
Sbjct  300   NYFQGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVCVDDALPSQGSEQRRILSFV  359

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  360   GGIDLCDGRYDTQYHSLFRTL  380



>gb|AAL48261.2|AF451979_1 phospholipase D1 [Papaver somniferum]
 gb|AAL48263.2|AF451981_1 phospholipase D1 [Papaver somniferum]
Length=813

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/381 (70%), Positives = 318/381 (83%), Gaps = 6/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1     MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61    DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDKV  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV +++ W RG+++A+FPGVPYTFF Q
Sbjct  121   LSGEEVDEWVEVVDQERNPVQGGCKIHVKLQYFDVGQDKNWARGIRSAKFPGVPYTFFTQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R GCKV+LYQDAHVP+NFIP+IPLAGG+ YEP RCWEDIFDAI+ AKH++YITGWSVYTE
Sbjct  181   RTGCKVSLYQDAHVPDNFIPKIPLAGGKIYEPARCWEDIFDAISNAKHMIYITGWSVYTE  240

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             + L+RD RR KPGGD TLGELLKKKA EGVRVLMLVWDDRTSVGLLKKDGLMATHDE+T 
Sbjct  241   VVLIRDSRRQKPGGDITLGELLKKKADEGVRVLMLVWDDRTSVGLLKKDGLMATHDEDTF  300

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF+ T+V+CVLCPRNPDDG S IQ+++I TMFTHHQKIVV D  MP   +++RRIVSF+
Sbjct  301   NYFQGTQVNCVLCPRNPDDGGSFIQDLQISTMFTHHQKIVVTDSAMPSEGSQQRRIVSFV  360

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ FH LFRTL
Sbjct  361   GGIDLCDGRYDTQFHSLFRTL  381



>ref|XP_002443625.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
 gb|EES17463.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
Length=813

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/384 (68%), Positives = 316/384 (82%), Gaps = 9/384 (2%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYAT  344
             ++EM+  LLHG+LH  ++E   +      +        K+VEG E  VG  K ++++YAT
Sbjct  1     MAEMS--LLHGTLHATIFEAASLSNPQRASGRAPKFIRKLVEGIEESVGVGKGSTKIYAT  58

Query  345   IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  521
             IDLEK RVGRTR++ +E  NPRWYESFHIYCAH A+NV+F+VK+DNPIGA LIGRAYMP 
Sbjct  59    IDLEKTRVGRTRIISNEPVNPRWYESFHIYCAHRAANVIFTVKIDNPIGASLIGRAYMPV  118

Query  522   RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
               +L GEE+D+WL + D+ R PI  HSKIHVK+Q+ DV ++  W RGV++ ++PGVPYTF
Sbjct  119   ADILVGEEIDKWLEICDDKREPI-GHSKIHVKIQYFDVSKDCNWARGVQSKKYPGVPYTF  177

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR+GCKVTLYQDAHVP+NF+PRIPLA G+ YEPQRCWEDIFDAI+KA+HL+YITGWSV
Sbjct  178   FSQRQGCKVTLYQDAHVPDNFVPRIPLADGKNYEPQRCWEDIFDAISKAQHLIYITGWSV  237

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
             YTEITLVRD  RPKPGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDG MATHDE
Sbjct  238   YTEITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGHMATHDE  297

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIV  1241
             ET NYF  T+V+CVLC RNPDD  S++Q+++I TMFTHHQKIVVVD E+P+  ++RRRIV
Sbjct  298   ETANYFHGTDVNCVLCGRNPDDSGSLVQDLQISTMFTHHQKIVVVDHELPNHGSQRRRIV  357

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SFIGGIDLCDGRYD+ +H LFRTL
Sbjct  358   SFIGGIDLCDGRYDTQYHSLFRTL  381



>tpg|DAA53246.1| TPA: phospholipase D family protein [Zea mays]
Length=655

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/348 (73%), Positives = 302/348 (87%), Gaps = 2/348 (1%)
 Frame = +3

Query  273   FHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMAS  449
             F ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA+
Sbjct  5     FRQLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAA  64

Query  450   NVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFL  629
             +V+F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ 
Sbjct  65    DVIFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYF  123

Query  630   DVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQ  809
             DV ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDAHVP+NF+PRI LA G+ YEP 
Sbjct  124   DVGKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVPDNFVPRIQLADGKNYEPH  183

Query  810   RCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVL  989
             RCWEDIFDAI+KA+HL+YITGWSVYTEITLVRD  RPKPGGD TLGELLK+KASEGVRVL
Sbjct  184   RCWEDIFDAISKAQHLIYITGWSVYTEITLVRDTNRPKPGGDVTLGELLKRKASEGVRVL  243

Query  990   MLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMF  1169
             MLVWDDRTSVGLLKKDGLMATHDEET NYF  T+V+CVLCPRNPDD  S +Q+++I TMF
Sbjct  244   MLVWDDRTSVGLLKKDGLMATHDEETANYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMF  303

Query  1170  THHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             THHQKIVVVD EMP+  +++RRIVSFIGGIDLCDGRYD+ +H LFRTL
Sbjct  304   THHQKIVVVDHEMPNQGSQQRRIVSFIGGIDLCDGRYDTQYHSLFRTL  351



>ref|XP_009787005.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Nicotiana 
sylvestris]
Length=790

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/346 (73%), Positives = 299/346 (86%), Gaps = 1/346 (0%)
 Frame = +3

Query  279   KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  455
             KI E  E  VG  K AS++YAT+DLEKARVGRTR++ +E  NPRW ESFHIYCAHMASNV
Sbjct  11    KIKETVEETVGVGKGASKMYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNV  70

Query  456   VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  635
             +F+VK +N IGA LIGRAY+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+
Sbjct  71    IFTVKDNNSIGATLIGRAYLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDI  130

Query  636   VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRC  815
              R+R WGRG+ + ++PGVPYTFFPQR GC+V+LYQDAH+P+ FIP+IPL+G ++YEP RC
Sbjct  131   SRDRNWGRGIGSPKYPGVPYTFFPQRSGCRVSLYQDAHIPDKFIPKIPLSGSKYYEPHRC  190

Query  816   WEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLML  995
             WED+FDAIT AKHL+YITGWSVYTEITL+RD RR KPGGD TLGELLKKKAS+GV+VLML
Sbjct  191   WEDVFDAITNAKHLIYITGWSVYTEITLLRDSRRQKPGGDITLGELLKKKASDGVKVLML  250

Query  996   VWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTH  1175
             VWDDRTSV LLKKDGLMATHDEET  +FKDT+VHCVLCPR+PDDG SI+++++I TMFTH
Sbjct  251   VWDDRTSVRLLKKDGLMATHDEETEEFFKDTDVHCVLCPRDPDDGGSIVKDLQISTMFTH  310

Query  1176  HQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             HQKIV+VD +MP G+++ RRIVSF+GGIDLCDGRYD+PFH LFRTL
Sbjct  311   HQKIVIVDSDMPSGESDMRRIVSFVGGIDLCDGRYDTPFHSLFRTL  356



>ref|XP_009123823.1| PREDICTED: phospholipase D alpha 2-like [Brassica rapa]
Length=812

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/380 (67%), Positives = 308/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1     MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61    RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W RG+K+ +FPGVPYTFF QRRG
Sbjct  121   EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNRGIKSVKFPGVPYTFFSQRRG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQDAH+P NF+P+IPLAGG++YE  RCWEDIFDAIT AKHL+YITGWSVY EI+L
Sbjct  181   CKVSLYQDAHIPGNFVPKIPLAGGKYYEANRCWEDIFDAITNAKHLIYITGWSVYAEISL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPK GGD T+GE+LKKKASEGV+V++LVWDDRTSV LLK+DGLMATHDEET N+F
Sbjct  241   VRDSRRPKEGGDVTIGEILKKKASEGVKVILLVWDDRTSVDLLKQDGLMATHDEETENFF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGD--TERRRIVSFIG  1253
             + T+V+CVLCPRNPDDG SI+QN+++ TMFTHHQKIVVVD EMP G   T+ RRIVSFIG
Sbjct  301   QGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQKIVVVDSEMPGGSSRTKSRRIVSFIG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             G+DLCDGRYD+PFH LFRTL
Sbjct  361   GLDLCDGRYDTPFHSLFRTL  380



>ref|XP_006392903.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
 gb|ESQ30189.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
Length=813

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 312/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             M + +LHG LH  +YEVD++  +G  + F  +I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1     MEEFMLHGRLHATIYEVDRLHVEGGRSGFLGQILANVEETIGVGKGETQLYATIDLEKAR  60

Query  366   VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +  GE
Sbjct  61    VGRTRKITKEPKNPKWYESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYVPVEDIFHGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD W+ +LD +R PI+  SKIHVKLQ+  V ++R W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121   EVDRWVEILDTERKPINGGSKIHVKLQYFGVEKDRNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+PENF+PRIPLAGG+ YEP RCWEDI DAIT AKHL+YITGWSVYTEI+LV
Sbjct  181   KVSLYQDAHIPENFVPRIPLAGGKNYEPNRCWEDILDAITNAKHLIYITGWSVYTEISLV  240

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPK GGD T+GE+LKKKASEGV+V++LVWDDRTSV LLKKDGLMATHDEET N+F+
Sbjct  241   RDSRRPKHGGDVTIGEILKKKASEGVKVILLVWDDRTSVDLLKKDGLMATHDEETENFFR  300

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP---DGDTERRRIVSFIG  1253
              T+V+CVLCPRNPDDG SIIQN+++ TMFTHHQKIVVVD EMP      +  RRIVSF+G
Sbjct  301   GTDVNCVLCPRNPDDGGSIIQNLQVSTMFTHHQKIVVVDSEMPSSGGSRSRSRRIVSFVG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             G+DLCDGRYD+PFH LFRTL
Sbjct  361   GLDLCDGRYDTPFHSLFRTL  380



>gb|EYU24646.1| hypothetical protein MIMGU_mgv1a001477mg [Erythranthe guttata]
Length=812

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/377 (68%), Positives = 306/377 (81%), Gaps = 2/377 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG+LH  + EVDK+      N F K++E     VG  K   ++YAT+DLEK+RV
Sbjct  1     MAHILLHGTLHATICEVDKLHGGADGNFFGKLMENIGETVGIGKGTPKIYATVDLEKSRV  60

Query  369   GRTRLLDEHKN-PRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTRL++   N PRWYESFHIYCAHMAS+V+F+VK  NPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRLIENEPNSPRWYESFHIYCAHMASSVIFTVKDANPIGATLIGRAYVPVHDLLDGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             +D W+ +LD ++NP+   SKI VKLQF DV R+R W  G+K+ + PGVPYTFF QRRGC+
Sbjct  121   IDRWVEILDENKNPVPEGSKIRVKLQFFDVTRDRNWAHGIKSPKNPGVPYTFFAQRRGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V+L+QDAHVP+ FIP+IPL+GG++YEP RCWED+FDAI  AKHL+YITGWSVYTEI L+R
Sbjct  181   VSLFQDAHVPDKFIPKIPLSGGKYYEPHRCWEDVFDAIMNAKHLIYITGWSVYTEIALIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RR K GGD TLGE+LKKKA EGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  +F+ 
Sbjct  241   DSRRQKAGGDVTLGEILKKKADEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEQFFQG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGGID  1262
             T V+CVLCPRNPDDG S +QN++I TMFTHHQKI++VD EMP +G   RRRIVSF+GG+D
Sbjct  301   TNVNCVLCPRNPDDGGSFVQNLQISTMFTHHQKIIIVDSEMPQEGFGRRRRIVSFVGGLD  360

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PFH LFRTL
Sbjct  361   LCDGRYDTPFHSLFRTL  377



>sp|O04883.1|PLDA1_PIMBR RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Spuriopimpinella brachycarpa]
 gb|AAB70463.1| phospholipase D [Spuriopimpinella brachycarpa]
Length=808

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/376 (66%), Positives = 304/376 (81%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA+ LLHG+LHV ++EVD +K   +      +     + +   K   ++YA+IDL+KARV
Sbjct  1     MAKTLLHGTLHVTIFEVDHLKAGSVVVFSESLRRTLRKPLVLAKGTPKIYASIDLDKARV  60

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR+++ E  NP+W ESFHIYC H ++NV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61    GRTRMIENEPNNPKWNESFHIYCGHPSTNVIFTVKDDNPIGATLIGRAYLPVHELLEGEE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+W+ +LD D+NPI   SKIHVKLQ+ D+ ++R W  G+++++FPGVPYTFF QR GC+
Sbjct  121   VDKWVEILDEDKNPISEGSKIHVKLQYFDITQDRNWAHGIRSSKFPGVPYTFFSQRPGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             ++LYQDAHVP+NF+P+IPL+GG+FYEP RCWED+FDAIT AKH +YITGWSVYTE  L+R
Sbjct  181   ISLYQDAHVPDNFVPKIPLSGGKFYEPHRCWEDVFDAITNAKHFIYITGWSVYTEFALIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPKPGGD  LGELLKKKA EGVRVLMLVWDDRTSVGLLKKDGLMATHD+ET  YF+D
Sbjct  241   DTRRPKPGGDIMLGELLKKKADEGVRVLMLVWDDRTSVGLLKKDGLMATHDQETEEYFRD  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             + VHCVLC RNPDDG  IIQ + I T+FTHHQKIVVVD EMP   +E RR+VSF+GGIDL
Sbjct  301   SNVHCVLCLRNPDDGGGIIQGLTISTIFTHHQKIVVVDSEMPTSGSENRRVVSFVGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+PFH LFRTL
Sbjct  361   CDGRYDTPFHSLFRTL  376



>ref|NP_001267764.1| phospholipase D alpha 1-like [Setaria italica]
 gb|ADK60917.1| phospholipase D alpha 1 [Setaria italica]
Length=811

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 313/381 (82%), Gaps = 8/381 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MAQ+LLHG+LH  ++E  ++      + G      K+VEG E  VG  K  +++YATIDL
Sbjct  1     MAQILLHGTLHATIFEAQELSNPHRASGGAPKFIRKLVEGIEDTVGVGKGTTKIYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             EK RVGRTR++ +E  NPRWYESFHIYCAH+A++V+F+VK+DNPIGA LIGRA++P + L
Sbjct  61    EKTRVGRTRMISNEPANPRWYESFHIYCAHLAADVIFTVKIDNPIGATLIGRAHLPVQDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             L G+E+D+WL + D    PI   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121   LDGKEIDKWLEICDEGGEPIGG-SKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAHVP+NFIP+IPLA G  YEP RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  180   RQGCKVTLYQDAHVPDNFIPKIPLADGN-YEPHRCWEDIFDAISNAQHLIYITGWSVYTE  238

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITLVRD  RP+PGGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET 
Sbjct  239   ITLVRDTNRPEPGGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETA  298

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
             NYF  ++V+CVLCPRNPDD  S +Q+++I  MFTHHQKIVVVD EMP+  +++RRIVSF+
Sbjct  299   NYFHGSDVNCVLCPRNPDDSGSFVQDLQIAAMFTHHQKIVVVDHEMPNQGSQQRRIVSFV  358

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+ +H LFRTL
Sbjct  359   GGIDLCDGRYDTQYHSLFRTL  379



>emb|CDY47540.1| BnaC03g69220D [Brassica napus]
Length=812

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/380 (67%), Positives = 307/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1     MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61    RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W RG+K+ +FPGVPYTFF QRRG
Sbjct  121   EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNRGIKSVKFPGVPYTFFSQRRG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVY EI+L
Sbjct  181   CKVSLYQDAHIPGNFVPKIPLAGGKHYEASRCWEDIFDAITNAKHLIYITGWSVYGEISL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPK GGD T+GE+LKKKASEGV+V++LVWDDRTSV LLK+DGLMATHDEET N+F
Sbjct  241   VRDSRRPKEGGDLTIGEILKKKASEGVKVILLVWDDRTSVDLLKQDGLMATHDEETENFF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGD--TERRRIVSFIG  1253
             + T+V+CVLCPRNPDDG SI+QN+++ TMFTHHQKIVVVD EMP G   T+ RRIVSFIG
Sbjct  301   QGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQKIVVVDSEMPGGSSRTKSRRIVSFIG  360

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             G+DLCDGRYD+PFH LFRTL
Sbjct  361   GLDLCDGRYDTPFHSLFRTL  380



>ref|XP_008673447.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Zea mays]
Length=810

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/346 (73%), Positives = 301/346 (87%), Gaps = 2/346 (1%)
 Frame = +3

Query  279   KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  455
             ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34    QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  456   VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  635
             +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94    IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  636   VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRC  815
              ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDAHVP+NF+PRI LA G+ YEP RC
Sbjct  153   GKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVPDNFVPRIQLADGKNYEPHRC  212

Query  816   WEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLML  995
             WEDIFDAI+KA+HL+YITGWSVYTEITLVRD  RPKPGGD TLGELLK+KASEGVRVLML
Sbjct  213   WEDIFDAISKAQHLIYITGWSVYTEITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLML  272

Query  996   VWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTH  1175
             VWDDRTSVGLLKKDGLMATHDEET NYF  T+V+CVLCPRNPDD  S +Q+++I TMFTH
Sbjct  273   VWDDRTSVGLLKKDGLMATHDEETANYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTH  332

Query  1176  HQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             HQKIVVVD EMP+  +++RRIVSFIGGIDLCDGRYD+ +H LFRTL
Sbjct  333   HQKIVVVDHEMPNQGSQQRRIVSFIGGIDLCDGRYDTQYHSLFRTL  378



>gb|KJB70612.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70613.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70615.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=795

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/346 (72%), Positives = 295/346 (85%), Gaps = 1/346 (0%)
 Frame = +3

Query  279   KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  455
             ++V   +  +G  K   ++YATIDLE+ARVGRTR + +E  NPRW+ESFHIYCAH ASNV
Sbjct  18    QLVANVQETIGIGKGVPKIYATIDLERARVGRTRTIENETSNPRWFESFHIYCAHNASNV  77

Query  456   VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  635
             VF+VK DNPIGA LIGRAY+P + L  G+EVD W+ +LD D+NPI S  KIHVKLQ+  V
Sbjct  78    VFTVKDDNPIGATLIGRAYVPVKDLTEGDEVDRWVEILDEDKNPIKSGGKIHVKLQYFGV  137

Query  636   VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRC  815
              ++R W RG+ + +FPGVPYTF+PQR+GCKV+LYQDAH+P+ F+P+IPLAGG+ YEP RC
Sbjct  138   TKDRNWDRGIVSRKFPGVPYTFYPQRKGCKVSLYQDAHIPDGFVPKIPLAGGKNYEPHRC  197

Query  816   WEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLML  995
             WEDIFDAIT AKH++YITGWSVYTEI+LVRD RRPKPGGD T+GELLKKKASEGVRV ML
Sbjct  198   WEDIFDAITNAKHMIYITGWSVYTEISLVRDSRRPKPGGDITIGELLKKKASEGVRVNML  257

Query  996   VWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTH  1175
             VWDDRTSVGLLKKDGLMATHDEET  +FKDT+V+CVLCPRNPDDG S +Q ++I TMFTH
Sbjct  258   VWDDRTSVGLLKKDGLMATHDEETEQFFKDTDVNCVLCPRNPDDGGSFVQELQISTMFTH  317

Query  1176  HQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             HQKIVVVD  MP+GD E+RRIVSF+GGIDLCDGRYD+PFH LFRTL
Sbjct  318   HQKIVVVDAAMPNGDPEKRRIVSFVGGIDLCDGRYDTPFHSLFRTL  363



>ref|XP_008242775.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=807

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/377 (69%), Positives = 308/377 (82%), Gaps = 6/377 (2%)
 Frame = +3

Query  189   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ +LLHG LH  +YEVD++   G    F K+++   + V F K  S+LYATIDLE AR
Sbjct  1     MAQTVLLHGVLHTTIYEVDRLMASGCSIFFCKLLK---KSVEFGK-GSKLYATIDLENAR  56

Query  366   VGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTRLL+   KNPRW ESFHIYCAH ASNVVFS+K DN IGA +IGRAYMPA  LL GE
Sbjct  57    VGRTRLLENATKNPRWRESFHIYCAHKASNVVFSIKEDNAIGATVIGRAYMPAAELLNGE  116

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD WL +LDN+  P+H  SKIHVKL+   V  +  W RG+++  FPGVPYTFF QR GC
Sbjct  117   EVDRWLKILDNNNKPLHGGSKIHVKLRLSSVNEDPNWSRGIRSPEFPGVPYTFFTQRNGC  176

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +VTLYQDAHVP+NFIP+IPLAG + YE  RCWED+FDAI+ AKHL+YI GWSV T ITL+
Sbjct  177   RVTLYQDAHVPDNFIPKIPLAGAKCYESHRCWEDVFDAISNAKHLIYIAGWSVCTSITLI  236

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD +R KPGGD TLGELLKKKA+EGV+VLMLVWDDRTSV LLK+DG+MATHDE+T +YF 
Sbjct  237   RDLKRQKPGGDLTLGELLKKKANEGVQVLMLVWDDRTSVRLLKRDGVMATHDEDTESYFH  296

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+VHCVLCPRNPD+G+SIIQ++E+ TMFTHHQKIVVVDGE+P+G  E+RRIVSFIGGID
Sbjct  297   HTKVHCVLCPRNPDNGQSIIQDLEVSTMFTHHQKIVVVDGELPNGGLEKRRIVSFIGGID  356

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+P HP+FRTL
Sbjct  357   LCDGRYDTPSHPIFRTL  373



>ref|XP_007204652.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
 gb|EMJ05851.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
Length=807

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/377 (69%), Positives = 308/377 (82%), Gaps = 6/377 (2%)
 Frame = +3

Query  189   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ +LLHG LH  +YEVD++  DG    F K+++   + V F K  S+ YATIDLE AR
Sbjct  1     MAQTVLLHGVLHTTIYEVDRLMADGCCIFFCKLLK---KSVEFGK-GSKFYATIDLENAR  56

Query  366   VGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTRLL+   +NPRW ESFHIYCAH ASNVVFS+K DN IGA++IGRAYMPA  LL GE
Sbjct  57    VGRTRLLENATQNPRWRESFHIYCAHKASNVVFSIKEDNAIGAKVIGRAYMPAAELLNGE  116

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD WL +LDN+  P+H  SKIHVKL F  V  +  W RG+++  FPGVPYTFF QR GC
Sbjct  117   EVDRWLKILDNNNKPLHGGSKIHVKLCFSSVNEDPNWSRGIRSPEFPGVPYTFFTQRNGC  176

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +VTLYQDAHVP+NFIP+IPLAG + YEP RCWED+FDAI+ AKHL+YI GWSV T ITL 
Sbjct  177   RVTLYQDAHVPDNFIPKIPLAGAKCYEPHRCWEDVFDAISNAKHLIYIAGWSVCTSITLK  236

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RDP+R KPG D TLGELLKKKA+EGV+VLMLVWDDRTSV LLK+DG+MATHDE+T +YF 
Sbjct  237   RDPKRQKPGEDLTLGELLKKKANEGVQVLMLVWDDRTSVRLLKRDGVMATHDEDTESYFH  296

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T+VHCVLCPRNPD+G+SIIQ++E+ TMFTHHQKIVVVD E+P+G  E+RRIVSFIGGID
Sbjct  297   HTKVHCVLCPRNPDNGQSIIQDLEVSTMFTHHQKIVVVDSELPNGGLEKRRIVSFIGGID  356

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+P HP+FRTL
Sbjct  357   LCDGRYDTPSHPIFRTL  373



>emb|CDY60551.1| BnaA05g35700D [Brassica napus]
Length=812

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/379 (66%), Positives = 308/379 (81%), Gaps = 4/379 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTD--GLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1     MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61    RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  121   EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+L
Sbjct  181   CKVSLYQDAHIPGNFVPKIPLAGGKHYEAGRCWEDIFDAITNAKHLIYITGWSVYTEISL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPK GGD T+GE+LKKKASEGV+V++LVWDDRTSV LLK+DGLMATHDEET N+F
Sbjct  241   VRDSRRPKEGGDVTIGEILKKKASEGVKVILLVWDDRTSVDLLKQDGLMATHDEETANFF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGG  1256
             + T+V+CVLCPRNPDDG SI+QN+++ TMFTHHQKIVVVD EMP    T+ RRIVSF+GG
Sbjct  301   RGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQKIVVVDSEMPGTARTKSRRIVSFVGG  360

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH LFRTL
Sbjct  361   LDLCDGRYDTPFHSLFRTL  379



>ref|XP_009144830.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/379 (66%), Positives = 308/379 (81%), Gaps = 4/379 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTD--GLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1     MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61    RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  121   EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+L
Sbjct  181   CKVSLYQDAHIPGNFVPKIPLAGGKHYEAGRCWEDIFDAITNAKHLIYITGWSVYTEISL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPK GGD T+GE+LKKKASEGV+V++LVWDDRTSV LLK+DGLMATHDEET N+F
Sbjct  241   VRDSRRPKEGGDVTIGEILKKKASEGVKVILLVWDDRTSVDLLKQDGLMATHDEETANFF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIVSFIGG  1256
             + T+V+CVLCPRNPDDG SI+QN+++ TMFTHHQKIVVVD EMP    T+ RRIVSF+GG
Sbjct  301   RGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQKIVVVDSEMPGTARTKSRRIVSFVGG  360

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             +DLCDGRYD+PFH LFRTL
Sbjct  361   LDLCDGRYDTPFHSLFRTL  379



>ref|XP_002325225.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
 gb|EEF03790.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
Length=808

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/376 (67%), Positives = 304/376 (81%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M  +LLHG+LHV +YE  ++   G      KI+E  ++ VGF K   +LYA I LE+ RV
Sbjct  1     MEPVLLHGTLHVTIYEACRVFGSGCSKFCCKILENIDKTVGFGKGFCKLYAGIYLEETRV  60

Query  369   GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNPI A +IG+AY+P   LL G+E
Sbjct  61    GRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNPIEAVVIGKAYLPVAELLDGKE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             V++WL +L  +  P+H  SKIHVK+QF D  +   W RG+ + +FPGVPYTFF QR GC+
Sbjct  121   VEKWLNILHKNHRPLHKGSKIHVKVQFFDATKRHYWSRGIGSPKFPGVPYTFFSQRSGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAHVP+ F+P+IPLAGG+ +E  RCWEDIFDAI  AKHL+YITGWSV+T+ITLVR
Sbjct  181   VTLYQDAHVPDKFVPKIPLAGGKRHEQHRCWEDIFDAIFNAKHLIYITGWSVFTKITLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             DP R KPGGD  LGELLKKKA+EGVRVLMLVWDDRTSV LLKKDGLMATHDE+TG+YF +
Sbjct  241   DPTRQKPGGDMILGELLKKKANEGVRVLMLVWDDRTSVKLLKKDGLMATHDEDTGSYFHN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T+VHCVLCPRNPD+G+SIIQ IEI TMFTHHQK +VVD E+P G+  +RRIVSFIGGIDL
Sbjct  301   TKVHCVLCPRNPDNGQSIIQGIEISTMFTHHQKTLVVDSELPGGELPKRRIVSFIGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+P HP+FRTL
Sbjct  361   CDGRYDTPSHPIFRTL  376



>ref|XP_011017763.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011017764.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=831

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/397 (64%), Positives = 311/397 (78%), Gaps = 1/397 (0%)
 Frame = +3

Query  126   ISDLPVLCFILSASS*PPLSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERV  305
             IS L  +    S SS      M  +L+HG+LHV +YE  ++   G      KI+E  ++ 
Sbjct  3     ISALSGIIHTRSRSSTYVTRTMEPVLIHGTLHVTIYEACRVFGSGCSKFCCKILENIDKN  62

Query  306   VGFNKTASRLYATIDLEKARVGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNP  482
             VGF K   +LYA I LE+ARVGRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNP
Sbjct  63    VGFGKGFCKLYAGIYLEEARVGRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNP  122

Query  483   IGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRG  662
             I A +IG+AY+P   LL G+EVD+WL +L  +  P H  SKIHVK+QF D  +   W +G
Sbjct  123   IEAVVIGKAYLPVAELLDGKEVDKWLDILHKNHRPPHKGSKIHVKVQFFDATKRHYWSKG  182

Query  663   VKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAIT  842
             + + +FPGVPYTFF QR GC+VTLYQDAHVP+ F+P+IPLAGG+ +E  RCWEDIFDAI 
Sbjct  183   IGSPKFPGVPYTFFSQRSGCRVTLYQDAHVPDKFVPKIPLAGGKLHEQHRCWEDIFDAIF  242

Query  843   KAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVG  1022
              AKHL+YITGWSV+T+ITLVRDP R KPGGD  LGELLKKKA+EGVRVLMLVWDDRTSV 
Sbjct  243   NAKHLIYITGWSVFTKITLVRDPTRQKPGGDMILGELLKKKANEGVRVLMLVWDDRTSVK  302

Query  1023  LLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDG  1202
             LLK+DGLMATHDE+TG+YF +T+VHCVLCPR+PDDG+SI+Q IEI TMFTHHQK +VVD 
Sbjct  303   LLKRDGLMATHDEDTGSYFHNTKVHCVLCPRSPDDGQSIVQGIEISTMFTHHQKTLVVDS  362

Query  1203  EMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             E+P G+  +RRIVSFIGGIDLCDGRYD+P HP+FRTL
Sbjct  363   ELPGGELPKRRIVSFIGGIDLCDGRYDTPSHPIFRTL  399



>ref|XP_009787006.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Nicotiana 
sylvestris]
Length=762

 Score =   535 bits (1379),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 289/328 (88%), Gaps = 1/328 (0%)
 Frame = +3

Query  333   LYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  509
             +YAT+DLEKARVGRTR++ +E  NPRW ESFHIYCAHMASNV+F+VK +N IGA LIGRA
Sbjct  1     MYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNVIFTVKDNNSIGATLIGRA  60

Query  510   YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  689
             Y+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+ R+R WGRG+ + ++PGV
Sbjct  61    YLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDISRDRNWGRGIGSPKYPGV  120

Query  690   PYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYIT  869
             PYTFFPQR GC+V+LYQDAH+P+ FIP+IPL+G ++YEP RCWED+FDAIT AKHL+YIT
Sbjct  121   PYTFFPQRSGCRVSLYQDAHIPDKFIPKIPLSGSKYYEPHRCWEDVFDAITNAKHLIYIT  180

Query  870   GWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMA  1049
             GWSVYTEITL+RD RR KPGGD TLGELLKKKAS+GV+VLMLVWDDRTSV LLKKDGLMA
Sbjct  181   GWSVYTEITLLRDSRRQKPGGDITLGELLKKKASDGVKVLMLVWDDRTSVRLLKKDGLMA  240

Query  1050  THDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER  1229
             THDEET  +FKDT+VHCVLCPR+PDDG SI+++++I TMFTHHQKIV+VD +MP G+++ 
Sbjct  241   THDEETEEFFKDTDVHCVLCPRDPDDGGSIVKDLQISTMFTHHQKIVIVDSDMPSGESDM  300

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RRIVSF+GGIDLCDGRYD+PFH LFRTL
Sbjct  301   RRIVSFVGGIDLCDGRYDTPFHSLFRTL  328



>gb|KDO48581.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=610

 Score =   528 bits (1360),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 237/311 (76%), Positives = 275/311 (88%), Gaps = 0/311 (0%)
 Frame = +3

Query  381   LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  560
             L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2     LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  561   PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQ  740
              +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCKV+LYQ
Sbjct  62    EILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCKVSLYQ  121

Query  741   DAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRP  920
             DAHVP+NF+P IPLAGG++YEP RCWEDIFDAIT A+H++YITGWSVYTEI+LVRD RRP
Sbjct  122   DAHVPDNFVPEIPLAGGKYYEPHRCWEDIFDAITNARHMIYITGWSVYTEISLVRDSRRP  181

Query  921   KPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHC  1100
             KPGGD  LGELLKKKASEGVRV MLVWDDRTSV LLKKDGLMATHDEET  +F+ T+VHC
Sbjct  182   KPGGDIMLGELLKKKASEGVRVCMLVWDDRTSVSLLKKDGLMATHDEETEKFFQGTDVHC  241

Query  1101  VLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRY  1280
             +LCPRNPDDG S IQ+I+I  MFTHHQKIVVVD  MP+GD ERRRI+SF+GGIDLCDGRY
Sbjct  242   ILCPRNPDDGGSFIQDIQISAMFTHHQKIVVVDSPMPNGDPERRRIMSFVGGIDLCDGRY  301

Query  1281  DSPFHPLFRTL  1313
             D+PFH LFRTL
Sbjct  302   DTPFHSLFRTL  312



>ref|XP_006654096.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=818

 Score =   531 bits (1369),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 254/385 (66%), Positives = 306/385 (79%), Gaps = 11/385 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHG+LHV V+E D +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1     MAKILLHGTLHVTVFEADGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             +KARVGRTR L D+   PRWYESFH+YCAH+AS+V+F++K  NPIG+ L+G AY+P R +
Sbjct  61    DKARVGRTRTLADDTAAPRWYESFHVYCAHLASDVLFTLKAKNPIGSSLLGVAYLPVRDI  120

Query  531   LGGEEVDEWLPLLDN---DRNPI-HSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYT  698
               G EV+ WLPL D+   +R P+    SK+HVKLQ+ D+ ++R WGRGV++ ++PGVPYT
Sbjct  121   FAGAEVERWLPLCDDVDAERKPVGDGDSKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYT  180

Query  699   FFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWS  878
             FF QR+GCKVTLYQDAHVP+ FIPRIP +GGR YEP RCWEDIFDAI  A+HL+YITGWS
Sbjct  181   FFSQRQGCKVTLYQDAHVPDGFIPRIPFSGGRCYEPHRCWEDIFDAINGARHLIYITGWS  240

Query  879   VYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHD  1058
             VYTEI L+RD  RPKPGG  TLGELLKKKA EGVRVLMLVWDDRTSVG+LKKDGLMATHD
Sbjct  241   VYTEIALLRDADRPKPGGGVTLGELLKKKAGEGVRVLMLVWDDRTSVGVLKKDGLMATHD  300

Query  1059  EETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRI  1238
             EET NYF+ TEV+CVLCPR+PDD  SI+Q+++I TMFTHHQKIVVVD +MP     RRRI
Sbjct  301   EETMNYFQGTEVNCVLCPRDPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPR-QGGRRRI  359

Query  1239  VSFIGGIDLCDGRYDSPFHPLFRTL  1313
             VSF+GG+DLCDGRYD+P H LFRTL
Sbjct  360   VSFVGGLDLCDGRYDTPCHSLFRTL  384



>gb|KDO48580.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=744

 Score =   529 bits (1362),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 237/311 (76%), Positives = 275/311 (88%), Gaps = 0/311 (0%)
 Frame = +3

Query  381   LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  560
             L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2     LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  561   PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQ  740
              +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCKV+LYQ
Sbjct  62    EILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCKVSLYQ  121

Query  741   DAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRP  920
             DAHVP+NF+P IPLAGG++YEP RCWEDIFDAIT A+H++YITGWSVYTEI+LVRD RRP
Sbjct  122   DAHVPDNFVPEIPLAGGKYYEPHRCWEDIFDAITNARHMIYITGWSVYTEISLVRDSRRP  181

Query  921   KPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHC  1100
             KPGGD  LGELLKKKASEGVRV MLVWDDRTSV LLKKDGLMATHDEET  +F+ T+VHC
Sbjct  182   KPGGDIMLGELLKKKASEGVRVCMLVWDDRTSVSLLKKDGLMATHDEETEKFFQGTDVHC  241

Query  1101  VLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRY  1280
             +LCPRNPDDG S IQ+I+I  MFTHHQKIVVVD  MP+GD ERRRI+SF+GGIDLCDGRY
Sbjct  242   ILCPRNPDDGGSFIQDIQISAMFTHHQKIVVVDSPMPNGDPERRRIMSFVGGIDLCDGRY  301

Query  1281  DSPFHPLFRTL  1313
             D+PFH LFRTL
Sbjct  302   DTPFHSLFRTL  312



>ref|NP_001054773.2| Os05g0171000 [Oryza sativa Japonica Group]
 dbj|BAF16687.2| Os05g0171000 [Oryza sativa Japonica Group]
Length=686

 Score =   526 bits (1354),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 253/390 (65%), Positives = 304/390 (78%), Gaps = 15/390 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1     MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61    DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  531   LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
             L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++R WGRGV++ ++PGVPYTF
Sbjct  121   LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYTF  180

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR+GCKVTLYQDAHVP+ FIPRIPL GGR YEP RCWEDIFDAI  A+H +YITGWSV
Sbjct  181   FSQRQGCKVTLYQDAHVPDGFIPRIPLDGGRSYEPHRCWEDIFDAINGARHFIYITGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
             YTEI L+RD  RPKPGG  TLGELLKKKA EGVRVLMLVWDDRTSVG+LKKDGLMATHDE
Sbjct  241   YTEIALIRDADRPKPGGGVTLGELLKKKAGEGVRVLMLVWDDRTSVGMLKKDGLMATHDE  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDG------DT  1223
             ET NYF+ TEV+CVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD +MP          
Sbjct  301   ETMNYFQGTEVNCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPSSRHGGGNGG  360

Query  1224  ERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              RRR+VSF+GG+DLCDGRYD+PFH LFRTL
Sbjct  361   GRRRVVSFVGGLDLCDGRYDTPFHSLFRTL  390



>ref|XP_002440692.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
 gb|EES19122.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
Length=700

 Score =   524 bits (1350),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 251/388 (65%), Positives = 305/388 (79%), Gaps = 13/388 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHGSLHV ++E +++   G           K+VE  E  VG  K  S++YATI L
Sbjct  1     MARILLHGSLHVTIFEAEELSNSGRPSSQAPGFLRKLVETVEDTVGVGKGTSKIYATIGL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              KARVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61    GKARVGRTRTLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  531   LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  695
               G EVD WL L D      +R P+ +  K+HVKLQ+ D+ ++R WGRGV++ ++PGVPY
Sbjct  121   FDGHEVDRWLHLCDGGGDDKNRTPLETGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPY  180

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF QR+GC+VTLYQDAHVP+ F+PRIPL GGR YE  RCWEDIFDAI+ AKHL+YITGW
Sbjct  181   TFFSQRQGCRVTLYQDAHVPDGFVPRIPLDGGRCYEAHRCWEDIFDAISGAKHLIYITGW  240

Query  876   SVYTEITLVRDPRRP-KPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             SVYTEITL+RD  RP +PGG  TLGELLKKKA EGVRVLMLVWDDRTSVG+LKKDGL AT
Sbjct  241   SVYTEITLLRDGARPARPGGGVTLGELLKKKAGEGVRVLMLVWDDRTSVGVLKKDGLKAT  300

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTER  1229
             HDEET NYF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD +MP    + +
Sbjct  301   HDEETMNYFQGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPVRRSSSQ  360

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RRI+SF+GG+DLCDGRYD+P HPLFRTL
Sbjct  361   RRILSFVGGLDLCDGRYDTPCHPLFRTL  388



>gb|AFW76092.1| phospholipase D family protein [Zea mays]
Length=529

 Score =   518 bits (1334),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 302/388 (78%), Gaps = 13/388 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  1     MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  354   EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61    GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  531   LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  695
               G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  121   FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  180

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF QR+GC+VTLYQDAHVP+ F+PRIPL GGR YE  RCWEDIFDAI+ AKHL+YITGW
Sbjct  181   TFFSQRQGCRVTLYQDAHVPDGFVPRIPLDGGRCYEAHRCWEDIFDAISGAKHLIYITGW  240

Query  876   SVYTEITLVRD-PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             SVYTEITL+RD  R P+PG   TLGELLKKKA EGVRVLMLVWDDRTSVG LKKDGLMAT
Sbjct  241   SVYTEITLLRDGARPPRPGSGVTLGELLKKKAGEGVRVLMLVWDDRTSVGALKKDGLMAT  300

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER-  1229
             HDEET NYF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD +MP   ++R 
Sbjct  301   HDEETMNYFEGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPVQRSQRQ  360

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RRI+SF+GG+DLCDGRYD+P H LFRTL
Sbjct  361   RRILSFVGGLDLCDGRYDTPCHSLFRTL  388



>gb|KJB68102.1| hypothetical protein B456_010G225600 [Gossypium raimondii]
Length=805

 Score =   527 bits (1358),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 303/375 (81%), Gaps = 4/375 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA+  LHG+LHV +YEV+K++  G    F K++   E  +G  K + +LYATIDLEKARV
Sbjct  1     MARTSLHGNLHVTIYEVNKLEGGGF---FRKLMANVEESIGIGKGSGKLYATIDLEKARV  57

Query  369   GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  548
             GRTR + E  +P W ESFHIYCAHMA++V+F+VK    IGA +IGRAY+P   +L GEEV
Sbjct  58    GRTRKV-ESDDPSWNESFHIYCAHMANDVIFTVKQAGSIGANVIGRAYLPVEDILSGEEV  116

Query  549   DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  728
             D W+ L D ++  + + +KIHVK+++ DV ++R W RG+ + +FPGVPYT++PQR GCKV
Sbjct  117   DRWIELKDEEKQNLENEAKIHVKIRYFDVTKDRNWNRGIVSRKFPGVPYTYYPQRHGCKV  176

Query  729   TLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRD  908
              LYQD+H+P+ FIP+IPLAG ++YE  RCWEDIFDAIT AKHLVYI GWSVYTEI L+RD
Sbjct  177   FLYQDSHIPDGFIPKIPLAGSKYYEAHRCWEDIFDAITNAKHLVYIAGWSVYTEIKLIRD  236

Query  909   PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDT  1088
              +R K GGD  LG+LLKKKAS+GVRV +L+WDDRTSVG LKKDGLMATHDEET  +F+D+
Sbjct  237   SKRSKRGGDTKLGDLLKKKASQGVRVNVLIWDDRTSVGALKKDGLMATHDEETEKFFEDS  296

Query  1089  EVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLC  1268
             +V+CVLCPR+PDDG SI+Q ++I TMFTHHQKIVVVD  MP+GDT+R+RIVSFIGG+DLC
Sbjct  297   DVNCVLCPRDPDDGGSIVQELQISTMFTHHQKIVVVDAAMPNGDTDRKRIVSFIGGLDLC  356

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+PFH LFRTL
Sbjct  357   DGRYDTPFHSLFRTL  371



>gb|AAU44332.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY96710.1| hypothetical protein OsI_18631 [Oryza sativa Indica Group]
 dbj|BAH00843.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62492.1| hypothetical protein OsJ_17289 [Oryza sativa Japonica Group]
Length=824

 Score =   526 bits (1354),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 253/390 (65%), Positives = 304/390 (78%), Gaps = 15/390 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1     MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61    DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  531   LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
             L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++R WGRGV++ ++PGVPYTF
Sbjct  121   LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYTF  180

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR+GCKVTLYQDAHVP+ FIPRIPL GGR YEP RCWEDIFDAI  A+H +YITGWSV
Sbjct  181   FSQRQGCKVTLYQDAHVPDGFIPRIPLDGGRSYEPHRCWEDIFDAINGARHFIYITGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
             YTEI L+RD  RPKPGG  TLGELLKKKA EGVRVLMLVWDDRTSVG+LKKDGLMATHDE
Sbjct  241   YTEIALIRDADRPKPGGGVTLGELLKKKAGEGVRVLMLVWDDRTSVGMLKKDGLMATHDE  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDG------DT  1223
             ET NYF+ TEV+CVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD +MP          
Sbjct  301   ETMNYFQGTEVNCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPSSRHGGGNGG  360

Query  1224  ERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              RRR+VSF+GG+DLCDGRYD+PFH LFRTL
Sbjct  361   GRRRVVSFVGGLDLCDGRYDTPFHSLFRTL  390



>ref|XP_002282187.3| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
 ref|XP_010656427.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   525 bits (1352),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 259/387 (67%), Positives = 300/387 (78%), Gaps = 18/387 (5%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M Q+LLHG+LH  +YEVD++ + G  N   K+    ER       +S++Y TIDL+KARV
Sbjct  2     MEQILLHGTLHGTIYEVDRLSSGGPWNFIDKLKRRIERA-----GSSKVYVTIDLDKARV  56

Query  369   GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR L +E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA +P   LL GE 
Sbjct  57    GRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEGE-  115

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD WL L  +DR PIH  SK+HVKLQF DV RE  W RG+ + +FPGVPYTFFPQR+GC+
Sbjct  116   VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSRGITSPKFPGVPYTFFPQRKGCR  175

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V LYQDAH+P  FIP+IPL+GG++YEP RCWEDIF AI+ AK L+YITGWSVYT+ITLVR
Sbjct  176   VLLYQDAHIPNKFIPKIPLSGGKYYEPHRCWEDIFHAISNAKQLIYITGWSVYTKITLVR  235

Query  906   DPRRPKPGGDATLGEL-----------LKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
               R  KPG  ATLGEL           LKKKASEGVRVLMLVWDDRTSV LLKKDGLMAT
Sbjct  236   YSRGQKPGEHATLGELFNKKTSTLGELLKKKASEGVRVLMLVWDDRTSVKLLKKDGLMAT  295

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERR  1232
             HDE+TG YF  +EVHCVLCPR+PD+G SI+Q+IEI TMFTHHQKIVVVD EMP+  +ERR
Sbjct  296   HDEDTGKYFHGSEVHCVLCPRDPDNGLSIVQDIEISTMFTHHQKIVVVDSEMPNRGSERR  355

Query  1233  RIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RIVSFIGGIDLCDGRYD+P H +FRTL
Sbjct  356   RIVSFIGGIDLCDGRYDTPTHTIFRTL  382



>ref|XP_008650412.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=733

 Score =   520 bits (1340),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 302/388 (78%), Gaps = 13/388 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  1     MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  354   EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61    GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  531   LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  695
               G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  121   FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  180

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF QR+GC+VTLYQDAHVP+ F+PRIPL GGR YE  RCWEDIFDAI+ AKHL+YITGW
Sbjct  181   TFFSQRQGCRVTLYQDAHVPDGFVPRIPLDGGRCYEAHRCWEDIFDAISGAKHLIYITGW  240

Query  876   SVYTEITLVRD-PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             SVYTEITL+RD  R P+PG   TLGELLKKKA EGVRVLMLVWDDRTSVG LKKDGLMAT
Sbjct  241   SVYTEITLLRDGARPPRPGSGVTLGELLKKKAGEGVRVLMLVWDDRTSVGALKKDGLMAT  300

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER-  1229
             HDEET NYF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD +MP   ++R 
Sbjct  301   HDEETMNYFEGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPVQRSQRQ  360

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RRI+SF+GG+DLCDGRYD+P H LFRTL
Sbjct  361   RRILSFVGGLDLCDGRYDTPCHSLFRTL  388



>gb|EPS60466.1| hypothetical protein M569_14336, partial [Genlisea aurea]
Length=770

 Score =   518 bits (1334),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 240/343 (70%), Positives = 283/343 (83%), Gaps = 6/343 (2%)
 Frame = +3

Query  285   VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  464
              EG E  +GF KTASRLYATIDL  ARVGRTRLL+E  NPRWYESFHIYCAH  S+VVFS
Sbjct  1     AEGVEEALGFRKTASRLYATIDLGIARVGRTRLLEETSNPRWYESFHIYCAHTTSDVVFS  60

Query  465   VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  644
             VK+DNPIGAE+IGRA + A  ++ GEE+D WLP+L++D   IH + KIHVKLQF DV RE
Sbjct  61    VKIDNPIGAEVIGRAALAAADIVVGEEIDAWLPILNSDHKAIHGNPKIHVKLQFFDVARE  120

Query  645   RCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWED  824
             RCW RG+K+  FPGVPYTFFPQR+GC++TLYQD+H  E F+P + LAGGR Y    CWED
Sbjct  121   RCWSRGIKSPNFPGVPYTFFPQRKGCRITLYQDSHSLETFVPPVKLAGGRNYRVHHCWED  180

Query  825   IFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWD  1004
             IF +I  A+HL+Y+ GWSVYTEITLVR      PG   TLGELLKKKA++G+RVL+L+WD
Sbjct  181   IFRSINDAQHLIYVAGWSVYTEITLVR------PGEAITLGELLKKKANQGIRVLVLIWD  234

Query  1005  DRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQK  1184
             DRTSV LLKKDGLM THD++T  YFKD+EVHCVLCPRNPD+GRS+IQ+IEIGTMFTHHQK
Sbjct  235   DRTSVPLLKKDGLMDTHDQDTFEYFKDSEVHCVLCPRNPDNGRSVIQDIEIGTMFTHHQK  294

Query  1185  IVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              V+VDG+MP+G+ + RRIVSF+GGIDLCDGRYD+  H LFRTL
Sbjct  295   TVIVDGDMPNGNKQPRRIVSFVGGIDLCDGRYDTQSHSLFRTL  337



>ref|XP_008649399.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
 ref|XP_008649400.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=821

 Score =   520 bits (1338),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 302/388 (78%), Gaps = 13/388 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  1     MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  354   EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61    GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  531   LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  695
               G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  121   FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  180

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF QR+GC+VTLYQDAHVP+ F+PRIPL GGR YE  RCWEDIFDAI+ AKHL+YITGW
Sbjct  181   TFFSQRQGCRVTLYQDAHVPDGFVPRIPLDGGRCYEAHRCWEDIFDAISGAKHLIYITGW  240

Query  876   SVYTEITLVRD-PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             SVYTEITL+RD  R P+PG   TLGELLKKKA EGVRVLMLVWDDRTSVG LKKDGLMAT
Sbjct  241   SVYTEITLLRDGARPPRPGSGVTLGELLKKKAGEGVRVLMLVWDDRTSVGALKKDGLMAT  300

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER-  1229
             HDEET NYF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD +MP   ++R 
Sbjct  301   HDEETMNYFEGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPVQRSQRQ  360

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RRI+SF+GG+DLCDGRYD+P H LFRTL
Sbjct  361   RRILSFVGGLDLCDGRYDTPCHSLFRTL  388



>ref|XP_004287315.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=809

 Score =   519 bits (1336),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 299/379 (79%), Gaps = 8/379 (2%)
 Frame = +3

Query  189   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MAQ +LLHG LH  ++EVD +K  G    F K+ E +   VG  K   R YATIDLE AR
Sbjct  1     MAQTVLLHGVLHATIFEVDSLKAGGCCTFFCKLFEES---VGLGK-GCRPYATIDLENAR  56

Query  366   VGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTRLL+E   NP+W E+FHIYCAHMASNVVFS+K  NPIGA +IG AY+PA  L  GE
Sbjct  57    VGRTRLLEETTTNPQWNEAFHIYCAHMASNVVFSIKEYNPIGANVIGEAYLPAAELFNGE  116

Query  543   EVDEWLPL-LDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EVD WL + + +   P+H  SKI VKL+F  V     W  G+K+ ++PGVPYTFFPQR G
Sbjct  117   EVDRWLKITMHHHGRPLHGGSKIRVKLRFYPVTGNCNWSHGIKSPKYPGVPYTFFPQRNG  176

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             C+VTLYQDAHVP+NFIP IPLAGG+ YEP RCWEDIF AI  AKHL+YI GWSVY +ITL
Sbjct  177   CRVTLYQDAHVPDNFIPDIPLAGGKCYEPHRCWEDIFHAIYNAKHLIYIAGWSVYAKITL  236

Query  900   VRDPRRPK-PGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             VRD +RPK   GD TLGELLKKKA EGV+VLMLVWDDRTSV +LK+DGLM THDE+T +Y
Sbjct  237   VRDTKRPKIVDGDLTLGELLKKKAKEGVKVLMLVWDDRTSVKVLKRDGLMGTHDEDTESY  296

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGG  1256
             F+DT VHCVLCPRNPD+G+SI+Q+IE+GTMFTHHQKIVVVD E+P+G   +RRIVSFIGG
Sbjct  297   FQDTGVHCVLCPRNPDNGQSIVQDIEVGTMFTHHQKIVVVDSELPNGAPGKRRIVSFIGG  356

Query  1257  IDLCDGRYDSPFHPLFRTL  1313
             IDLCDGRYD+ FHPLFRTL
Sbjct  357   IDLCDGRYDTQFHPLFRTL  375



>gb|AFW77332.1| phospholipase D family protein [Zea mays]
Length=925

 Score =   520 bits (1340),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 302/388 (78%), Gaps = 13/388 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  105   MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  164

Query  354   EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  165   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  224

Query  531   LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  695
               G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  225   FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  284

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF QR+GC+VTLYQDAHVP+ F+PRIPL GGR YE  RCWEDIFDAI+ AKHL+YITGW
Sbjct  285   TFFSQRQGCRVTLYQDAHVPDGFVPRIPLDGGRCYEAHRCWEDIFDAISGAKHLIYITGW  344

Query  876   SVYTEITLVRD-PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             SVYTEITL+RD  R P+PG   TLGELLKKKA EGVRVLMLVWDDRTSVG LKKDGLMAT
Sbjct  345   SVYTEITLLRDGARPPRPGSGVTLGELLKKKAGEGVRVLMLVWDDRTSVGALKKDGLMAT  404

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER-  1229
             HDEET NYF+ T+VHCVLCPRNPDD  SI+Q+++I TMFTHHQKIVVVD +MP   ++R 
Sbjct  405   HDEETMNYFEGTDVHCVLCPRNPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPVQRSQRQ  464

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RRI+SF+GG+DLCDGRYD+P H LFRTL
Sbjct  465   RRILSFVGGLDLCDGRYDTPCHSLFRTL  492



>ref|XP_003568837.1| PREDICTED: phospholipase D alpha 1-like [Brachypodium distachyon]
Length=822

 Score =   517 bits (1331),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 241/386 (62%), Positives = 300/386 (78%), Gaps = 11/386 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA++LLHG+LHV V+E + +      +        K+VEG E  VG  K  S  YAT+ L
Sbjct  1     MAKILLHGTLHVTVFEAEGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGNSNFYATVSL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              + R+GRTR L DE  +PRW+ESFHIYCAH+AS+V+F++K  + IGA ++G  ++P R +
Sbjct  61    GQCRIGRTRTLSDESTSPRWFESFHIYCAHLASDVLFTIKAKSAIGASVVGTGFLPVRDI  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
               G+EV+ WLPL D+ RNP     K+HVKLQ+ D+ ++R WGRG+++ + PGVPYTFF Q
Sbjct  121   FPGDEVERWLPLCDDARNPADGGGKVHVKLQYFDISKDRAWGRGIRSPKHPGVPYTFFSQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R+GCKVTLYQDAH+P+ FIPRIPL  GR YEP RCWEDIFDAI+ AKH VY+TGWSV+TE
Sbjct  181   RQGCKVTLYQDAHIPDGFIPRIPLDDGRCYEPHRCWEDIFDAISNAKHFVYMTGWSVFTE  240

Query  891   ITLVRDPRRPKP-GGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET  1067
             +TL+RD  RPKP GG  TLGELLKKKASEGV+VLMLVWDDRTSVG+LKKDGLMATHDEET
Sbjct  241   VTLLRDAARPKPAGGGVTLGELLKKKASEGVKVLMLVWDDRTSVGMLKKDGLMATHDEET  300

Query  1068  GNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERR----R  1235
              NYF+DT+VHCVLCPR+PDD  SI+Q+++I TMFTHHQKIVVVD +MP G         R
Sbjct  301   MNYFQDTDVHCVLCPRDPDDSGSIVQDLQISTMFTHHQKIVVVDHDMPKGAASESRRRRR  360

Query  1236  IVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             ++SF+GG+DLCDGRYD+PFH LF TL
Sbjct  361   VMSFVGGLDLCDGRYDTPFHSLFGTL  386



>ref|XP_010325101.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum lycopersicum]
Length=723

 Score =   513 bits (1322),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/291 (81%), Positives = 265/291 (91%), Gaps = 0/291 (0%)
 Frame = +3

Query  441   MASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKL  620
             MAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE VDEWL +LD +R P+H HSKIHVKL
Sbjct  1     MASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVVDEWLEILDTERKPVHGHSKIHVKL  60

Query  621   QFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFY  800
             Q+ DV RE  W RG++  RFPGVPYTFF QR+GCK+TLYQD+HVP+NF+P+IPLAGG FY
Sbjct  61    QYFDVTREYNWNRGIRVTRFPGVPYTFFSQRQGCKITLYQDSHVPDNFVPKIPLAGGNFY  120

Query  801   EPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGV  980
             EPQRCWEDIFDAIT AKHL+YITGWSVYTEITL+RD RRPKPGGD TLGELLKKKA+EGV
Sbjct  121   EPQRCWEDIFDAITNAKHLIYITGWSVYTEITLIRDMRRPKPGGDITLGELLKKKANEGV  180

Query  981   RVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIG  1160
             RVLMLVWDDRTSV +LK+DGLMATHD+ET  YF+++EVHCVLCPRNPDDGRSIIQNIEIG
Sbjct  181   RVLMLVWDDRTSVPVLKEDGLMATHDQETAAYFENSEVHCVLCPRNPDDGRSIIQNIEIG  240

Query  1161  TMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             TMFTHHQKIVVVDGE+P+GDTERRRIVS+IGGIDLCDGRYD+ FH LFRTL
Sbjct  241   TMFTHHQKIVVVDGELPNGDTERRRIVSYIGGIDLCDGRYDTQFHSLFRTL  291



>ref|XP_010656428.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   515 bits (1326),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 256/387 (66%), Positives = 298/387 (77%), Gaps = 18/387 (5%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M Q L+HG+LH  +YEVD + T G  N   K+   ++R+VG     S++Y TIDLEKA V
Sbjct  2     MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKL---SKRIVG--APISKIYVTIDLEKAGV  56

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL GE 
Sbjct  57    GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEGE-  115

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD WL L  +D  PI+  SK+HVKLQF+DV RE  W RG+++ +FPGVPYTFFPQR+GC+
Sbjct  116   VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSRGIRSPKFPGVPYTFFPQRKGCR  175

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V LYQDAHVP  FIP+IPL+GG+ YEP +CWEDIF AI+ AKHLVYITGWS+YT+ TLVR
Sbjct  176   VLLYQDAHVPNKFIPKIPLSGGKCYEPHQCWEDIFHAISNAKHLVYITGWSLYTKTTLVR  235

Query  906   DPRRPKPGGDA-----------TLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
               R  KPG  A           TLGELLKKKASEGV VLML+W+DRTSV LLKKDGLMAT
Sbjct  236   YSRGQKPGEHATLGELFRKKTLTLGELLKKKASEGVTVLMLLWEDRTSVKLLKKDGLMAT  295

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERR  1232
             H E+TG YF  T VHCVLCPRNPD+G SI+Q+IEI  MFTHHQKIVVVD EMP+G +E R
Sbjct  296   HGEDTGKYFHGTGVHCVLCPRNPDNGLSIVQDIEISAMFTHHQKIVVVDSEMPNGGSEHR  355

Query  1233  RIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RIVSFIGG DLCDGRYD+P H +FRTL
Sbjct  356   RIVSFIGGFDLCDGRYDTPTHSIFRTL  382



>gb|AAC49274.1| phospholipase D [Arabidopsis thaliana]
Length=809

 Score =   514 bits (1324),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 292/368 (79%), Gaps = 4/368 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDG-LHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             MA  LLHG+LH  +YEVD +   G +     KI+   E  +G  K  +RLYATIDL+KAR
Sbjct  1     MAHDLLHGTLHATIYEVDALHGGGVMQGFLGKILANVEETIGVGKGETRLYATIDLQKAR  60

Query  366   VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRTR + +E KNP+WYESF +             K D PIGA LIGRAY+P  +++ GE
Sbjct  61    VGRTRKIKNEPKNPKWYESFQVSVVTWLLISSSLSKDDIPIGATLIGRAYIPVDQVINGE  120

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
              VD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W  G+K+A+FPGVPYTFF QR+GC
Sbjct  121   -VDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNMGIKSAKFPGVPYTFFSQRQGC  179

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KV+LYQDAH+P+NF+PRIPLAGG+ YEPQRCWEDIFD I+ AKHL+YITGWSVY EI LV
Sbjct  180   KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDTISNAKHLIYITGWSVYAEIALV  239

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD RRPKPGGD T+GELLKKKASEGVRVL+LVWDDRTSV +LKKDGLMATHDEET N+F+
Sbjct  240   RDSRRPKPGGDVTIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR  299

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPD-GDTERRRIVSFIGGI  1259
             + +VHC+LCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP  G +E RRIVSF+GGI
Sbjct  300   ERDVHCILCPRNPDDGGSIVQSLQISTMFTHHQKIVVVDSEMPSRGGSEMRRIVSFVGGI  359

Query  1260  DLCDGRYD  1283
             DLCDGRYD
Sbjct  360   DLCDGRYD  367



>ref|XP_009368855.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=808

 Score =   512 bits (1318),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 298/374 (80%), Gaps = 7/374 (2%)
 Frame = +3

Query  198   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  377
             +LLHG LH  +YEVD++   G    F K +  +   VGF K  SRLYATIDLE  RVGRT
Sbjct  6     VLLHGVLHATIYEVDRLMAGGCCIFFCKFLGES---VGFGK-GSRLYATIDLENVRVGRT  61

Query  378   RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  554
             RLL+   KNP W ESFHIYCAHM SNVVFS+K DN  G ++IGRA+MPA  LL  E +D 
Sbjct  62    RLLENSTKNPLWCESFHIYCAHMTSNVVFSIKEDNAFGTKVIGRAHMPAAELLNSEVIDR  121

Query  555   WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTL  734
             W+ ++ +++ P+H  SKIHVKL+F +V +E  W RG+++  F GVPYTFF QR GC+VTL
Sbjct  122   WVRIIYHNK-PLHGRSKIHVKLRFFNVNQESNWSRGIRSPEFQGVPYTFFTQRNGCRVTL  180

Query  735   YQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPR  914
             YQDAHVPENF P+IPLAG + YEP RCWEDIF+ I+ AKHL+YI GWSV T+ITLVRDP+
Sbjct  181   YQDAHVPENFTPQIPLAGSKCYEPHRCWEDIFNGISNAKHLIYIAGWSVCTKITLVRDPK  240

Query  915   RPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEV  1094
             R  PGGD TLGELLKKKA EGV+VLMLVWDDRTSV LLK+DG+MATHDE+T +YF +T V
Sbjct  241   RQIPGGDLTLGELLKKKADEGVKVLMLVWDDRTSVKLLKRDGVMATHDEDTESYFHNTAV  300

Query  1095  HCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGD-TERRRIVSFIGGIDLCD  1271
             HCVLCPRNPD+G SI++++++ TMFTHHQKIVVVD E+P+G   E+RRIVSFIGGIDLCD
Sbjct  301   HCVLCPRNPDNGNSIVKDLQVSTMFTHHQKIVVVDSELPNGGRLEKRRIVSFIGGIDLCD  360

Query  1272  GRYDSPFHPLFRTL  1313
             GRYD+P HP+FRTL
Sbjct  361   GRYDTPSHPIFRTL  374



>dbj|BAJ93878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   510 bits (1314),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/349 (68%), Positives = 286/349 (82%), Gaps = 3/349 (1%)
 Frame = +3

Query  276   HKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASN  452
              ++VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+AS+
Sbjct  3     QQLVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLASD  62

Query  453   VVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLD  632
             V+F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D
Sbjct  63    VLFTIKGKSTIGAVVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFD  122

Query  633   VVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQR  812
             + ++R WG G+++ + PGVPYTFF QR+GCKVTLYQDAH+P+ FIPRIPL  GR YEP R
Sbjct  123   ISKDRGWGHGIRSGKHPGVPYTFFSQRQGCKVTLYQDAHIPDGFIPRIPLDDGRCYEPHR  182

Query  813   CWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKP-GGDATLGELLKKKASEGVRVL  989
             CWEDIF AI+ AKHL+YITGWSVYTEITL+RD  RPKP GG  TLGELLKKKA EGVRVL
Sbjct  183   CWEDIFAAISNAKHLIYITGWSVYTEITLLRDANRPKPAGGGVTLGELLKKKAGEGVRVL  242

Query  990   MLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMF  1169
             MLVWDDRTSVG+LKKDGLMATHDEET NYF+DT+VHCVLCPR+PDD  SI+Q+++I TMF
Sbjct  243   MLVWDDRTSVGVLKKDGLMATHDEETMNYFQDTDVHCVLCPRDPDDSGSIVQDLQISTMF  302

Query  1170  THHQKIVVVDGEMP-DGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             THHQK V+VD +MP  G   RRRI+SF+GG+DLCDGRYD+PFH LF TL
Sbjct  303   THHQKTVIVDHDMPQSGGGRRRRILSFVGGLDLCDGRYDTPFHSLFGTL  351



>gb|EMT24153.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=906

 Score =   514 bits (1323),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 237/347 (68%), Positives = 285/347 (82%), Gaps = 3/347 (1%)
 Frame = +3

Query  282   IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVV  458
             +VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+A++V+
Sbjct  4     LVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLATDVL  63

Query  459   FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  638
             F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D+ 
Sbjct  64    FTIKGSSTIGASVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFDIS  123

Query  639   RERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCW  818
             ++R WGRG+++ + PGVPYTFF QR+GCKVTLYQDAH+P+ FIPRIPL  GR YEP RCW
Sbjct  124   KDRAWGRGIRSGKNPGVPYTFFSQRQGCKVTLYQDAHIPDGFIPRIPLDDGRCYEPHRCW  183

Query  819   EDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKP-GGDATLGELLKKKASEGVRVLML  995
             EDIF AI+ AKHL+YITGWSVYTEI L+RD  RPKP GG  TLGELLKKKA EGVRVLML
Sbjct  184   EDIFAAISNAKHLIYITGWSVYTEIALLRDANRPKPAGGGVTLGELLKKKAGEGVRVLML  243

Query  996   VWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTH  1175
             VWDDRTSVG+LKKDGLMATHDEET NYF+DT+VHCVLCPR+PDD  S +Q+++I TMFTH
Sbjct  244   VWDDRTSVGVLKKDGLMATHDEETMNYFQDTDVHCVLCPRDPDDSGSFVQDLQISTMFTH  303

Query  1176  HQKIVVVDGEMP-DGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             HQK V+VD +MP  G   RRRI+SF+GG+DLCDGRYD+PFHPLF TL
Sbjct  304   HQKTVIVDHDMPQSGGGRRRRILSFVGGLDLCDGRYDTPFHPLFGTL  350



>ref|XP_002524502.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF37942.1| phopholipase d alpha, putative [Ricinus communis]
Length=725

 Score =   507 bits (1306),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 293/376 (78%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG L + ++EVD++   G    F KI+E  E  VG  K  S+LYATIDLE  +V
Sbjct  1     MAPVLLHGILDLTIFEVDRLSGSGCSKFFCKILENVEETVGCGKGFSKLYATIDLEGTKV  60

Query  369   GRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR L   + +P+W ESFHIYCAH+ASNV FS+KV +PIG+++IGRAY+P   LL GE+
Sbjct  61    GRTRELKHARSDPQWDESFHIYCAHLASNVTFSIKVKDPIGSQVIGRAYLPVVELLNGEK  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD+WL +L+ +  P+H   KIHV++QFLD  +   W +G+ +  F GVPYTFFPQR GC+
Sbjct  121   VDKWLRILNKNHKPLHRGLKIHVRVQFLDATKRSSWSKGITSPNFSGVPYTFFPQRSGCR  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAHVP+ F P+I L G + Y   RCWEDIFDAI  AKH +YITGWSV+T+I+LVR
Sbjct  181   VTLYQDAHVPDKFNPKIFLRGDKRYAQHRCWEDIFDAICNAKHFIYITGWSVFTKISLVR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D RRPK GGD  LGELLKKKA EGVRVLMLVWDD+TSV LLKKDG+MATHDE+T +YF +
Sbjct  241   DSRRPKKGGDTILGELLKKKAEEGVRVLMLVWDDKTSVKLLKKDGVMATHDEDTRSYFHN  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T V+CVLCPRNPD+ +SI Q +EI T+FTHHQK V+VD  +P+G+ E+RRI+SFIGGIDL
Sbjct  301   TRVNCVLCPRNPDNWKSIKQGLEISTVFTHHQKTVIVDSGLPNGELEKRRIISFIGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH +FRTL
Sbjct  361   CDGRYDTQFHSIFRTL  376



>gb|ACL53520.1| unknown [Zea mays]
Length=743

 Score =   504 bits (1298),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 231/309 (75%), Positives = 271/309 (88%), Gaps = 1/309 (0%)
 Frame = +3

Query  387   DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPL  566
             +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL +
Sbjct  4     NEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEI  63

Query  567   LDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDA  746
              D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDA
Sbjct  64    CDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDA  122

Query  747   HVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKP  926
             HVP+NF+PRI LA G+ YEP RCWEDIFDAI+KA+HL+YITGWSVYTEITLVRD  RPKP
Sbjct  123   HVPDNFVPRIQLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTEITLVRDTNRPKP  182

Query  927   GGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVL  1106
             GGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET NYF  T+V+CVL
Sbjct  183   GGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETANYFHGTDVNCVL  242

Query  1107  CPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDS  1286
             CPRNPDD  S +Q+++I TMFTHHQKIVVVD EMP+  +++RRIVSFIGGIDLCDGRYD+
Sbjct  243   CPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHEMPNQGSQQRRIVSFIGGIDLCDGRYDT  302

Query  1287  PFHPLFRTL  1313
              +H LFRTL
Sbjct  303   QYHSLFRTL  311



>ref|NP_001146559.1| phospholipase D family protein [Zea mays]
 gb|ACN26583.1| unknown [Zea mays]
 gb|AFW80164.1| phospholipase D family protein [Zea mays]
Length=743

 Score =   504 bits (1298),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 231/309 (75%), Positives = 271/309 (88%), Gaps = 1/309 (0%)
 Frame = +3

Query  387   DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPL  566
             +E  NPRWYESFHIYCAHMA++VVF+VK+DNPIGA LIGRAY+P   +LGG+E+D+WL +
Sbjct  4     NEPVNPRWYESFHIYCAHMAADVVFTVKIDNPIGASLIGRAYLPVEDILGGDEIDKWLEI  63

Query  567   LDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDA  746
              D  R PI   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDA
Sbjct  64    CDEKREPI-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDA  122

Query  747   HVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKP  926
             HVP+NF+PRIPLA G+ YEP RCWEDIFDAI+KA+HL+YITGWSVYTEITLVRD  RPKP
Sbjct  123   HVPDNFVPRIPLADGKNYEPHRCWEDIFDAISKAQHLIYITGWSVYTEITLVRDTSRPKP  182

Query  927   GGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVL  1106
             GGD TLGELLK+KASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEET NYF  T+V+CVL
Sbjct  183   GGDVTLGELLKRKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETANYFHGTDVNCVL  242

Query  1107  CPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDS  1286
             CPRNPDD  S +Q+++I TMFTHHQKIVVVD E+P+  +++RRIVSF+GGIDLCDGRYD+
Sbjct  243   CPRNPDDSGSFVQDLQISTMFTHHQKIVVVDHELPNEGSQQRRIVSFVGGIDLCDGRYDT  302

Query  1287  PFHPLFRTL  1313
              +H LFRTL
Sbjct  303   QYHSLFRTL  311



>emb|CAN76339.1| hypothetical protein VITISV_014670 [Vitis vinifera]
Length=801

 Score =   506 bits (1302),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/387 (65%), Positives = 289/387 (75%), Gaps = 30/387 (8%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M Q L+HG+LH  +YEVD + T G  N   KI                 Y TIDLEKA V
Sbjct  1     MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKI-----------------YVTIDLEKAGV  43

Query  369   GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL GE 
Sbjct  44    GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEGE-  102

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD WL L  +D  PI+  SK+HVKLQF+DV RE  W RG+++ +FPGVPYTFFPQR+GC+
Sbjct  103   VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSRGIRSPKFPGVPYTFFPQRKGCR  162

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             V LYQDAHVP  FIP+IPL+GG+ YEP +CWEDIF AI+ AKHLVYITGWS+YT+ TLVR
Sbjct  163   VLLYQDAHVPNKFIPKIPLSGGKCYEPHQCWEDIFHAISNAKHLVYITGWSLYTKTTLVR  222

Query  906   DPRRPKPGGDA-----------TLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
               R  KPG  A           TLGELLKKKASEGV VLML+W+DRTSV LLKKDGLMAT
Sbjct  223   YSRGQKPGEHATLGELFRKKTLTLGELLKKKASEGVTVLMLLWEDRTSVKLLKKDGLMAT  282

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERR  1232
             H E+TG YF  T VHCVLCPRNPD+G SI+Q+IEI  MFTHHQKIVVVD EMP+G +E R
Sbjct  283   HGEDTGKYFHGTGVHCVLCPRNPDNGLSIVQDIEISAMFTHHQKIVVVDSEMPNGGSEHR  342

Query  1233  RIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RIVSFIGG DLCDGRYD+P H +FRTL
Sbjct  343   RIVSFIGGFDLCDGRYDTPTHSIFRTL  369



>ref|XP_009364028.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   504 bits (1297),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 245/374 (66%), Positives = 295/374 (79%), Gaps = 8/374 (2%)
 Frame = +3

Query  198   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  377
             +LLHG LH  +YEVD++   G    F K +  +   VG  K  SRLYATIDLE  RVGRT
Sbjct  6     VLLHGVLHATIYEVDRLMPGGCCIFFCKFLGES---VGLRK-GSRLYATIDLENVRVGRT  61

Query  378   RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  554
             RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62    RLLENSTKNPQWRESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLNGKEVDR  121

Query  555   WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTL  734
             WL ++ ++  P+HS  KIHVKLQF +V ++  W  G+++  F GVPYTFF QR GC+VTL
Sbjct  122   WLTIMYHNNKPLHS--KIHVKLQFFNVNQDLNWSCGIRSPEFQGVPYTFFTQRNGCRVTL  179

Query  735   YQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPR  914
             YQ+AHVP NF P+IPLAG  +Y+  RCWEDIF AI+ AK+L+YI GWSVYT+ITLVRDP 
Sbjct  180   YQNAHVPRNFTPKIPLAGSMYYDQHRCWEDIFHAISNAKNLIYIAGWSVYTKITLVRDPN  239

Query  915   RPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEV  1094
                 GGD TLGELLKKKA EGV+VLMLVWDDRTSV LLK+DG+MATHDE+T +YF +T V
Sbjct  240   SQILGGDLTLGELLKKKADEGVKVLMLVWDDRTSVKLLKRDGVMATHDEDTESYFHNTAV  299

Query  1095  HCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGD-TERRRIVSFIGGIDLCD  1271
             HCVLCPRNPD+G SI++++E+ TMFTHHQKIVVVD E+P+G+  E+RRIVSFIGGIDLCD
Sbjct  300   HCVLCPRNPDNGNSIVEDLEVSTMFTHHQKIVVVDNELPNGEGLEKRRIVSFIGGIDLCD  359

Query  1272  GRYDSPFHPLFRTL  1313
             GRYD+P HP+FRTL
Sbjct  360   GRYDTPSHPIFRTL  373



>ref|XP_008385550.1| PREDICTED: phospholipase D alpha 1-like [Malus domestica]
Length=809

 Score =   504 bits (1297),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 243/374 (65%), Positives = 293/374 (78%), Gaps = 6/374 (2%)
 Frame = +3

Query  198   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  377
             +LLHG LH  +YEVD++   G    F K +     +VG  K  S LYATIDLE  RVGRT
Sbjct  6     VLLHGVLHATIYEVDRLMPGGCCIFFCKFLG---ELVGLGK-GSXLYATIDLENVRVGRT  61

Query  378   RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  554
             RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62    RLLENSTKNPQWGESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLDGKEVDR  121

Query  555   WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTL  734
             WL ++ ++  P+H  SKIHVKLQF +V ++  W  G+++  F GVPYTFF Q+ GC+VTL
Sbjct  122   WLKIMYDNNKPLHIRSKIHVKLQFFNVNQDLNWSCGIRSPEFQGVPYTFFTQKNGCRVTL  181

Query  735   YQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPR  914
             YQ+AHVP+ F P+IPLAG   Y+  RCWEDIF AI+ AKHL+YI GWSVYT+ITLVRDP 
Sbjct  182   YQNAHVPKKFTPKIPLAGSMCYDQHRCWEDIFHAISNAKHLIYIAGWSVYTKITLVRDPN  241

Query  915   RPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEV  1094
                PGGD TLGELLKKKA EGV+VLMLVWDDRTSV  LK+DG+MATHDE+T +YF +T V
Sbjct  242   SQIPGGDLTLGELLKKKADEGVKVLMLVWDDRTSVKFLKRDGVMATHDEDTESYFHNTAV  301

Query  1095  HCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGD-TERRRIVSFIGGIDLCD  1271
             HCVLCPRNPD+G SI++++E+ TMFTHHQKIVVVD E+P+G+  E+RRIVSFIGGIDLCD
Sbjct  302   HCVLCPRNPDNGNSIVEDLEVSTMFTHHQKIVVVDSELPNGEGLEKRRIVSFIGGIDLCD  361

Query  1272  GRYDSPFHPLFRTL  1313
             GRYD+P HP+FRTL
Sbjct  362   GRYDTPSHPIFRTL  375



>ref|XP_012076577.1| PREDICTED: phospholipase D alpha 1-like isoform X5 [Jatropha 
curcas]
Length=792

 Score =   502 bits (1293),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 246/372 (66%), Positives = 290/372 (78%), Gaps = 16/372 (4%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTR  380
             LLHG+L V V+E+D I+     NLF KIV             S+LYAT+DL+KARVGRTR
Sbjct  4     LLHGTLSVTVFEIDIIQNGCGFNLFSKIV------------GSKLYATVDLDKARVGRTR  51

Query  381   LL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEW  557
             ++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D  +GA LIGRAY+P   ++ G  +D W
Sbjct  52    MITNQPYNPKWFESFHIYCAHLISNVIFTVKDDQLVGATLIGRAYIPVEDVIKGYIIDRW  111

Query  558   LPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLY  737
             + +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTFF QR GC+VTLY
Sbjct  112   VEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTFFNQRHGCRVTLY  169

Query  738   QDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRR  917
             QDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSVYTEITLVRDP R
Sbjct  170   QDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSVYTEITLVRDPNR  228

Query  918   PKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVH  1097
             PKPGGD  LGELLKKKA EGV VL+LVWDDRTSV  LKKDGLMATHD+ET  YFK+T+VH
Sbjct  229   PKPGGDVKLGELLKKKADEGVTVLVLVWDDRTSVEQLKKDGLMATHDQETEIYFKNTKVH  288

Query  1098  CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGR  1277
             CVLCPRNPDDGRS +Q  EI TMFTHHQK VVVD EMPD  + + RIVSFIGGIDLCDGR
Sbjct  289   CVLCPRNPDDGRSKVQEFEISTMFTHHQKTVVVDCEMPDNTSNKTRIVSFIGGIDLCDGR  348

Query  1278  YDSPFHPLFRTL  1313
             YD+  HPLF+TL
Sbjct  349   YDTQDHPLFKTL  360



>emb|CDX87920.1| BnaC06g09820D [Brassica napus]
Length=343

 Score =   486 bits (1251),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 223/339 (66%), Positives = 275/339 (81%), Gaps = 3/339 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTD--GLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1     MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61    RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  121   EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQDAH+P NF+P+IPLAGG+ YE  RCWEDIFDAIT AKHL+YITGWSVYTEI+L
Sbjct  181   CKVSLYQDAHIPGNFVPKIPLAGGKHYEAGRCWEDIFDAITNAKHLIYITGWSVYTEISL  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPK GGD T+GE+LKKKASEGV+V++LVWDDRTSV LLK+DGLMATHDEET N+F
Sbjct  241   VRDSRRPKEGGDVTIGEILKKKASEGVKVILLVWDDRTSVDLLKQDGLMATHDEETANFF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVV  1196
             + T+V+CVLCPRNPDDG SI+QN+++ TMFTHHQKIVVV
Sbjct  301   RGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQKIVVV  339



>ref|XP_012076575.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Jatropha 
curcas]
Length=799

 Score =   501 bits (1291),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 244/372 (66%), Positives = 292/372 (78%), Gaps = 9/372 (2%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTR  380
             LLHG+L V V+E+D I+     N    I++   ++VG     S+LYAT+DL+KARVGRTR
Sbjct  4     LLHGTLSVTVFEIDIIQNGCGFNFVTIIIKFVFQIVG-----SKLYATVDLDKARVGRTR  58

Query  381   LL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEW  557
             ++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D  +GA LIGRAY+P   ++ G  +D W
Sbjct  59    MITNQPYNPKWFESFHIYCAHLISNVIFTVKDDQLVGATLIGRAYIPVEDVIKGYIIDRW  118

Query  558   LPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLY  737
             + +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTFF QR GC+VTLY
Sbjct  119   VEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTFFNQRHGCRVTLY  176

Query  738   QDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRR  917
             QDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSVYTEITLVRDP R
Sbjct  177   QDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSVYTEITLVRDPNR  235

Query  918   PKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVH  1097
             PKPGGD  LGELLKKKA EGV VL+LVWDDRTSV  LKKDGLMATHD+ET  YFK+T+VH
Sbjct  236   PKPGGDVKLGELLKKKADEGVTVLVLVWDDRTSVEQLKKDGLMATHDQETEIYFKNTKVH  295

Query  1098  CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGR  1277
             CVLCPRNPDDGRS +Q  EI TMFTHHQK VVVD EMPD  + + RIVSFIGGIDLCDGR
Sbjct  296   CVLCPRNPDDGRSKVQEFEISTMFTHHQKTVVVDCEMPDNTSNKTRIVSFIGGIDLCDGR  355

Query  1278  YDSPFHPLFRTL  1313
             YD+  HPLF+TL
Sbjct  356   YDTQDHPLFKTL  367



>ref|XP_012076576.1| PREDICTED: phospholipase D alpha 1-like isoform X4 [Jatropha 
curcas]
Length=796

 Score =   501 bits (1291),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 246/372 (66%), Positives = 293/372 (79%), Gaps = 12/372 (3%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTR  380
             LLHG+L V V+E+D I+     NLF K+   +  +VG     S+LYAT+DL+KARVGRTR
Sbjct  4     LLHGTLSVTVFEIDIIQNGCGFNLFSKV---SACIVG-----SKLYATVDLDKARVGRTR  55

Query  381   LL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEW  557
             ++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D  +GA LIGRAY+P   ++ G  +D W
Sbjct  56    MITNQPYNPKWFESFHIYCAHLISNVIFTVKDDQLVGATLIGRAYIPVEDVIKGYIIDRW  115

Query  558   LPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLY  737
             + +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTFF QR GC+VTLY
Sbjct  116   VEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTFFNQRHGCRVTLY  173

Query  738   QDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRR  917
             QDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSVYTEITLVRDP R
Sbjct  174   QDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSVYTEITLVRDPNR  232

Query  918   PKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVH  1097
             PKPGGD  LGELLKKKA EGV VL+LVWDDRTSV  LKKDGLMATHD+ET  YFK+T+VH
Sbjct  233   PKPGGDVKLGELLKKKADEGVTVLVLVWDDRTSVEQLKKDGLMATHDQETEIYFKNTKVH  292

Query  1098  CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGR  1277
             CVLCPRNPDDGRS +Q  EI TMFTHHQK VVVD EMPD  + + RIVSFIGGIDLCDGR
Sbjct  293   CVLCPRNPDDGRSKVQEFEISTMFTHHQKTVVVDCEMPDNTSNKTRIVSFIGGIDLCDGR  352

Query  1278  YDSPFHPLFRTL  1313
             YD+  HPLF+TL
Sbjct  353   YDTQDHPLFKTL  364



>ref|XP_002515518.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF46967.1| phopholipase d alpha, putative [Ricinus communis]
Length=817

 Score =   499 bits (1286),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 242/384 (63%), Positives = 293/384 (76%), Gaps = 16/384 (4%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTD----------GLHNLFHKIVEGAERVVGFNK--TASRLYAT  344
             LLHG+L V ++EVDK++T           G  N   + +   +RVV        + LYAT
Sbjct  4     LLHGTLSVTIFEVDKLQTGCGFNFFSRGPGQQNCGKRFLSQVKRVVLCRPEIVGTGLYAT  63

Query  345   IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  521
             +DL+KARVGRTR L D+H NP+WYESFHIYCAH+ S+V+F++K D  +GA LIGRAY+P 
Sbjct  64    VDLDKARVGRTRKLEDQHYNPQWYESFHIYCAHLISHVIFTIKDDQFVGASLIGRAYIPV  123

Query  522   RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
               ++ G  +D W+ +LD  RNPI S  KIHVKLQFL+V ++  W +G+K  R+ GVPY F
Sbjct  124   EDVITGYIIDRWVEILDEQRNPIGS--KIHVKLQFLNVTQDSSWSQGIKTPRYDGVPYAF  181

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR+GC+VTLYQDAHVP NFIPRIP+ G + YE QRCWEDIFDAIT AK+L+YITGWSV
Sbjct  182   FNQRQGCRVTLYQDAHVPNNFIPRIPVEG-KSYEAQRCWEDIFDAITDAKYLIYITGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
             YTEIT+VRDP RPKPGGD  LGELLKKKA EGV+VL+LVWDDRTSV   K+DGLM THD+
Sbjct  241   YTEITMVRDPHRPKPGGDMKLGELLKKKADEGVKVLVLVWDDRTSVKQFKEDGLMGTHDQ  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIV  1241
             ET  YF++T VHC+LCPRNPDD RSIIQ  +I TMFTHHQK V+VD EM D  +++R IV
Sbjct  301   ETEEYFRNTNVHCILCPRNPDDRRSIIQGFQISTMFTHHQKTVIVDSEMSDNASQKRSIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SFIGGIDLCDGRYD+  HPLF TL
Sbjct  361   SFIGGIDLCDGRYDTQEHPLFNTL  384



>emb|CDY63527.1| BnaAnng18990D, partial [Brassica napus]
Length=334

 Score =   481 bits (1238),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 219/334 (66%), Positives = 269/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  362
             M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1     MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  363   RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  539
             RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61    RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  540   EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  719
             EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W RG+K+ +FPGVPYTFF QRRG
Sbjct  121   EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNRGIKSVKFPGVPYTFFSQRRG  180

Query  720   CKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITL  899
             CKV+LYQDAH+P NF+P+IPLAGG++YE  RCWEDIFDAIT AKHL+YITGWSVY EI++
Sbjct  181   CKVSLYQDAHIPGNFVPKIPLAGGKYYEANRCWEDIFDAITNAKHLIYITGWSVYAEISV  240

Query  900   VRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYF  1079
             VRD RRPK GGD T+GE+LKKKASEGV+V++LVWDDRTSV LLK+DGLMATHDEET N+F
Sbjct  241   VRDSRRPKEGGDVTIGEILKKKASEGVKVILLVWDDRTSVDLLKQDGLMATHDEETENFF  300

Query  1080  KDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQ  1181
             + T+V+CVLCPRNPDDG SI+QN+++ TMFTHHQ
Sbjct  301   QGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQ  334



>ref|XP_012076574.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Jatropha 
curcas]
Length=816

 Score =   498 bits (1281),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 246/384 (64%), Positives = 293/384 (76%), Gaps = 16/384 (4%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIV---EGAERVVGFNK---------TASRLYAT  344
             LLHG+L V V+E+D I+     NLF K+       +R +   K           S+LYAT
Sbjct  4     LLHGTLSVTVFEIDIIQNGCGFNLFSKVSACQNCGKRFLSKMKRMVLCRPEIVGSKLYAT  63

Query  345   IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  521
             +DL+KARVGRTR++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D  +GA LIGRAY+P 
Sbjct  64    VDLDKARVGRTRMITNQPYNPKWFESFHIYCAHLISNVIFTVKDDQLVGATLIGRAYIPV  123

Query  522   RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
               ++ G  +D W+ +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTF
Sbjct  124   EDVIKGYIIDRWVEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTF  181

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR GC+VTLYQDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSV
Sbjct  182   FNQRHGCRVTLYQDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
             YTEITLVRDP RPKPGGD  LGELLKKKA EGV VL+LVWDDRTSV  LKKDGLMATHD+
Sbjct  241   YTEITLVRDPNRPKPGGDVKLGELLKKKADEGVTVLVLVWDDRTSVEQLKKDGLMATHDQ  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIV  1241
             ET  YFK+T+VHCVLCPRNPDDGRS +Q  EI TMFTHHQK VVVD EMPD  + + RIV
Sbjct  301   ETEIYFKNTKVHCVLCPRNPDDGRSKVQEFEISTMFTHHQKTVVVDCEMPDNTSNKTRIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SFIGGIDLCDGRYD+  HPLF+TL
Sbjct  361   SFIGGIDLCDGRYDTQDHPLFKTL  384



>ref|XP_011070230.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Sesamum indicum]
Length=819

 Score =   498 bits (1281),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 238/394 (60%), Positives = 292/394 (74%), Gaps = 25/394 (6%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  314
             MA  LLHG+LH  ++E D++                  KT    + F + +  +  +VG 
Sbjct  1     MAPRLLHGTLHATIFEADRLQGGFSLSHLFGTTGNPQKKTKSFLSQFKRFLLCSPEIVG-  59

Query  315   NKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  491
                 SR+YATIDLE+ARVGRTR++ +E  NPRW E FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60    ----SRIYATIDLERARVGRTRVIQNEPSNPRWSEYFHIYCAHNVSNIVFTVKDDNPIGA  115

Query  492   ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKA  671
              LIGRAY+P   L+ G  VD W+ +LD DRNPIH  SKIHVKLQF  V++E  W +G+++
Sbjct  116   TLIGRAYLPVEELMSGHMVDRWIDILDEDRNPIHGGSKIHVKLQFFQVIQESSWSQGIRS  175

Query  672   ARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAK  851
             + F GVPYTFF QR+GCKV+LY DAHVP++ I     + G ++EPQRCWED+FDAI  AK
Sbjct  176   SAFGGVPYTFFKQRQGCKVSLYPDAHVPDDNITHFLKSEG-YFEPQRCWEDMFDAINNAK  234

Query  852   HLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLK  1031
             HL+YITGWSVYT+ITL+RDP+RPKPGGD+ LGELLKKKA EGV VLMLVWDDRTS+   K
Sbjct  235   HLIYITGWSVYTKITLIRDPKRPKPGGDSILGELLKKKADEGVNVLMLVWDDRTSIQEFK  294

Query  1032  KDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP  1211
             KDGLMATHD+ET  YF++T+V C+LCPRNPD+G SI Q  ++  MFTHHQK VVVD E P
Sbjct  295   KDGLMATHDQETKAYFQNTKVRCILCPRNPDNGTSIFQGFQVSAMFTHHQKTVVVDSESP  354

Query  1212  DGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              G + +RRIVSF+GGIDLCDGRYD+  H LFRTL
Sbjct  355   GGTSGKRRIVSFVGGIDLCDGRYDTRVHSLFRTL  388



>emb|CAN81667.1| hypothetical protein VITISV_017804 [Vitis vinifera]
Length=642

 Score =   491 bits (1265),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 240/339 (71%), Positives = 272/339 (80%), Gaps = 13/339 (4%)
 Frame = +3

Query  333   LYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  509
             +Y TIDL+KARVGRTR L +E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA
Sbjct  40    VYVTIDLDKARVGRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRA  99

Query  510   YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  689
              +P   LL GE VD WL L  +DR PIH  SK+HVKLQF DV RE  W RG+ + +FPGV
Sbjct  100   QLPVEELLEGE-VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSRGITSXKFPGV  158

Query  690   PYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYIT  869
             PYTFFPQR+GC+V LYQDAH+P  FIP+IPL+GG++YEP RCWEDIF AI+ AK L+YIT
Sbjct  159   PYTFFPQRKGCRVLLYQDAHIPNKFIPKIPLSGGKYYEPHRCWEDIFHAISNAKQLIYIT  218

Query  870   GWSVYTEITLVRDPRRPKPGGDATLGEL-----------LKKKASEGVRVLMLVWDDRTS  1016
             GWSVYT+ TLVR  R  KPG  ATLGEL           LKKKASEGVRVLMLVWDDRTS
Sbjct  219   GWSVYTKXTLVRYSRGQKPGEHATLGELFNKKTSTLGELLKKKASEGVRVLMLVWDDRTS  278

Query  1017  VGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVV  1196
             V LLKKDGLMATHDE+TG YF  +EVHCVLCPR+PD+G SI+Q+IEI TMFTHHQKIVVV
Sbjct  279   VKLLKKDGLMATHDEDTGKYFHGSEVHCVLCPRDPDNGLSIVQDIEISTMFTHHQKIVVV  338

Query  1197  DGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             D EMP+  +ERRRIVSFIGGIDLCDGRYD+P H +FRTL
Sbjct  339   DSEMPNRGSERRRIVSFIGGIDLCDGRYDTPTHTIFRTL  377



>ref|XP_012078794.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Jatropha 
curcas]
 gb|KDP32412.1| hypothetical protein JCGZ_13337 [Jatropha curcas]
Length=810

 Score =   496 bits (1278),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 230/376 (61%), Positives = 294/376 (78%), Gaps = 3/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG LHV ++E+D++      N F KIVE  E  V   K+ S++YATI+LE+AR+
Sbjct  1     MASVLLHGILHVTIFEIDRLSGSSCCNFFCKIVEKCEGTVACGKSISKIYATIELEEARI  60

Query  369   GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR L     NP+W+ESFHIYCAHMASNV FS+K+ +PIG+++IGRA +PA ++L GE 
Sbjct  61    GRTRELKHASSNPQWHESFHIYCAHMASNVTFSIKIKDPIGSQVIGRASLPAMQVLNGEA  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             ++ WL +L+    P+ S  KIHVKLQF DV +   W +G+ +    GVP+TFFPQR GC+
Sbjct  121   LNTWLRILNKKNKPLRS--KIHVKLQFFDVSKGSNWSKGITSPNVLGVPHTFFPQRNGCR  178

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQD+H  +N++PRIPLAGG+ YEP RCWEDIFDAI+ AKH +YITGWSVY +I L+R
Sbjct  179   VTLYQDSHFLDNYVPRIPLAGGKCYEPHRCWEDIFDAISNAKHFIYITGWSVYVKIKLIR  238

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D  R K G D  LGELLKKKA EGVRVLMLVWDD+TS  LLKKDG+MATHDE+T +YF +
Sbjct  239   DLERRKDGEDVILGELLKKKAEEGVRVLMLVWDDKTSCKLLKKDGVMATHDEDTRSYFHN  298

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             ++V+CVL PR P++  +IIQ+IE+ T+FTHHQK ++VD EM +G++E+RRIVSFIGGIDL
Sbjct  299   SKVNCVLSPRKPENWNNIIQDIEVSTIFTHHQKTLIVDSEMGNGESEKRRIVSFIGGIDL  358

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  359   CDGRYDNQFHSLFRTL  374



>ref|XP_012076573.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Jatropha 
curcas]
Length=816

 Score =   496 bits (1278),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/384 (64%), Positives = 293/384 (76%), Gaps = 16/384 (4%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIV---EGAERVVGFNK---------TASRLYAT  344
             LLHG+L V V+E+D I+     NLF K +      +R +   K           S+LYAT
Sbjct  4     LLHGTLSVTVFEIDIIQNGCGFNLFSKGIGQQNCGKRFLSKMKRMVLCRPEIVGSKLYAT  63

Query  345   IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  521
             +DL+KARVGRTR++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D  +GA LIGRAY+P 
Sbjct  64    VDLDKARVGRTRMITNQPYNPKWFESFHIYCAHLISNVIFTVKDDQLVGATLIGRAYIPV  123

Query  522   RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
               ++ G  +D W+ +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTF
Sbjct  124   EDVIKGYIIDRWVEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTF  181

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR GC+VTLYQDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSV
Sbjct  182   FNQRHGCRVTLYQDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
             YTEITLVRDP RPKPGGD  LGELLKKKA EGV VL+LVWDDRTSV  LKKDGLMATHD+
Sbjct  241   YTEITLVRDPNRPKPGGDVKLGELLKKKADEGVTVLVLVWDDRTSVEQLKKDGLMATHDQ  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIV  1241
             ET  YFK+T+VHCVLCPRNPDDGRS +Q  EI TMFTHHQK VVVD EMPD  + + RIV
Sbjct  301   ETEIYFKNTKVHCVLCPRNPDDGRSKVQEFEISTMFTHHQKTVVVDCEMPDNTSNKTRIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SFIGGIDLCDGRYD+  HPLF+TL
Sbjct  361   SFIGGIDLCDGRYDTQDHPLFKTL  384



>emb|CBI36314.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   477 bits (1227),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 224/354 (63%), Positives = 277/354 (78%), Gaps = 25/354 (7%)
 Frame = +3

Query  180   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  359
             +SE  ++ LHG+LH  ++E+D++ + G    F K+VE  E  VGF K  S+LYATID+ +
Sbjct  1     MSEFNEIPLHGTLHATIFEIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGR  60

Query  360   ARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  536
             ARVGRTR++ +E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LG
Sbjct  61    ARVGRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILG  120

Query  537   GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  716
             GEEVD+W+ +++ +  PIH  SKIHVKLQ+ +V  +R WGRG++                
Sbjct  121   GEEVDKWVEIVNEELKPIHGGSKIHVKLQYFEVTADRSWGRGIR----------------  164

Query  717   GCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEIT  896
                     +AHVP+NF+P+IPLA G++YEP+RCWED+FDAI  AKHL+YITGWSVYTEIT
Sbjct  165   --------NAHVPDNFVPKIPLADGKYYEPRRCWEDVFDAINNAKHLIYITGWSVYTEIT  216

Query  897   LVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNY  1076
             LVRD RRPKPGGD T+GELLKKKASEGVRVLMLVWDDRTSV LLKKDGLM THDEET +Y
Sbjct  217   LVRDSRRPKPGGDLTIGELLKKKASEGVRVLMLVWDDRTSVPLLKKDGLMGTHDEETEHY  276

Query  1077  FKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRI  1238
             F DT+VHCVLCPRNPDDG SI+Q+++I TMFTHHQKIVVVD EMP G +E+RRI
Sbjct  277   FHDTDVHCVLCPRNPDDGGSIVQDLQISTMFTHHQKIVVVDSEMPSGGSEKRRI  330



>ref|NP_001146242.1| uncharacterized protein LOC100279815 [Zea mays]
 gb|ACL53544.1| unknown [Zea mays]
 gb|AFW87188.1| phospholipase D family protein [Zea mays]
Length=816

 Score =   493 bits (1269),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 241/383 (63%), Positives = 289/383 (75%), Gaps = 8/383 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1     MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGSTRLYATVDL  60

Query  354   EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              +ARVGRTR++  +  NPRWYE FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61    GRARVGRTRVITGDPVNPRWYEVFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE-RCWGRGVKAARFPGVPYTFFP  707
             + G+E++  L +LD  +  +    KI V+L+F DV  + R WGRGV  AR+PGVPYTFF 
Sbjct  121   IAGQEIERSLDILDASKKRLPHGPKIRVRLRFQDVSADPRGWGRGVGGARYPGVPYTFFS  180

Query  708   QRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYT  887
             QR GC+VTLYQDAH P+ F PRIPLAGGR Y+P RCWED+FDAI+ A+HL+YITGWSVYT
Sbjct  181   QRPGCRVTLYQDAHTPDAFAPRIPLAGGRLYQPGRCWEDVFDAISNARHLIYITGWSVYT  240

Query  888   EITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSV-GLLKKDGLMATHDEE  1064
             EITL+RD  RP+PGG+ATLGELLK+KASEGVRVLMLVWDDRTSV  L  K G M+THD E
Sbjct  241   EITLLRDGSRPRPGGEATLGELLKRKASEGVRVLMLVWDDRTSVESLGMKWGFMSTHDAE  300

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVS  1244
             T  YF+ + VHCVLCPRNPD G S +   +I  M THHQKIVVVD EMP   ++RRRI+S
Sbjct  301   TAEYFRGSGVHCVLCPRNPDAGSSAVMGAQIAYMITHHQKIVVVDHEMPAKRSDRRRILS  360

Query  1245  FIGGIDLCDGRYDSPFHPLFRTL  1313
             F+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   FVGGLDLCDGRYDTQFHSLFRTL  383



>ref|XP_012078795.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Jatropha 
curcas]
Length=808

 Score =   492 bits (1267),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 229/376 (61%), Positives = 295/376 (78%), Gaps = 5/376 (1%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG LHV ++E+D++   G  + F +IVE  E  V   K+ S++YATI+LE+AR+
Sbjct  1     MASVLLHGILHVTIFEIDRLS--GSSSFFLQIVEKCEGTVACGKSISKIYATIELEEARI  58

Query  369   GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR L     NP+W+ESFHIYCAHMASNV FS+K+ +PIG+++IGRA +PA ++L GE 
Sbjct  59    GRTRELKHASSNPQWHESFHIYCAHMASNVTFSIKIKDPIGSQVIGRASLPAMQVLNGEA  118

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             ++ WL +L+    P+ S  KIHVKLQF DV +   W +G+ +    GVP+TFFPQR GC+
Sbjct  119   LNTWLRILNKKNKPLRS--KIHVKLQFFDVSKGSNWSKGITSPNVLGVPHTFFPQRNGCR  176

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQD+H  +N++PRIPLAGG+ YEP RCWEDIFDAI+ AKH +YITGWSVY +I L+R
Sbjct  177   VTLYQDSHFLDNYVPRIPLAGGKCYEPHRCWEDIFDAISNAKHFIYITGWSVYVKIKLIR  236

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D  R K G D  LGELLKKKA EGVRVLMLVWDD+TS  LLKKDG+MATHDE+T +YF +
Sbjct  237   DLERRKDGEDVILGELLKKKAEEGVRVLMLVWDDKTSCKLLKKDGVMATHDEDTRSYFHN  296

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             ++V+CVL PR P++  +IIQ+IE+ T+FTHHQK ++VD EM +G++E+RRIVSFIGGIDL
Sbjct  297   SKVNCVLSPRKPENWNNIIQDIEVSTIFTHHQKTLIVDSEMGNGESEKRRIVSFIGGIDL  356

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  357   CDGRYDNQFHSLFRTL  372



>ref|XP_004965943.1| PREDICTED: phospholipase D alpha 2-like [Setaria italica]
Length=818

 Score =   493 bits (1268),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 246/384 (64%), Positives = 289/384 (75%), Gaps = 9/384 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + A+RLYAT+D+
Sbjct  1     MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGATRLYATVDI  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              +ARVGRTR++  +  NPRWYE+FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61    GRARVGRTRVIAGDPVNPRWYEAFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE-RCWGRGVKAARFPGVPYTFFP  707
             LGG E+D WL +LD  R  +    KI V+L+F DV  + R WGRGV  AR PGVPYTFF 
Sbjct  121   LGGHEIDRWLDVLDAARKRLPHGPKIRVRLRFQDVAADPRGWGRGVGGARCPGVPYTFFS  180

Query  708   QRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYT  887
             QR GC+VTLYQDAHVP+ F PRIPLAGGR Y+  RCWED+FDAI+ A+HL+YITGWSVYT
Sbjct  181   QRPGCRVTLYQDAHVPDAFAPRIPLAGGRLYQQGRCWEDVFDAISNARHLIYITGWSVYT  240

Query  888   EITLVRDPRRP-KPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKD-GLMATHDE  1061
             EITL+RD  RP +PGGDATLGELLK+KASEGVRVLMLVWDDRTSV  L    G M+THD 
Sbjct  241   EITLLRDGARPHRPGGDATLGELLKRKASEGVRVLMLVWDDRTSVESLGMTWGFMSTHDA  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIV  1241
             ET  YF+ T+V CVLCPRNPD G S ++  +I  M THHQK VVVD EMP   ++RRRIV
Sbjct  301   ETAEYFRGTDVRCVLCPRNPDVGSSAVKGAQIAYMITHHQKTVVVDHEMPVRRSDRRRIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SF+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   SFVGGLDLCDGRYDTQFHSLFRTL  384



>ref|XP_006656220.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=820

 Score =   492 bits (1267),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 247/387 (64%), Positives = 286/387 (74%), Gaps = 12/387 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA LLLHG+L   + E D +      T G   +F K VEG E  +G  K A+RLYATIDL
Sbjct  1     MAHLLLHGTLEATILEADNLSDPTRATGGAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  354   EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              +ARVGRTR++D E  NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61    GRARVGRTRVVDGESVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGRGVKAARFPGVPYTFFP  707
             L G+ ++  L +LD  R  I     IHV+LQF DV  +R  WGRGV  AR+PGVPYTFF 
Sbjct  121   LSGQAIERRLDVLDASRKRISHGPTIHVRLQFRDVAGDRHGWGRGVCGARYPGVPYTFFS  180

Query  708   QRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYT  887
             QR GCKVTLYQDAHVP+ F PRIPLAGG  Y+  RCWED+FDAI+ AKHL+YITGWSVYT
Sbjct  181   QRPGCKVTLYQDAHVPDAFAPRIPLAGGGLYQQGRCWEDVFDAISNAKHLIYITGWSVYT  240

Query  888   EITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSV-GLLKKDGLMATHDEE  1064
             EITL+RD  R +PGGDATLG+LLK+KASEGVRVL+LVWDDRTSV  L  K G M+THD E
Sbjct  241   EITLIRDGTRQRPGGDATLGDLLKRKASEGVRVLLLVWDDRTSVESLGMKWGFMSTHDAE  300

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP----DGDTERR  1232
             T  YF+ T+V CVLCPRNPD GRS I   +I  M THHQK V+ D +MP    D  + RR
Sbjct  301   TAEYFRGTDVRCVLCPRNPDAGRSAIMGAQIAYMITHHQKTVIADHDMPVPRGDAGSGRR  360

Query  1233  RIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RIVSF+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   RIVSFVGGLDLCDGRYDTQFHSLFRTL  387



>ref|XP_012078796.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Jatropha 
curcas]
Length=807

 Score =   489 bits (1260),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 228/376 (61%), Positives = 293/376 (78%), Gaps = 6/376 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             MA +LLHG LHV ++E+D++        F +IVE  E  V   K+ S++YATI+LE+AR+
Sbjct  1     MASVLLHGILHVTIFEIDRLSGS---TFFLQIVEKCEGTVACGKSISKIYATIELEEARI  57

Query  369   GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
             GRTR L     NP+W+ESFHIYCAHMASNV FS+K+ +PIG+++IGRA +PA ++L GE 
Sbjct  58    GRTRELKHASSNPQWHESFHIYCAHMASNVTFSIKIKDPIGSQVIGRASLPAMQVLNGEA  117

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             ++ WL +L+    P+ S  KIHVKLQF DV +   W +G+ +    GVP+TFFPQR GC+
Sbjct  118   LNTWLRILNKKNKPLRS--KIHVKLQFFDVSKGSNWSKGITSPNVLGVPHTFFPQRNGCR  175

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQD+H  +N++PRIPLAGG+ YEP RCWEDIFDAI+ AKH +YITGWSVY +I L+R
Sbjct  176   VTLYQDSHFLDNYVPRIPLAGGKCYEPHRCWEDIFDAISNAKHFIYITGWSVYVKIKLIR  235

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D  R K G D  LGELLKKKA EGVRVLMLVWDD+TS  LLKKDG+MATHDE+T +YF +
Sbjct  236   DLERRKDGEDVILGELLKKKAEEGVRVLMLVWDDKTSCKLLKKDGVMATHDEDTRSYFHN  295

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             ++V+CVL PR P++  +IIQ+IE+ T+FTHHQK ++VD EM +G++E+RRIVSFIGGIDL
Sbjct  296   SKVNCVLSPRKPENWNNIIQDIEVSTIFTHHQKTLIVDSEMGNGESEKRRIVSFIGGIDL  355

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+ FH LFRTL
Sbjct  356   CDGRYDNQFHSLFRTL  371



>tpg|DAA53245.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=332

 Score =   472 bits (1215),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 218/300 (73%), Positives = 260/300 (87%), Gaps = 2/300 (1%)
 Frame = +3

Query  279   KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  455
             ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34    QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  456   VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  635
             +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94    IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  636   VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRC  815
              ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDAHVP+NF+PRI LA G+ YEP RC
Sbjct  153   GKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVPDNFVPRIQLADGKNYEPHRC  212

Query  816   WEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLML  995
             WEDIFDAI+KA+HL+YITGWSVYTEITLVRD  RPKPGGD TLGELLK+KASEGVRVLML
Sbjct  213   WEDIFDAISKAQHLIYITGWSVYTEITLVRDTNRPKPGGDVTLGELLKRKASEGVRVLML  272

Query  996   VWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTH  1175
             VWDDRTSVGLLKKDGLMATHDEET NYF  T+V+CVLCPRNPDD  S +Q+++I TMFTH
Sbjct  273   VWDDRTSVGLLKKDGLMATHDEETANYFHGTDVNCVLCPRNPDDSGSFVQDLQISTMFTH  332



>ref|XP_010090252.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB39153.1| Phospholipase D alpha 1 [Morus notabilis]
Length=788

 Score =   487 bits (1253),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 236/377 (63%), Positives = 287/377 (76%), Gaps = 23/377 (6%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR-  365
             MAQ+LLHG LH                    ++E  E +VGF K  S+LYATIDLE +R 
Sbjct  1     MAQVLLHGVLH--------------------LIEKFEEIVGFRKGTSKLYATIDLENSRS  40

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VG TR+L+ +  NPRWYESF IYCAH ASNVVF++K D PIGAE+I RAY+P   LL G+
Sbjct  41    VGSTRVLECKTWNPRWYESFDIYCAHKASNVVFTIKQDKPIGAEVIARAYLPVDELLSGK  100

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD+WL L+D+   P+H  SKIHV+++F DV ++  W +G+ + +FPGVPYTFFPQR  C
Sbjct  101   EVDQWLHLMDHKHKPLHHGSKIHVRVRFCDVSKDINWSKGIGSPKFPGVPYTFFPQRNDC  160

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             +VTLYQDAHVP  F+P+IPL G + YEP RCWEDIFD+I  AKHL+YI GWSVYT ITLV
Sbjct  161   RVTLYQDAHVPNKFLPKIPLDGDKCYEPNRCWEDIFDSICHAKHLIYIAGWSVYTRITLV  220

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD  R   GGD TL ELL +K   GVRV+MLVWDDRTS+ LLKKDGLMATHDE+T +YF+
Sbjct  221   RDAGRKMNGGDMTLRELLIEK-ERGVRVIMLVWDDRTSLKLLKKDGLMATHDEDTESYFE  279

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
             +T VHCVLCPRNPD+G+SII+ + + TMFTHHQKIVVVD E  DG + +R+IVSFIGGID
Sbjct  280   NTSVHCVLCPRNPDNGQSIIEGLAVSTMFTHHQKIVVVDSETVDGMSNKRKIVSFIGGID  339

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+PF+ +FRTL
Sbjct  340   LCDGRYDTPFYSIFRTL  356



>ref|XP_007013459.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY31078.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=806

 Score =   486 bits (1252),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 229/346 (66%), Positives = 279/346 (81%), Gaps = 3/346 (1%)
 Frame = +3

Query  282   IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVV  458
             +V+  E  VG  K  S+LY TIDLE+ RVGR+RLL+ E  N +W+ESFHIYCAH ASNVV
Sbjct  30    LVQNIEESVGVGKAFSKLYVTIDLEETRVGRSRLLENEGSNLQWHESFHIYCAHKASNVV  89

Query  459   FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  638
             FS+K ++PIGA LIGRAY+P   LL GEEVD WL ++D +  P+   S+IHVKLQF D  
Sbjct  90    FSIKENDPIGASLIGRAYLPVEELLNGEEVDRWLKVVDKEYKPLCRGSRIHVKLQFFDTT  149

Query  639   RERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRI-PLAGGRFYEPQRC  815
             R   W +G+K+ +FPGVPYTFF QR GC+VTLYQDAHVP+ FI  I PLAG ++YEP RC
Sbjct  150   RHPNWSQGIKSPKFPGVPYTFFSQREGCRVTLYQDAHVPDKFISGIIPLAGRKYYEPHRC  209

Query  816   WEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLML  995
             WEDIF AI+ AKH +YI GWSVY +IT++RD +RPKP GD TLGELL KKA+EGV VLML
Sbjct  210   WEDIFTAISNAKHFIYIAGWSVYAKITMIRDLKRPKPDGDLTLGELLIKKANEGVSVLML  269

Query  996   VWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTH  1175
             VWDDRTSV  LK+DG+MATHDE+T +YF +T+VHCVLCPRNPD   SI+Q++E+ TMFTH
Sbjct  270   VWDDRTSVEFLKEDGVMATHDEDTRHYFHNTKVHCVLCPRNPDHLHSIVQDMEVSTMFTH  329

Query  1176  HQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             HQKIVVVD E+P+ ++ +RR+VSFIGGIDLCDGRYD+P HP+FRTL
Sbjct  330   HQKIVVVDSELPNEES-KRRVVSFIGGIDLCDGRYDTPSHPIFRTL  374



>ref|NP_001058017.1| Os06g0604400 [Oryza sativa Japonica Group]
 sp|P93844.2|PLDA2_ORYSJ RecName: Full=Phospholipase D alpha 2; Short=PLD alpha 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2 [Oryza sativa Japonica 
Group]
 dbj|BAD35531.1| Phospholipase D alpha 2 [Oryza sativa Japonica Group]
 dbj|BAF19931.1| Os06g0604400 [Oryza sativa Japonica Group]
 gb|EEE65982.1| hypothetical protein OsJ_21907 [Oryza sativa Japonica Group]
Length=817

 Score =   486 bits (1252),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 245/384 (64%), Positives = 284/384 (74%), Gaps = 9/384 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1     MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  354   EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              +ARVGRTR++D E  NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61    GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVREL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGRGVKAARFPGVPYTFFP  707
             L GE ++  L +LD  R  I     IHV+LQF DV  +R  WGRGV  AR+PGVPYTFF 
Sbjct  121   LSGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGRGVSGARYPGVPYTFFS  180

Query  708   QRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYT  887
             QR GC+VTLYQDAHVP+ F PRIPLAGG +Y   RCWED+FDAI+ AKHL+Y+TGWSVYT
Sbjct  181   QRPGCRVTLYQDAHVPDAFAPRIPLAGGGYYRQGRCWEDVFDAISNAKHLIYLTGWSVYT  240

Query  888   EITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSV-GLLKKDGLMATHDEE  1064
             EITL+RD  R +PGGDATLGELLK+KASEGVRVL+LVWDDRTSV  L  K G M+THD E
Sbjct  241   EITLIRDGTRQRPGGDATLGELLKRKASEGVRVLLLVWDDRTSVESLGMKWGFMSTHDAE  300

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIV  1241
             T +YF+ T+V CVLCPRNPD GRS I   +I  M THHQK V+VD +MP       RRIV
Sbjct  301   TADYFRGTDVRCVLCPRNPDAGRSAIMGAQIAYMITHHQKTVIVDHDMPVPRGGGSRRIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SF+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   SFVGGLDLCDGRYDTQFHSLFRTL  384



>gb|EYU32345.1| hypothetical protein MIMGU_mgv1a001383mg [Erythranthe guttata]
Length=828

 Score =   486 bits (1250),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 240/394 (61%), Positives = 291/394 (74%), Gaps = 25/394 (6%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  314
             MA  LLHG+LH  +YE D++                  +T    + F + V     VVG 
Sbjct  1     MAPRLLHGTLHATIYEADRLQGRFNFDLCGGTAGNPQKRTKRFLSQFKRYVLCRPEVVG-  59

Query  315   NKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  491
                 SR+YATIDLE+ARVGRTR++ +E  NPRWYE+FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60    ----SRVYATIDLERARVGRTRMIENEPSNPRWYENFHIYCAHTVSNIVFTVKDDNPIGA  115

Query  492   ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKA  671
              LIGRAY+P   L+ G  VD W+ ++D DRNPIH  SKIHVKLQ+  V +E  W +G+K 
Sbjct  116   ILIGRAYLPVEDLISGRAVDRWIEIVDEDRNPIHGGSKIHVKLQYFHVFQESNWSQGIKT  175

Query  672   ARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAK  851
               F GVPYTFF QR+GCKV+LY DAHV E+ I +   + G +YEPQRCWED+FDAI  AK
Sbjct  176   PSFGGVPYTFFRQRQGCKVSLYPDAHVEEDNITQFLRSEG-YYEPQRCWEDMFDAIKDAK  234

Query  852   HLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLK  1031
             HL+YITGWS+YT+ITL+RDP RPKP G+ TLGELLKKKA+EGV VL+LVWDDRTSV  LK
Sbjct  235   HLIYITGWSIYTKITLIRDPTRPKPDGETTLGELLKKKANEGVNVLVLVWDDRTSVKELK  294

Query  1032  KDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP  1211
             +DGLMATHD+ET +YF++T V CVLCPRNPD+G SI+Q IE+ +MFTHHQK VVVD    
Sbjct  295   RDGLMATHDQETRDYFQNTNVRCVLCPRNPDNGHSILQGIEVSSMFTHHQKTVVVDSGGS  354

Query  1212  DGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              G  E+RRIVSF+GGIDLCDGRYD+  H +FRTL
Sbjct  355   HGGGEKRRIVSFLGGIDLCDGRYDTRKHSVFRTL  388



>ref|XP_003563661.1| PREDICTED: phospholipase D alpha 2-like [Brachypodium distachyon]
Length=823

 Score =   484 bits (1245),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 241/389 (62%), Positives = 291/389 (75%), Gaps = 14/389 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA  LLHG+LH  + E DK+      T G   +F K VEG E  +G  K ++RLYATIDL
Sbjct  1     MAHRLLHGTLHATILEADKLTDPTRATGGAPGIFRKFVEGFEETIGRGKGSTRLYATIDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              +ARVGRTR++ D+  NPRWYE FHIYCAH A++VVF+VK D PIGA L+GRAY+P R L
Sbjct  61    GRARVGRTRVIADDPVNPRWYEEFHIYCAHFAADVVFTVKADQPIGATLLGRAYLPVRDL  120

Query  531   L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR---ERCWGRGVKAARFPGVPY  695
             L   G+E++  L +LD  +  +     IHV+L+F DV      R WGRG+   RFPGVPY
Sbjct  121   LDAAGKEIERRLDVLDPGKKKLPHGPTIHVRLRFCDVAAAEGRREWGRGIGGLRFPGVPY  180

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF QR GCKVTLYQDAH P+ F PRIPL+GGR YE  RCWED+FDAI+ A+HLVY+TGW
Sbjct  181   TFFSQRPGCKVTLYQDAHTPDAFAPRIPLSGGRMYEQGRCWEDVFDAISDARHLVYVTGW  240

Query  876   SVYTEITLVRD-PRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLK-KDGLMA  1049
             SVYTEITL+RD  R P+PGGDATLGELLK+KASEGVRVLMLVWDDR+SV  +  K G M 
Sbjct  241   SVYTEITLLRDGARPPRPGGDATLGELLKRKASEGVRVLMLVWDDRSSVESIGWKQGYMG  300

Query  1050  THDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTE  1226
             THD ET +YF+ T+VHCVLCPRNPD G S+++  +I  M +HHQKI+ VD +MP  G + 
Sbjct  301   THDAETADYFRGTDVHCVLCPRNPDVGSSVVKGAQIAYMISHHQKIIAVDHDMPVRGGST  360

Query  1227  RRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             RRRIVSF+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   RRRIVSFVGGLDLCDGRYDTQFHSLFRTL  389



>ref|XP_012076566.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Jatropha 
curcas]
Length=792

 Score =   482 bits (1241),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 240/372 (65%), Positives = 285/372 (77%), Gaps = 16/372 (4%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTR  380
             LLHG+L V V+E+D I+     NLF +IV             S+LYAT+DL+KARVGRTR
Sbjct  4     LLHGTLFVTVFEIDIIQNGCGFNLFSEIV------------CSKLYATVDLDKARVGRTR  51

Query  381   LL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEW  557
             ++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D   GA LIGRAY+P   ++ G  +D W
Sbjct  52    MITNQPYNPQWFESFHIYCAHLISNVIFTVKDDQLAGATLIGRAYIPVEDVIKGYIIDRW  111

Query  558   LPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLY  737
             + +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTFF QR GC+VTLY
Sbjct  112   VEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTFFNQRHGCRVTLY  169

Query  738   QDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRR  917
             QDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSV TEITLVRDP R
Sbjct  170   QDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSVNTEITLVRDPYR  228

Query  918   PKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVH  1097
             PKPGG+  LGELLKKKA EGV VL+LVW DRTSV  LKKDGLMATH +ET  YFK+T+VH
Sbjct  229   PKPGGEVKLGELLKKKADEGVTVLVLVWKDRTSVKHLKKDGLMATHGQETKIYFKNTKVH  288

Query  1098  CVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGR  1277
             CVL PRNPDDGRS +Q   I TMFTHHQK VVVD EMPD  + +RRIVSFIGGIDLCDGR
Sbjct  289   CVLRPRNPDDGRSKVQGFAISTMFTHHQKTVVVDCEMPDDTSNKRRIVSFIGGIDLCDGR  348

Query  1278  YDSPFHPLFRTL  1313
             YD+  HPLF+TL
Sbjct  349   YDTQDHPLFKTL  360



>ref|XP_008777837.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=859

 Score =   483 bits (1243),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 301/425 (71%), Gaps = 50/425 (12%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF------------------------------H  278
             MAQ LLHG+L   ++E   +      ++                                
Sbjct  1     MAQYLLHGTLQATIFEATSLSNSNTMSMSAPKRIQKAPTTSKRRLLRRLSWIKRVSFCGR  60

Query  279   KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  455
             K+    E  VG     ++LYAT+DLEKARVGRTR++ +E  NPRWYESF IYCAH A++V
Sbjct  61    KLAGDIEESVGLGIGPAKLYATVDLEKARVGRTRVITNEPNNPRWYESFRIYCAHWAADV  120

Query  456   VFSVKVDNPIGAELIGRAYMPARRLL---GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQF  626
             +F+VK DNP+GA LIGRAY+P   +L     E VD WL +   D + +   ++IHV+L +
Sbjct  121   IFTVKADNPVGASLIGRAYLPVMDILENNNSEAVDRWLDIYREDGSQVGGGAQIHVRLWY  180

Query  627   LDVVRE--RCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPEN-FIP-RIPLAGGR  794
              DV R+  + WGRG+ + R+PGVP+TFFPQR+GCKVTLYQDAHVP++  +P RIPLAG R
Sbjct  181   WDVSRDPYQGWGRGIASPRYPGVPHTFFPQRQGCKVTLYQDAHVPDDGLVPSRIPLAGNR  240

Query  795   FYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASE  974
             +YEP+RCWEDIFDAI  A+HL+Y+TGWSVYTEITLVRDPRRP+PGGDATLGELLK+KA E
Sbjct  241   YYEPRRCWEDIFDAIANARHLIYVTGWSVYTEITLVRDPRRPRPGGDATLGELLKQKARE  300

Query  975   GVRVLMLVWDDRTSVGL--LKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQN  1148
             GVRVLMLVWDDRTS+GL  L+KDG+MATHD++T +YF+ T VHCVLCPRNPD+GRS +Q+
Sbjct  301   GVRVLMLVWDDRTSLGLGPLRKDGVMATHDQDTSSYFRGTGVHCVLCPRNPDEGRSYVQD  360

Query  1149  IEIGTMFTHHQKIVVVDGEMP----------DGDTERRRIVSFIGGIDLCDGRYDSPFHP  1298
             +E  TMFTHHQK +VVD E+P          DG   +RRI  F+GGIDLCDGRYD+ +H 
Sbjct  361   LETATMFTHHQKTLVVDVEVPGKTMAATRNDDGRRRKRRIAGFVGGIDLCDGRYDTQYHS  420

Query  1299  LFRTL  1313
             LFRTL
Sbjct  421   LFRTL  425



>dbj|BAJ85695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96017.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   480 bits (1236),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 236/386 (61%), Positives = 285/386 (74%), Gaps = 11/386 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1     MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61    GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  531   L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV-RERCWGRGVKAARFPGVPYTF  701
             L  GG+E++  L +LD  +  IH    IHV+L+F DV    R WG G+  AR PGVPYTF
Sbjct  121   LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVAANRREWGAGLGGARHPGVPYTF  180

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR GC+VTLYQDAH P+ F PRIPL+GGR Y+  RCWED+FDAI+ A+HL+Y+TGWSV
Sbjct  181   FSQRPGCRVTLYQDAHTPDAFAPRIPLSGGRTYQQGRCWEDVFDAISDARHLIYVTGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKD-GLMATHD  1058
             YTEITL+RD  RP+PGGDATLGELLK+KASEGVRVLMLVWDDRTSV  L    G M THD
Sbjct  241   YTEITLIRDGSRPRPGGDATLGELLKRKASEGVRVLMLVWDDRTSVESLGMTWGYMGTHD  300

Query  1059  EETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRR  1235
              ET  YF+ T+V CVLCPRNPD GRS +  ++   M +HHQKI+ VD +MP  G + RRR
Sbjct  301   AETAEYFRGTDVQCVLCPRNPDIGRSAVMGLQTAYMISHHQKIIAVDHDMPVRGSSSRRR  360

Query  1236  IVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             IVSF+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   IVSFVGGLDLCDGRYDTQFHSLFRTL  386



>dbj|BAJ94103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   480 bits (1236),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 236/386 (61%), Positives = 285/386 (74%), Gaps = 11/386 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1     MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61    GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  531   L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV-RERCWGRGVKAARFPGVPYTF  701
             L  GG+E++  L +LD  +  IH    IHV+L+F DV    R WG G+  AR PGVPYTF
Sbjct  121   LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVAANRREWGAGLGGARHPGVPYTF  180

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR GC+VTLYQDAH P+ F PRIPL+GGR Y+  RCWED+FDAI+ A+HL+Y+TGWSV
Sbjct  181   FSQRPGCRVTLYQDAHTPDAFAPRIPLSGGRTYQQGRCWEDVFDAISDARHLIYVTGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKD-GLMATHD  1058
             YTEITL+RD  RP+PGGDATLGELLK+KASEGVRVLMLVWDDRTSV  L    G M THD
Sbjct  241   YTEITLIRDGSRPRPGGDATLGELLKRKASEGVRVLMLVWDDRTSVESLGMTWGYMGTHD  300

Query  1059  EETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRR  1235
              ET  YF+ T+V CVLCPRNPD GRS +  ++   M +HHQKI+ VD +MP  G + RRR
Sbjct  301   AETAEYFRGTDVQCVLCPRNPDIGRSAVMGLQTAYMISHHQKIIAVDHDMPVRGSSSRRR  360

Query  1236  IVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             IVSF+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   IVSFVGGLDLCDGRYDTQFHSLFRTL  386



>ref|XP_002437251.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
 gb|EER88618.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
Length=816

 Score =   479 bits (1232),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 285/383 (74%), Gaps = 8/383 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1     MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEESLGLGQGSTRLYATVDL  60

Query  354   EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              +ARVGRTR++  +  NPRWYE+FHIYCAH ASNVVFSVK   PIGA LIGRAY+P R L
Sbjct  61    GRARVGRTRVITGDPVNPRWYEAFHIYCAHFASNVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAAR-FPGVPYTFFP  707
             + G+E++  L +L+  +  +    K+ V+L+F DV  +R           +PGVPYTFF 
Sbjct  121   IAGQEIERSLDILNASKKRLPHGPKLRVRLRFQDVAADRRGWGRGVGGARYPGVPYTFFS  180

Query  708   QRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYT  887
             QR GC+VTLYQDAH P+ F PRIPLAGGRFYEP RCWED+FDAI+ A+HL+YITGWSVYT
Sbjct  181   QRPGCRVTLYQDAHTPDAFAPRIPLAGGRFYEPGRCWEDVFDAISNARHLIYITGWSVYT  240

Query  888   EITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSV-GLLKKDGLMATHDEE  1064
             EITL+RD  RP+PGGDATLGELLK+KASEGVRVLMLVWDDRTSV  L  K G M+THD E
Sbjct  241   EITLLRDGSRPRPGGDATLGELLKRKASEGVRVLMLVWDDRTSVESLGMKWGFMSTHDAE  300

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVS  1244
             T  YF+ ++VHCVLCPRNPD G S +   +I  M THHQKI+VVD EMP   ++RRRI+S
Sbjct  301   TAEYFRGSDVHCVLCPRNPDAGSSAVMGAQIAYMITHHQKIIVVDHEMPARHSDRRRILS  360

Query  1245  FIGGIDLCDGRYDSPFHPLFRTL  1313
             F+GG+DLCDGRYD+ FH LFRTL
Sbjct  361   FVGGLDLCDGRYDTQFHSLFRTL  383



>gb|EMT32202.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=820

 Score =   479 bits (1232),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 235/386 (61%), Positives = 284/386 (74%), Gaps = 11/386 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1     MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  354   EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61    GKARVGRTRVIAGDPVNPRWYEDFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVREL  120

Query  531   L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV-VRERCWGRGVKAARFPGVPYTF  701
             L  GG E++  L +LD  +  IH    IHV+L+F DV    R WG G+  AR PGVPYTF
Sbjct  121   LDAGGREIERRLDVLDPSKKKIHHGPTIHVRLRFCDVTANRREWGAGLGGARHPGVPYTF  180

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR GC+VTLYQDAH P+ F PRIPL+GGR Y+  RCWED+FDAI+ A+HL+Y+TGWSV
Sbjct  181   FSQRPGCRVTLYQDAHTPDAFAPRIPLSGGRTYQQGRCWEDVFDAISDARHLIYVTGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKD-GLMATHD  1058
             YTEITL+RD  RP+PGGDATLGELLK+KASEGVRVLMLVWDDRTSV  L    G M THD
Sbjct  241   YTEITLIRDGSRPRPGGDATLGELLKRKASEGVRVLMLVWDDRTSVESLGMTWGYMGTHD  300

Query  1059  EETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRR  1235
              ET  YF+ T+V CVLCPRNPD GRS +  ++   M +HHQKI+ VD +MP  G + RRR
Sbjct  301   AETAEYFRGTDVQCVLCPRNPDIGRSAVMGLQTAYMISHHQKIIAVDHDMPVRGSSSRRR  360

Query  1236  IVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             IVSF+GG+DLCDGRYD+ FH LFRT+
Sbjct  361   IVSFVGGLDLCDGRYDTQFHSLFRTM  386



>dbj|BAA19466.1| phospholipase D [Oryza sativa Japonica Group]
Length=818

 Score =   478 bits (1231),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 243/384 (63%), Positives = 282/384 (73%), Gaps = 9/384 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1     MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  354   EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
              +ARVGRTR++D E  NPRWYE FHIYCAH A++VVFSVK   PIGA LI RAY+P R L
Sbjct  61    GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIDRAYLPVREL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGRGVKAARFPGVPYTFFP  707
             L GE ++  L +LD  R  I     IHV+LQF DV  +R  WGRGV  AR+PGVPYTFF 
Sbjct  121   LCGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGRGVSGARYPGVPYTFFS  180

Query  708   QRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYT  887
             QR GC+VTLYQDAHVP+ F PRIPLAGG +Y   RCWED+FDAI+ AKHL+Y+TGWSVYT
Sbjct  181   QRPGCRVTLYQDAHVPDAFAPRIPLAGGGYYRQGRCWEDVFDAISNAKHLIYLTGWSVYT  240

Query  888   EITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSV-GLLKKDGLMATHDEE  1064
             EITL+RD  R +PGGDATLGELLK+KASEGVRVL+LVWDDRTSV  L  K G M+THD E
Sbjct  241   EITLIRDGTRQRPGGDATLGELLKRKASEGVRVLLLVWDDRTSVESLGMKWGFMSTHDAE  300

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDTERRRIV  1241
             T +YF+ T+V CVLCPRNPD GRS I   +I  M THHQK V+VD +MP       RRIV
Sbjct  301   TADYFRGTDVRCVLCPRNPDAGRSAIMGAQIAYMITHHQKTVIVDHDMPVPRGGGSRRIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SF+G +DLCDGRYD+ FH LFRTL
Sbjct  361   SFVGRLDLCDGRYDTQFHSLFRTL  384



>gb|EYU23014.1| hypothetical protein MIMGU_mgv1a0192722mg, partial [Erythranthe 
guttata]
Length=479

 Score =   466 bits (1200),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 227/347 (65%), Positives = 266/347 (77%), Gaps = 3/347 (1%)
 Frame = +3

Query  282   IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVV  458
             ++E  ++ +G+  TA+  Y  I LE   VG+TR +  E     W ESF IYCAH AS+V+
Sbjct  1     VIELVKKAMGYKNTATEFYVKIGLENTTVGQTRRVPHEDTKLSWDESFQIYCAHKASHVI  60

Query  459   FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIH--SHSKIHVKLQFLD  632
             F++KVDN IGAELIG A +    L+ G+E+D  L +L  D  PI      +IHVKL+F D
Sbjct  61    FTIKVDNFIGAELIGWARIAVSELISGKEIDTGLTILHTDNEPIFLLGQPEIHVKLKFFD  120

Query  633   VVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQR  812
             V RER W RG+K   FPGVP+TFF QR GCKVTLYQDAHVP+NFIP+IPLAGG+FYEP+R
Sbjct  121   VARERYWSRGLKTPEFPGVPFTFFRQRNGCKVTLYQDAHVPDNFIPKIPLAGGKFYEPRR  180

Query  813   CWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLM  992
             CWEDIFDAI  AKH++YITGWSVY EITLVRD RRPK GGD TLGELL KKA EGVRVL+
Sbjct  181   CWEDIFDAIYNAKHMIYITGWSVYAEITLVRDRRRPKAGGDLTLGELLTKKADEGVRVLL  240

Query  993   LVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFT  1172
             LVWDDRTSVG LK+DGLM THD+ET  YF +T VHCVLCPR P  G+ +I NIEI T+FT
Sbjct  241   LVWDDRTSVGWLKEDGLMMTHDKETDKYFLNTNVHCVLCPRIPGIGQRLIHNIEIETLFT  300

Query  1173  HHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             HHQKIVVVD EMP+G +  RR+VSFIGGIDL DGRYD+ FH LFRTL
Sbjct  301   HHQKIVVVDSEMPNGSSNIRRLVSFIGGIDLYDGRYDTQFHSLFRTL  347



>ref|XP_012076565.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Jatropha 
curcas]
Length=816

 Score =   477 bits (1228),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 240/384 (63%), Positives = 288/384 (75%), Gaps = 16/384 (4%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIV---EGAERVVGFNK---------TASRLYAT  344
             LLHG+L V V+E+D I+     NLF ++       +R +   K           S+LYAT
Sbjct  4     LLHGTLFVTVFEIDIIQNGCGFNLFSEVSACQNCGKRFLSKMKRMVLCRPEIVCSKLYAT  63

Query  345   IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  521
             +DL+KARVGRTR++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D   GA LIGRAY+P 
Sbjct  64    VDLDKARVGRTRMITNQPYNPQWFESFHIYCAHLISNVIFTVKDDQLAGATLIGRAYIPV  123

Query  522   RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
               ++ G  +D W+ +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTF
Sbjct  124   EDVIKGYIIDRWVEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTF  181

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR GC+VTLYQDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSV
Sbjct  182   FNQRHGCRVTLYQDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
              TEITLVRDP RPKPGG+  LGELLKKKA EGV VL+LVW DRTSV  LKKDGLMATH +
Sbjct  241   NTEITLVRDPYRPKPGGEVKLGELLKKKADEGVTVLVLVWKDRTSVKHLKKDGLMATHGQ  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIV  1241
             ET  YFK+T+VHCVL PRNPDDGRS +Q   I TMFTHHQK VVVD EMPD  + +RRIV
Sbjct  301   ETKIYFKNTKVHCVLRPRNPDDGRSKVQGFAISTMFTHHQKTVVVDCEMPDDTSNKRRIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SFIGGIDLCDGRYD+  HPLF+TL
Sbjct  361   SFIGGIDLCDGRYDTQDHPLFKTL  384



>emb|CDP13512.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   477 bits (1228),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 236/390 (61%), Positives = 282/390 (72%), Gaps = 16/390 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGF------------NKTASR  332
             MA  LLHG+L   ++E+D+++T    N   K     +   GF                SR
Sbjct  1     MASKLLHGTLQATIFEIDRLRTGWGFNFCGKTGGPEKMARGFCARVKRAVFCRPEIVGSR  60

Query  333   LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  509
             LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61    LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  510   YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAA-RFPG  686
             Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V ++  W +G+  +    G
Sbjct  121   YLPVEEIINGFIVDRWLQILDEDGIPIQGGPKIHVKLQFFSVNQDPNWSQGIGGSLAVKG  180

Query  687   VPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYI  866
             VP TFF +R+GC VTLYQDAH+P+       L     YEPQRCWEDIFDAI  AKHL+YI
Sbjct  181   VPRTFFKERQGCHVTLYQDAHMPDTIFSNY-LESKLRYEPQRCWEDIFDAINNAKHLIYI  239

Query  867   TGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLM  1046
             TGWSVYT+ITL+RDP RPKPGGD TLGELLKKKA+EGVRVL+LVWDDRTSV  LK+DGLM
Sbjct  240   TGWSVYTQITLIRDPNRPKPGGDITLGELLKKKANEGVRVLLLVWDDRTSVETLKRDGLM  299

Query  1047  ATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMP-DGDT  1223
             ATHD+ETG++F+DT VHCVLCPRNPDDG SIIQ  E+ TMFTHHQK V+VD E+P  G  
Sbjct  300   ATHDQETGDFFRDTNVHCVLCPRNPDDGNSIIQGFEVSTMFTHHQKTVIVDSEIPGSGGE  359

Query  1224  ERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              +RRIVSF+GGIDLCDGRYD+  HPLF +L
Sbjct  360   PKRRIVSFLGGIDLCDGRYDTVAHPLFSSL  389



>ref|XP_012076563.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Jatropha 
curcas]
 gb|KDP33596.1| hypothetical protein JCGZ_07167 [Jatropha curcas]
Length=816

 Score =   476 bits (1226),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 240/384 (63%), Positives = 288/384 (75%), Gaps = 16/384 (4%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFH----------KIVEGAERVVGFNK--TASRLYAT  344
             LLHG+L V V+E+D I+     NLF           + +   +R+V        S+LYAT
Sbjct  4     LLHGTLFVTVFEIDIIQNGCGFNLFSEGIGQQNCGKRFLSKMKRMVLCRPEIVCSKLYAT  63

Query  345   IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  521
             +DL+KARVGRTR++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D   GA LIGRAY+P 
Sbjct  64    VDLDKARVGRTRMITNQPYNPQWFESFHIYCAHLISNVIFTVKDDQLAGATLIGRAYIPV  123

Query  522   RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  701
               ++ G  +D W+ +LD   NPI S  KIHVKLQ++ V ++  W +G+K  R+ GVPYTF
Sbjct  124   EDVIKGYIIDRWVEILDELHNPIGS--KIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTF  181

Query  702   FPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSV  881
             F QR GC+VTLYQDAHVP NFIPRI L GG+ YE  RCWE+IFDAI+ AKHL+YITGWSV
Sbjct  182   FNQRHGCRVTLYQDAHVPNNFIPRI-LLGGKSYEAHRCWEEIFDAISNAKHLIYITGWSV  240

Query  882   YTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDE  1061
              TEITLVRDP RPKPGG+  LGELLKKKA EGV VL+LVW DRTSV  LKKDGLMATH +
Sbjct  241   NTEITLVRDPYRPKPGGEVKLGELLKKKADEGVTVLVLVWKDRTSVKHLKKDGLMATHGQ  300

Query  1062  ETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIV  1241
             ET  YFK+T+VHCVL PRNPDDGRS +Q   I TMFTHHQK VVVD EMPD  + +RRIV
Sbjct  301   ETKIYFKNTKVHCVLRPRNPDDGRSKVQGFAISTMFTHHQKTVVVDCEMPDDTSNKRRIV  360

Query  1242  SFIGGIDLCDGRYDSPFHPLFRTL  1313
             SFIGGIDLCDGRYD+  HPLF+TL
Sbjct  361   SFIGGIDLCDGRYDTQDHPLFKTL  384



>emb|CDP13510.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   476 bits (1226),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 238/390 (61%), Positives = 285/390 (73%), Gaps = 16/390 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKI---VEGAERVVGFNKTA---------SR  332
             MA  LLHG+L   ++E+D+++T    N   K     + A R     K A         SR
Sbjct  1     MASKLLHGTLQATIFEIDRLQTGWGFNFCGKTGGPAKMARRFFARLKRAVLCRPEIVGSR  60

Query  333   LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  509
             LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61    LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  510   YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAA-RFPG  686
             Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V  +  W +G+  +  F G
Sbjct  121   YLPVEEIISGFVVDRWLQILDEDGIPIQGGPKIHVKLQFFSVNHDPNWSQGIGGSLAFKG  180

Query  687   VPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYI  866
             VP TFF +R+GC VTLYQDAH+P+       L     YEPQRCWEDIFDAI  AKHL+YI
Sbjct  181   VPRTFFKERQGCHVTLYQDAHMPDTAFSNC-LESKLRYEPQRCWEDIFDAINNAKHLIYI  239

Query  867   TGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLM  1046
             TGWSVYT+ITL+RDP RPKPGGD TLGELLKKKA+EGVRVL+LVWDDRTSV  LK+DG+M
Sbjct  240   TGWSVYTQITLIRDPYRPKPGGDITLGELLKKKANEGVRVLLLVWDDRTSVETLKRDGMM  299

Query  1047  ATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTE  1226
             ATHD+ETG++F+DT VHCVLCPRNPDDG SIIQ  E+ TMFTHHQK V+VD E+P+   E
Sbjct  300   ATHDQETGDFFRDTNVHCVLCPRNPDDGNSIIQGFEVSTMFTHHQKTVIVDSEIPESRGE  359

Query  1227  -RRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              +RRIVSF+GGIDLCDGRYD+  HPLF +L
Sbjct  360   PKRRIVSFLGGIDLCDGRYDTIAHPLFSSL  389



>ref|XP_010923204.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=859

 Score =   475 bits (1222),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 236/425 (56%), Positives = 304/425 (72%), Gaps = 50/425 (12%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYE-----------------VDKIKTDGLHNLFH-------------  278
             MAQ LLHG+L V ++E                 + K  T     L               
Sbjct  1     MAQYLLHGTLQVTIFEATSLSNSNAISVSAPKPIQKAPTTSKRRLMRRLSWIKRVSFCRP  60

Query  279   KIVEGAERVVGFNKTASRLYATIDLEKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNV  455
             K+VE  E  VGF K +++LYATIDLE+ARVGRTR +++E  NPRWYESFHIYCAH  +N+
Sbjct  61    KLVEEIEDTVGFGKGSAKLYATIDLERARVGRTRVIMNEPNNPRWYESFHIYCAHWTANI  120

Query  456   VFSVKVDNPIGAELIGRAYMPARRLLGGEE---VDEWLPLLDNDRNPIHSHSKIHVKLQF  626
             +F++K DNP+GA LIGRAY+P + +L       VD WL +   D + +   ++IHV+L +
Sbjct  121   IFTIKADNPVGASLIGRAYLPVKDILNNNNSGAVDRWLNIYREDCSQVGGGAQIHVRLWY  180

Query  627   LDVVRE--RCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPEN-FIP-RIPLAGGR  794
             LDV ++    WG+G+ + ++ GVP+TFFPQR+ CK+TLYQDAHVP+N  +P RIPL   R
Sbjct  181   LDVSKDPYLGWGQGIASLQYLGVPHTFFPQRQDCKLTLYQDAHVPDNGLVPTRIPLVDNR  240

Query  795   FYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASE  974
             +YEP RCWEDIFD IT A+HL+YITGWSVYT+ITL+RDPRRP+ GGDATLGELLK+K+ E
Sbjct  241   YYEPHRCWEDIFDTITNAQHLIYITGWSVYTDITLIRDPRRPRLGGDATLGELLKQKSRE  300

Query  975   GVRVLMLVWDDRTSVGL--LKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQN  1148
             GVRVLMLVWDDRTS+GL  L+KDG+MATHD++T +YF+ T VHC+LCPRNPD+G S +Q+
Sbjct  301   GVRVLMLVWDDRTSLGLGPLRKDGVMATHDQDTSSYFRGTGVHCILCPRNPDEGGSYVQD  360

Query  1149  IEIGTMFTHHQKIVVVDGEMP----------DGDTERRRIVSFIGGIDLCDGRYDSPFHP  1298
             +E  TMFTHHQK ++VD E+P          DG  ++RRI+SFIGGIDLCDGRYD+ +H 
Sbjct  361   LETATMFTHHQKTLIVDVEVPSKMMDGRRNDDGRRKKRRIISFIGGIDLCDGRYDTQYHS  420

Query  1299  LFRTL  1313
             LFRTL
Sbjct  421   LFRTL  425



>gb|ACI96318.1| putative phospholipase D alpha 1 precursor [Aegilops speltoides]
Length=544

 Score =   464 bits (1194),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 211/296 (71%), Positives = 253/296 (85%), Gaps = 1/296 (0%)
 Frame = +3

Query  426   IYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSK  605
             IYCAH+A++V+F++K DN IGA LIGRAY+P   LL GEE+D WL + D++R P+   SK
Sbjct  1     IYCAHLAADVIFTMKADNAIGATLIGRAYLPVSELLEGEEIDRWLEICDDNREPV-GESK  59

Query  606   IHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLA  785
             IHVKLQ+  V ++R W RGV++ +FPGVPYTFF QR+GC V LYQDAHVP+NFIP+IPLA
Sbjct  60    IHVKLQYFGVDKDRNWARGVRSVKFPGVPYTFFSQRQGCNVRLYQDAHVPDNFIPKIPLA  119

Query  786   GGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKK  965
              G+ YEP RCWEDIFDAI+ A+HL+YITGWSV+TEITL+RD  RPKPGGD TLGELLK+K
Sbjct  120   DGKNYEPARCWEDIFDAISNAQHLIYITGWSVHTEITLIRDTNRPKPGGDVTLGELLKRK  179

Query  966   ASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQ  1145
             ASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET NYF+ T+VHCVLCPRNPDD  SI+Q
Sbjct  180   ASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETANYFQGTDVHCVLCPRNPDDSGSIVQ  239

Query  1146  NIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             +++I TMFTHHQKIV VD  +P   +E+RRI+SF+GGIDLCDGRYD+ +H LFRTL
Sbjct  240   DLQISTMFTHHQKIVCVDDALPSQGSEQRRILSFVGGIDLCDGRYDTQYHSLFRTL  295



>gb|ACI96319.1| putative phospholipase D alpha 1 precursor [Secale cereale]
Length=544

 Score =   464 bits (1194),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 211/296 (71%), Positives = 253/296 (85%), Gaps = 1/296 (0%)
 Frame = +3

Query  426   IYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSK  605
             IYCAH+A++V+F++K DN IGA LIGRAY+P   LL GEE+D WL + D++R P+   SK
Sbjct  1     IYCAHLAADVIFTMKADNAIGATLIGRAYLPVSELLDGEEIDRWLEICDDNREPV-GESK  59

Query  606   IHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLA  785
             IHVKLQ+  V ++R W RGV++ +FPGVPYTFF QR+GC V LYQDAHVP+NFIP+IPLA
Sbjct  60    IHVKLQYFGVDKDRNWARGVRSVKFPGVPYTFFSQRQGCNVRLYQDAHVPDNFIPKIPLA  119

Query  786   GGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKK  965
              G+ YEP RCWEDIFDAI+ A+HL+YITGWSV+TEITL+RD  RPKPGGD TLGELLK+K
Sbjct  120   DGKNYEPARCWEDIFDAISNAQHLIYITGWSVHTEITLIRDTNRPKPGGDVTLGELLKRK  179

Query  966   ASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQ  1145
             ASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET NYF+ T+VHCVLCPRNPDD  SI+Q
Sbjct  180   ASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETANYFQGTDVHCVLCPRNPDDSGSIVQ  239

Query  1146  NIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             +++I TMFTHHQKIV VD  +P   +E+RRI+SF+GGIDLCDGRYD+ +H LFRTL
Sbjct  240   DLQISTMFTHHQKIVCVDDALPSQGSEQRRILSFVGGIDLCDGRYDTQYHSLFRTL  295



>gb|ACI96316.1| putative phospholipase D alpha 1 precursor [Triticum monococcum]
Length=544

 Score =   464 bits (1193),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 211/296 (71%), Positives = 253/296 (85%), Gaps = 1/296 (0%)
 Frame = +3

Query  426   IYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSK  605
             IYCAH+A++V+F++K DN IGA LIGRAY+P   LL GEE+D WL + D++R P+   SK
Sbjct  1     IYCAHLAADVIFTLKADNAIGATLIGRAYLPVGELLKGEEIDRWLEICDDNREPV-GESK  59

Query  606   IHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLA  785
             IHVKLQ+  V ++R W RGV++ +FPGVPYTFF QR+GC V LYQDAHVP+NFIP+IPLA
Sbjct  60    IHVKLQYFGVEKDRNWARGVRSVKFPGVPYTFFSQRQGCNVRLYQDAHVPDNFIPKIPLA  119

Query  786   GGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKK  965
              G+ YEP RCWEDIFDAI+ A+HL+YITGWSV+TEITL+RD  RPKPGGD TLGELLK+K
Sbjct  120   DGKNYEPARCWEDIFDAISNAQHLIYITGWSVHTEITLIRDTNRPKPGGDVTLGELLKRK  179

Query  966   ASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQ  1145
             ASEGVRVLMLVWDDRTSVGLLK+DGLMATHDEET NYF+ T+VHCVLCPRNPDD  SI+Q
Sbjct  180   ASEGVRVLMLVWDDRTSVGLLKRDGLMATHDEETANYFQGTDVHCVLCPRNPDDSGSIVQ  239

Query  1146  NIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             +++I TMFTHHQKIV VD  +P   +E+RRI+SF+GGIDLCDGRYD+ +H LFRTL
Sbjct  240   DLQISTMFTHHQKIVCVDDALPSQGSEQRRILSFVGGIDLCDGRYDTQYHSLFRTL  295



>ref|XP_011459180.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=814

 Score =   473 bits (1216),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 290/378 (77%), Gaps = 7/378 (2%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTD-GLHNLF---HKIVEGAERVV--GFNKTASRLYATIDLEKA  362
             LLHG+L+  +YE+DKI +  G+  L+    K V+  +R+V  G   + S++YAT+DL+KA
Sbjct  4     LLHGTLYATIYEIDKINSGCGIGLLWTSPKKFVDQVKRLVLCGPEISGSKIYATVDLDKA  63

Query  363   RVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             RV RTR+++  +NP W E FHIY AH  S+++F+VK ++PIGA LIGRAY+P   ++ G 
Sbjct  64    RVARTRMVNNPRNPIWKEDFHIYSAHNISHIIFTVKANDPIGATLIGRAYVPVEDIIKGY  123

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
              VD W+ +LD + NPIH +S+IHVKLQF  V+ +  W +G+++  + GVP+TFF QR+GC
Sbjct  124   VVDRWVEILDEEHNPIHGNSRIHVKLQFSSVIEDAHWSQGLRSPNYEGVPWTFFNQRQGC  183

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KVTLYQD+HV ++F P I +A G+ +EPQRCWEDIFDAIT AKHL+YITGWSVYTEI LV
Sbjct  184   KVTLYQDSHVEDDFHPGILMANGKIHEPQRCWEDIFDAITNAKHLIYITGWSVYTEINLV  243

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RDP+R KPG + TLG+LLKKKA EGV VL+LVWDDRTS+   KKDGLM THD+ET  YF+
Sbjct  244   RDPQRRKPGDELTLGQLLKKKADEGVLVLLLVWDDRTSIPEYKKDGLMTTHDQETEEYFR  303

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGD-TERRRIVSFIGGI  1259
             +T+V C LCPRNPD GRS IQ  E  TMFTHHQK VVVD EM  GD +++RRI+SF+GGI
Sbjct  304   NTKVRCFLCPRNPDIGRSFIQGFETSTMFTHHQKTVVVDSEMVGGDPSQKRRILSFVGGI  363

Query  1260  DLCDGRYDSPFHPLFRTL  1313
             DLCDGRYD   HPLF TL
Sbjct  364   DLCDGRYDIQKHPLFSTL  381



>ref|XP_010050012.1| PREDICTED: phospholipase D alpha 1-like [Eucalyptus grandis]
 ref|XP_010050013.1| PREDICTED: phospholipase D alpha 1-like [Eucalyptus grandis]
Length=812

 Score =   470 bits (1209),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/377 (59%), Positives = 275/377 (73%), Gaps = 1/377 (0%)
 Frame = +3

Query  186   EMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  365
             +M  +LLHG+LH+ ++EVD I        F K+ E   + +G  +    LY T+D+ K R
Sbjct  2     DMEDVLLHGTLHLKIFEVDGISGGKPAAFFRKLTEEIGKCIGCGRPTFELYTTVDIGKTR  61

Query  366   VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             V RTRL +  H N RW ESFHIYCAH AS + FS+K  +PIGA +IG A +    ++ G+
Sbjct  62    VSRTRLTESGHGNLRWNESFHIYCAHAASQITFSIKESDPIGAPVIGTASLLVSEIVKGQ  121

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
             EVD WL +   +   +H  SKIHVKL+F     +  W +G++   FPGVP+TFF QR+GC
Sbjct  122   EVDRWLKISRGEHTSLHRGSKIHVKLKFESATGDPHWSKGIRRPDFPGVPHTFFEQRKGC  181

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
             KVTLYQDAHV + F P+I LAGG+ YEP  CWEDIFDAI+ AK  VYI GWSVYTEITL+
Sbjct  182   KVTLYQDAHVEDGFTPKIHLAGGKHYEPHHCWEDIFDAISNAKQFVYIAGWSVYTEITLI  241

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
             RD +R KPGGD  LG+LLK KA EGV VLMLVWDD+TSV  LKKDG+MATHDE+T ++F 
Sbjct  242   RDLKRQKPGGDMILGDLLKMKADEGVTVLMLVWDDKTSVKDLKKDGVMATHDEDTRSFFH  301

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T VHCVLCPRNPD+GRS+ Q +EI T+FTHHQKIVVVD E   G++ +RRIVSFIGGID
Sbjct  302   GTRVHCVLCPRNPDNGRSLFQGMEIATIFTHHQKIVVVDSEASGGESGKRRIVSFIGGID  361

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+P HPLFRTL
Sbjct  362   LCDGRYDTPSHPLFRTL  378



>gb|KCW82853.1| hypothetical protein EUGRSUZ_C04222 [Eucalyptus grandis]
Length=810

 Score =   469 bits (1208),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/376 (60%), Positives = 274/376 (73%), Gaps = 1/376 (0%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  368
             M  +LLHG+LH+ ++EVD I        F K+ E   + +G  +    LY T+D+ K RV
Sbjct  1     MEDVLLHGTLHLKIFEVDGISGGKPAAFFRKLTEEIGKCIGCGRPTFELYTTVDIGKTRV  60

Query  369   GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  545
              RTRL +  H N RW ESFHIYCAH AS + FS+K  +PIGA +IG A +    ++ G+E
Sbjct  61    SRTRLTESGHGNLRWNESFHIYCAHAASQITFSIKESDPIGAPVIGTASLLVSEIVKGQE  120

Query  546   VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  725
             VD WL +   +   +H  SKIHVKL+F     +  W +G++   FPGVP+TFF QR+GCK
Sbjct  121   VDRWLKISRGEHTSLHRGSKIHVKLKFESATGDPHWSKGIRRPDFPGVPHTFFEQRKGCK  180

Query  726   VTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVR  905
             VTLYQDAHV + F P+I LAGG+ YEP  CWEDIFDAI+ AK  VYI GWSVYTEITL+R
Sbjct  181   VTLYQDAHVEDGFTPKIHLAGGKHYEPHHCWEDIFDAISNAKQFVYIAGWSVYTEITLIR  240

Query  906   DPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKD  1085
             D +R KPGGD  LG+LLK KA EGV VLMLVWDD+TSV  LKKDG+MATHDE+T ++F  
Sbjct  241   DLKRQKPGGDMILGDLLKMKADEGVTVLMLVWDDKTSVKDLKKDGVMATHDEDTRSFFHG  300

Query  1086  TEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGIDL  1265
             T VHCVLCPRNPD+GRS+ Q +EI T+FTHHQKIVVVD E   G++ +RRIVSFIGGIDL
Sbjct  301   TRVHCVLCPRNPDNGRSLFQGMEIATIFTHHQKIVVVDSEASGGESGKRRIVSFIGGIDL  360

Query  1266  CDGRYDSPFHPLFRTL  1313
             CDGRYD+P HPLFRTL
Sbjct  361   CDGRYDTPSHPLFRTL  376



>ref|XP_008219493.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=806

 Score =   468 bits (1205),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 228/383 (60%), Positives = 287/383 (75%), Gaps = 24/383 (6%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTD-GLHNLFHK-----------IVEGAERVVGFNKTASRLYAT  344
             LLHG+L   +YEVD++    GLH L+             ++ G +++VG     S+LYAT
Sbjct  4     LLHGTLLATIYEVDRLYNGCGLHLLWKSPKIFVAQIKKLVLCGPKQIVG-----SKLYAT  58

Query  345   IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  524
             +DL+KARVGRTR++++  NP+W E FHIYCAH  S+++F+VK ++ IGA LIGRAY+P  
Sbjct  59    VDLDKARVGRTRMVNDPNNPKWREDFHIYCAHNISSLIFTVKSNDLIGATLIGRAYIPVE  118

Query  525   RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFF  704
              ++ G  VD WL + D D NPI+ +S+IHVKLQF  V  +  W  G+K+ ++ GVP+TFF
Sbjct  119   EIIKGYAVDRWLEIFDEDGNPIYGNSRIHVKLQFSSVKDDFHWSLGIKSPKYDGVPWTFF  178

Query  705   PQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVY  884
              QR GC+VTLYQD+HVP +FI  IP+     YEPQRCWEDIFDAIT A+H +YITGWSVY
Sbjct  179   NQREGCRVTLYQDSHVPNDFISHIPM-----YEPQRCWEDIFDAITNARHFIYITGWSVY  233

Query  885   TEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEE  1064
             TEITL+RDP R K   D TLGELLK+KA+EGV VL+LVWDDRTSV  LKKDGLM THD+ 
Sbjct  234   TEITLLRDPSRRK--DDITLGELLKRKANEGVSVLLLVWDDRTSVEELKKDGLMTTHDQG  291

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVS  1244
             T  YF +T+VHC LCPRNPD G+SIIQ  +  TMFTHHQK +VVD EMP G++++RRIVS
Sbjct  292   TEEYFLNTKVHCFLCPRNPDVGKSIIQGFQTATMFTHHQKTIVVDSEMPGGESQKRRIVS  351

Query  1245  FIGGIDLCDGRYDSPFHPLFRTL  1313
             F+GGIDLCDGRYD+P HPLF TL
Sbjct  352   FVGGIDLCDGRYDTPKHPLFATL  374



>ref|XP_009614730.1| PREDICTED: phospholipase D alpha 1 {ECO:0000250|UniProtKB:Q41142}-like 
[Nicotiana tomentosiformis]
Length=820

 Score =   466 bits (1198),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 285/387 (74%), Gaps = 13/387 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  335
             M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1     MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  336   YATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  512
             YATIDL+KARVGRTR+  ++  NPRWYE+F IYCAH  SN++F++K +NPI A LIGRAY
Sbjct  61    YATIDLDKARVGRTRIFGNDPSNPRWYETFRIYCAHEISNIIFTIKDENPISATLIGRAY  120

Query  513   MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVP  692
             +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++  W RG+ +A F GVP
Sbjct  121   LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQDSNWSRGISSAAFGGVP  180

Query  693   YTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITG  872
             YTFF +R+GC+VTLY DA + ++ I     + G   EPQRCWEDIFDAI  AKHL+YI G
Sbjct  181   YTFFKERQGCQVTLYPDADISDDDITNYLKSQG-LLEPQRCWEDIFDAINNAKHLIYIAG  239

Query  873   WSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             WSVYT+ITL+R+P+RPK GGD TLGELLKKKASEGV VL+L+WDDRTSV +LK+DGLM+T
Sbjct  240   WSVYTKITLIRNPKRPKIGGDLTLGELLKKKASEGVNVLLLIWDDRTSVEVLKRDGLMST  299

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERR  1232
             HD+ET  YFK+T+VHC LCPRNPD G++I Q  ++GTMFTHHQK +VVD E+P G +++R
Sbjct  300   HDQETAEYFKNTDVHCCLCPRNPDSGKTITQGFQVGTMFTHHQKTIVVDSEIPGGLSQKR  359

Query  1233  RIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              I+SF+GGIDLCDGRYD+  H LFRTL
Sbjct  360   MIISFLGGIDLCDGRYDTREHSLFRTL  386



>ref|XP_009758055.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
 ref|XP_009758056.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=820

 Score =   466 bits (1198),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 285/387 (74%), Gaps = 13/387 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  335
             M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1     MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  336   YATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  512
             YATIDL+KARVGRTR+  ++  NPRWYE+F IYCAH  SN++F++K +NP+ A LIGRAY
Sbjct  61    YATIDLDKARVGRTRIFENDPSNPRWYETFRIYCAHEISNIIFTIKDENPVSATLIGRAY  120

Query  513   MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVP  692
             +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++  W RG+ +  F GVP
Sbjct  121   LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQDSNWSRGINSLAFGGVP  180

Query  693   YTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITG  872
             YTFF +R+GC+VTLY DA + ++ I     + G F EPQRCWEDIFDAI  AKHL+YI G
Sbjct  181   YTFFKERQGCQVTLYPDADISDDDITNYLKSQGLF-EPQRCWEDIFDAINNAKHLIYIAG  239

Query  873   WSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             WSVYT+ITL+R+P+RPK GGD TLGELLKKKASEGV VL+L+WDDRTSV +LK++GLM+T
Sbjct  240   WSVYTKITLIRNPKRPKIGGDLTLGELLKKKASEGVNVLLLIWDDRTSVEVLKRNGLMST  299

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERR  1232
             HD+ET  YFK+TEVHC LCPRNPD G++I Q  ++GTMFTHHQK +VVD E+P G +++R
Sbjct  300   HDQETAEYFKNTEVHCCLCPRNPDSGKTITQGFQVGTMFTHHQKTIVVDSEIPGGMSQKR  359

Query  1233  RIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              IVSF+GGIDLCDGRYD+  H LFRTL
Sbjct  360   MIVSFLGGIDLCDGRYDTREHSLFRTL  386



>ref|XP_009407292.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=815

 Score =   461 bits (1186),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 222/383 (58%), Positives = 281/383 (73%), Gaps = 8/383 (2%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  353
             M+Q LLHG LH  ++E   +      T        ++VE  E+ V F K  SR YATID+
Sbjct  1     MSQFLLHGVLHATIFEATSVSDRCRITRHAPKFVRELVEAVEKTVSFGKGWSRFYATIDI  60

Query  354   EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             E AR+GRTR++   H NPRW ESFHIYCAH A+NVVF+VK++ PIGA ++GRA +    L
Sbjct  61    EMARLGRTRVITGHHGNPRWNESFHIYCAHTAANVVFTVKLEEPIGARVVGRASLSTEEL  120

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             LG  EVD WL +LD DR P+     IHV L+F+    +  WGRGV + R+PGVP+TFF Q
Sbjct  121   LGCAEVDRWLEILDEDRRPLRGGPAIHVSLRFVAADMDPNWGRGVLSIRYPGVPHTFFSQ  180

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R GC+VTLYQD H  + F PRIPLA G+ +E  RCWEDIFDAI  A++L+YITGWSVYTE
Sbjct  181   RPGCRVTLYQDTHSSDGFFPRIPLADGKQFEAHRCWEDIFDAIQDAQNLIYITGWSVYTE  240

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGL--LKKDGLMATHDEE  1064
             ITLVRDPRRPKP GD TLGELLK+KAS+GVRVL+L+W DRT++GL  +   G+M TH E+
Sbjct  241   ITLVRDPRRPKPEGDVTLGELLKRKASQGVRVLILIWHDRTALGLGSVHYGGIMDTHCED  300

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVS  1244
             T  YF+ ++VHCVLC R+PD G S+++++++  MFTHHQK V+VD  MP+G++  R+IVS
Sbjct  301   TFCYFEGSDVHCVLCGRDPDLGDSLVEDVKVLYMFTHHQKTVIVDHAMPNGNSTMRQIVS  360

Query  1245  FIGGIDLCDGRYDSPFHPLFRTL  1313
             F+GGIDLCDGRYD  FH LFRTL
Sbjct  361   FVGGIDLCDGRYDMQFHSLFRTL  383



>gb|KJB07619.1| hypothetical protein B456_001G0333002, partial [Gossypium raimondii]
Length=806

 Score =   461 bits (1185),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 228/387 (59%), Positives = 282/387 (73%), Gaps = 15/387 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAER-----------VVGFNKTASRL  335
             M Q LLHG+L+V + E+D++K  G   L  K V   ++           V+  + T S++
Sbjct  1     MEQHLLHGTLNVTINEIDRLKISG--GLLSKDVGLLDKGKILLAQLKRLVLCQSITDSKI  58

Query  336   YATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  512
             YAT+DL+KAR  RTR++ +E +   W ESF IYC H+ S+++F+VK  NPIGA LIGRAY
Sbjct  59    YATVDLDKARAARTRMVKNEGQASPWNESFRIYCGHLISHIIFTVKYVNPIGATLIGRAY  118

Query  513   MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVP  692
             +P + ++ G  VD W+ +LD +  PIH  SKIHV LQF +V ++  W RG+K   F GVP
Sbjct  119   VPVQDIINGNIVDRWVNILDQNHVPIHGDSKIHVHLQFFNVTQDAHWSRGIKNRDFNGVP  178

Query  693   YTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITG  872
             YT+F QR+GCKVTLY+DAH  ++  P + LAGG  Y+  RCWEDIFDAI  AKH +YITG
Sbjct  179   YTYFAQRQGCKVTLYKDAHTEDDSQP-VFLAGGERYQVHRCWEDIFDAIDNAKHFIYITG  237

Query  873   WSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMAT  1052
             WSVYT+ITL+RDPRRPKPGGD TLGELLK+KA +GV VLMLVWDDRTSV  LKKDGLMAT
Sbjct  238   WSVYTKITLIRDPRRPKPGGDLTLGELLKEKAKQGVTVLMLVWDDRTSVKELKKDGLMAT  297

Query  1053  HDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERR  1232
             HDEET N FK T VHCVLCPR PD   SI+Q  +I TMFTHHQK VVVDGE+P   + +R
Sbjct  298   HDEETANVFKGTNVHCVLCPRKPDHDESIVQESDINTMFTHHQKTVVVDGELPSERSGKR  357

Query  1233  RIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
              +VSF+GGIDLCDGRYD+  HPLF TL
Sbjct  358   TVVSFVGGIDLCDGRYDTQEHPLFSTL  384



>gb|KHN07080.1| Phospholipase D alpha 1 [Glycine soja]
Length=799

 Score =   460 bits (1183),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/375 (61%), Positives = 281/375 (75%), Gaps = 18/375 (5%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGR  374
             LLHG L V +YEVD + T  D   NL  K VE            + LYATIDL+KARVGR
Sbjct  4     LLHGRLDVIIYEVDTLPTLNDCNLNLCSKFVE------------TGLYATIDLDKARVGR  51

Query  375   TRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVD  551
             T+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A LIGRAY+P  +++ G  VD
Sbjct  52    TKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATLIGRAYVPVEQVVNGNIVD  111

Query  552   EWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVT  731
             EW+ +LD D NPI S SKIHVK+QF  V  +  W +G+++ RF GVP+TFF Q+ GCKVT
Sbjct  112   EWVQILDEDHNPIPSESKIHVKMQFSSVRNDINWSQGIRSPRFQGVPHTFFSQKNGCKVT  171

Query  732   LYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLVRDP  911
             LYQDAHV + F+P IPL+GG+ YE ++CWEDI++AI  A++ +YITGWSVY+EITL+RDP
Sbjct  172   LYQDAHVSDGFVPWIPLSGGKPYEHRKCWEDIYNAIMDARNFIYITGWSVYSEITLIRDP  231

Query  912   RRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFKDTE  1091
                KP    TLGELLK KA EGV+VLMLVWDDRTSV   KKDGLMATHD+ET +YFK+T+
Sbjct  232   M--KPTTRITLGELLKMKAEEGVKVLMLVWDDRTSVPDFKKDGLMATHDQETADYFKNTK  289

Query  1092  VHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDT-ERRRIVSFIGGIDLC  1268
             V CVLCPRNPDDG+SI+Q  E  TMFTHHQK +VVD ++  G   ++R IVSF+GGIDLC
Sbjct  290   VKCVLCPRNPDDGKSIVQGFETSTMFTHHQKTIVVDTQVAMGQQGQKRTIVSFVGGIDLC  349

Query  1269  DGRYDSPFHPLFRTL  1313
             DGRYD+  HPLF TL
Sbjct  350   DGRYDTQEHPLFSTL  364



>ref|XP_007011867.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY29486.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=824

 Score =   460 bits (1183),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 228/388 (59%), Positives = 275/388 (71%), Gaps = 17/388 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGF------------NKTASR  332
             MA  LLHG L V +Y +D +K     +L  K     +    F                S+
Sbjct  1     MATHLLHGKLTVRIYGIDTLKYPSGLSLLSKATGPTQLAKLFIAQLKRIMLCQSEMIGSK  60

Query  333   LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  509
             LYAT+DL+KARV RTR++ +    P W ESF IYC H+ S+++F+VK  NPIGA LIGRA
Sbjct  61    LYATVDLDKARVARTRMISKKGSEPIWNESFRIYCGHLISDIIFTVKYANPIGATLIGRA  120

Query  510   YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  689
             ++PA  ++ G  VD W+ +LD +RNPI   SKIHV+LQF +V ++R W +G+    F GV
Sbjct  121   HIPAEDVIQGAAVDRWVDILDENRNPIPGGSKIHVQLQFFNVTQDRNWSQGISNPGFEGV  180

Query  690   PYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYIT  869
             PYTFF QR GCKVTLYQDAHV ++F    P      Y+P RCWEDIFDAI  AKHL+YIT
Sbjct  181   PYTFFSQREGCKVTLYQDAHVQDDF--SSPTMSP--YQPHRCWEDIFDAINNAKHLIYIT  236

Query  870   GWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMA  1049
             GWSVYTEITL+RDPRR KP G+ TLG+LLKKKA EGV VLMLVWDDRTSV  LK+DGLMA
Sbjct  237   GWSVYTEITLIRDPRRQKPEGNLTLGQLLKKKADEGVVVLMLVWDDRTSVKELKRDGLMA  296

Query  1050  THDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER  1229
             THD+ET +YFKDT VHCVLCPRN D+G S IQ  EI +MFTHHQK VVVD E+P   + +
Sbjct  297   THDQETADYFKDTNVHCVLCPRNRDEGESTIQGFEIASMFTHHQKTVVVDSELPRERSGK  356

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             R IVSF+GGIDLCDGRYD+  HPLF+TL
Sbjct  357   RAIVSFVGGIDLCDGRYDTQDHPLFKTL  384



>ref|XP_011039694.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011039695.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=820

 Score =   459 bits (1182),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 236/388 (61%), Positives = 291/388 (75%), Gaps = 14/388 (4%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKI---------KTDGLHNLFHKIVEGAERVVGF---NKTASR  332
             MA  LLHG+L V VY VD +         KT+G      + +   +R +     N   SR
Sbjct  1     MAPRLLHGTLDVTVYGVDNLQYGCGFSLLKTEGFLKFGKRCLVNVKRSMSCLPENVAGSR  60

Query  333   LYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  509
             LYAT+DL+KARV RTR++  E  NPRW ESFHIYCAH  S+VVF++K D+ IGA LIGRA
Sbjct  61    LYATVDLDKARVARTRMVGKEPYNPRWNESFHIYCAHSISHVVFTIKDDDAIGATLIGRA  120

Query  510   YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  689
             Y+P   +  G+ ++ W+ ++D DR P+   S++H+KLQF DV ++R W +G+K+ ++ GV
Sbjct  121   YLPVEDIPNGKILERWVEIVDEDRKPVPGGSRVHIKLQFFDVNQDRYWSQGIKSPQYEGV  180

Query  690   PYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYIT  869
             PY FF QR+GC+VTLYQDAHVP++F P+I LAG + YE  RCWEDIF+AI+ AKHL+YIT
Sbjct  181   PYVFFNQRQGCRVTLYQDAHVPDSFSPKICLAG-KHYEAHRCWEDIFEAISDAKHLIYIT  239

Query  870   GWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMA  1049
             GWSVYTEITL+RDP R KPGG+  LGELLKKKA EGV VLMLVWDDRTSV   KKDGLMA
Sbjct  240   GWSVYTEITLIRDPNRRKPGGELKLGELLKKKAEEGVTVLMLVWDDRTSVLDFKKDGLMA  299

Query  1050  THDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTER  1229
             THDEET  YF+ ++VHC+LCPRNPD GRS+IQ  ++ TMFTHHQK VVVD EMPD  T +
Sbjct  300   THDEETEKYFRGSKVHCILCPRNPDVGRSMIQGFQVSTMFTHHQKTVVVDSEMPDTVTGK  359

Query  1230  RRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             R IVSFIGGIDLCDGRYD+  HPLF+TL
Sbjct  360   REIVSFIGGIDLCDGRYDTQDHPLFKTL  387



>emb|CBI28204.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   456 bits (1172),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 233/377 (62%), Positives = 273/377 (72%), Gaps = 34/377 (9%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEG-AERVVGFNKTASRLYATIDLEKAR  365
             M Q L+HG+LH  +YEVD + T G  N   K+    ++R+VG     S++Y TIDLEKA 
Sbjct  2     MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKVYTTLSKRIVG--APISKIYVTIDLEKAG  59

Query  366   VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  542
             VGRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL GE
Sbjct  60    VGRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEGE  119

Query  543   EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  722
              VD WL L  +D  PI+  SK+HVKLQF+DV RE  W RG+++ +FPGVPYTFFPQR+GC
Sbjct  120   -VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSRGIRSPKFPGVPYTFFPQRKGC  178

Query  723   KVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEITLV  902
                                    R YEP +CWEDIF AI+ AKHLVYITGWS+YT+ TL+
Sbjct  179   -----------------------RCYEPHQCWEDIFHAISNAKHLVYITGWSLYTKTTLL  215

Query  903   RDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGNYFK  1082
                +        TLGELLKKKASEGV VLML+W+DRTSV LLKKDGLMATH E+TG YF 
Sbjct  216   FRKKT------LTLGELLKKKASEGVTVLMLLWEDRTSVKLLKKDGLMATHGEDTGKYFH  269

Query  1083  DTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIGGID  1262
              T VHCVLCPRNPD+G SI+Q+IEI  MFTHHQKIVVVD EMP+G +E RRIVSFIGG D
Sbjct  270   GTGVHCVLCPRNPDNGLSIVQDIEISAMFTHHQKIVVVDSEMPNGGSEHRRIVSFIGGFD  329

Query  1263  LCDGRYDSPFHPLFRTL  1313
             LCDGRYD+P H +FRTL
Sbjct  330   LCDGRYDTPTHSIFRTL  346



>ref|XP_011649822.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 ref|XP_011649823.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN62948.1| hypothetical protein Csa_2G381740 [Cucumis sativus]
Length=814

 Score =   457 bits (1177),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 220/380 (58%), Positives = 280/380 (74%), Gaps = 10/380 (3%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGL-------HNLFHKIVEGAERVVGFNK--TASRLYATIDL  353
             LLHG+LH  +YE+D+++T G             K + G +R +        SR+YAT+DL
Sbjct  4     LLHGTLHADIYEIDRLQT-GFPVFCGKDKRSTKKFLAGVKRCILCRPEIVGSRMYATVDL  62

Query  354   EKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  533
             +KARVGRTR++D+  NP W + F IYCAH  S+++F+VK  + IGA LIGRAY+P   ++
Sbjct  63    DKARVGRTRIVDQPYNPHWNDHFRIYCAHTVSHIIFTVKDGDFIGATLIGRAYVPVEEII  122

Query  534   GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQR  713
              G   ++W+ +LD D  P++  S+IHVKLQF  V  +R W RG+    F GVP+TFF QR
Sbjct  123   KGFVYEKWVDILDEDGKPLYGRSRIHVKLQFSSVNEDRNWSRGILDPNFEGVPFTFFKQR  182

Query  714   RGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTEI  893
              GCKV+LYQDAHV  NF+PR+ L+GG F+E  RCWEDIFDAI+ A+HL+YITGWSVYTEI
Sbjct  183   WGCKVSLYQDAHVLNNFLPRVGLSGGNFHEVHRCWEDIFDAISNARHLIYITGWSVYTEI  242

Query  894   TLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETGN  1073
             TL+RD  R + G D TLG+LLKKKA EGV VL+LVWDDRTS+ + K+DGLMATHD+ET  
Sbjct  243   TLIRDRERRQTGDDITLGQLLKKKAEEGVTVLLLVWDDRTSIEVFKRDGLMATHDQETAE  302

Query  1074  YFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFIG  1253
             YF++++V CVLCPR PD GRS IQ  E  TMFTHHQK VV+D E+  G TE+RRI+SF+G
Sbjct  303   YFRNSKVRCVLCPRRPDVGRSTIQGFETDTMFTHHQKTVVLDSEIVGGGTEKRRIISFVG  362

Query  1254  GIDLCDGRYDSPFHPLFRTL  1313
             GIDLCDGRYD+P HPLF TL
Sbjct  363   GIDLCDGRYDTPQHPLFSTL  382



>ref|XP_008394091.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Malus domestica]
Length=672

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 279/383 (73%), Gaps = 19/383 (5%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  344
             LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4     LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  345   IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  524
             IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59    IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  525   RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFF  704
              ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +  W  G++  ++ GVP TFF
Sbjct  119   DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAEDFHWSLGIRNPKYEGVPRTFF  178

Query  705   PQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVY  884
              QR GC+VTLYQD+HV + F P IP   G  YEPQRCWEDIFDAIT A+H +YITGWSVY
Sbjct  179   NQREGCRVTLYQDSHVADEFNPHIPTPLGGLYEPQRCWEDIFDAITNARHFIYITGWSVY  238

Query  885   TEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEE  1064
             T+ITL+RDPRR K   D TLG+LLK+KA EGV VL+LVWDDRTS+  LKKDGLM THD+E
Sbjct  239   TKITLLRDPRRRK--DDITLGQLLKRKADEGVLVLLLVWDDRTSIEELKKDGLMTTHDQE  296

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVS  1244
             T  YF++T+VHC LCPRNPD G+SIIQ  +  TMFTHHQK +V+D E+    +++RRIVS
Sbjct  297   TEEYFRNTKVHCFLCPRNPDVGKSIIQGFQTATMFTHHQKTIVLDSEISGRGSQKRRIVS  356

Query  1245  FIGGIDLCDGRYDSPFHPLFRTL  1313
             F+GGIDLCDGRYD+  HPLF TL
Sbjct  357   FVGGIDLCDGRYDTQEHPLFATL  379



>ref|XP_004251821.1| PREDICTED: phospholipase D alpha 1-like [Solanum lycopersicum]
Length=820

 Score =   457 bits (1175),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 217/386 (56%), Positives = 287/386 (74%), Gaps = 12/386 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  338
             M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1     MVPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  339   ATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  515
             ATIDL+KARVGRTR+  +E  NP W ++F +YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61    ATIDLDKARVGRTRIAENEPSNPHWNDTFRLYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  516   PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  695
             P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++  W RG+ +  F G+PY
Sbjct  121   PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQDSNWSRGITSLAFGGLPY  180

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF +R+GC+VTLY DA + ++ I     + G F EPQRCWEDIFDAI+ AKH++YI GW
Sbjct  181   TFFKERQGCQVTLYPDADISDDDITNYLKSQGLF-EPQRCWEDIFDAISNAKHMIYIAGW  239

Query  876   SVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATH  1055
             SVYT+ITL+R+PRRPK GG+ TLGELLKKKASEGV VL+LVWDD TS  +LK+DGLM+TH
Sbjct  240   SVYTKITLIRNPRRPKVGGELTLGELLKKKASEGVNVLLLVWDDITSDEVLKRDGLMSTH  299

Query  1056  DEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRR  1235
             D+ET +YFK+T+VHC LCPRN D G+++IQ  ++GTMFTHHQK +VVD E+P G + +R 
Sbjct  300   DQETADYFKNTDVHCCLCPRNADSGKTVIQGFQVGTMFTHHQKTIVVDTEIPGGMSHKRM  359

Query  1236  IVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             IVSF+GGIDLCDGRYD+  H LFRTL
Sbjct  360   IVSFLGGIDLCDGRYDTRDHSLFRTL  385



>ref|XP_006350007.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=819

 Score =   456 bits (1172),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 217/386 (56%), Positives = 285/386 (74%), Gaps = 12/386 (3%)
 Frame = +3

Query  189   MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  338
             M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1     MGPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  339   ATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  515
             ATIDL+KARVGRTR+  +E  NP W ++F  YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61    ATIDLDKARVGRTRIAENEPSNPHWNDTFRFYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  516   PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  695
             P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++  W RG+ +  F GVPY
Sbjct  121   PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQDSNWSRGITSPAFGGVPY  180

Query  696   TFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGW  875
             TFF +R+GC+VTLY DA + ++ I     + G F EPQRCWEDIFDAI  AKH++YI GW
Sbjct  181   TFFKERQGCQVTLYPDADISDDDITNYLKSQGLF-EPQRCWEDIFDAINNAKHMIYIAGW  239

Query  876   SVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATH  1055
             SVYT+ITL+R+P+RPK GG+ TLGELLKKKASEGV VL+LVWDD TS  +LK+DGLM+TH
Sbjct  240   SVYTKITLIRNPKRPKVGGELTLGELLKKKASEGVNVLLLVWDDITSDEVLKRDGLMSTH  299

Query  1056  DEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRR  1235
             D+ET +YFK+T+VHC LCPRN D G+++IQ  ++GTMFTHHQK +VVD E+P G + +R 
Sbjct  300   DQETADYFKNTDVHCCLCPRNADSGKTVIQGFQVGTMFTHHQKTIVVDTEIPGGMSHKRM  359

Query  1236  IVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             IVSF+GGIDLCDGRYD+  H LFRTL
Sbjct  360   IVSFLGGIDLCDGRYDTRDHSLFRTL  385



>ref|XP_006581357.1| PREDICTED: phospholipase D alpha 1-like [Glycine max]
Length=826

 Score =   455 bits (1170),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 229/393 (58%), Positives = 285/393 (73%), Gaps = 27/393 (7%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVG--------------------FNK  320
             LLHG L V +YEVD + T    NL +   +G  R VG                    F +
Sbjct  4     LLHGRLDVIIYEVDTLPTLNDCNL-NLCSKGTSRSVGKRFLSQLKSCFLCQCQCQPEFVE  62

Query  321   TASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAEL  497
             T   LYATIDL+KARVGRT+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A L
Sbjct  63    TG--LYATIDLDKARVGRTKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATL  120

Query  498   IGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAAR  677
             IGRAY+P  +++ G  VDEW+ +LD D NPI S SKIHVK+QF  V  +  W +G+++ R
Sbjct  121   IGRAYVPVEQVVNGNIVDEWVQILDEDHNPIPSESKIHVKMQFSSVRNDINWSQGIRSPR  180

Query  678   FPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHL  857
             F GVP+TFF Q+ GCKVTLYQDAHV + F+P IPL+GG+ YE ++CWEDI++AI  A++ 
Sbjct  181   FQGVPHTFFSQKNGCKVTLYQDAHVSDGFVPWIPLSGGKPYEHRKCWEDIYNAIMDARNF  240

Query  858   VYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKD  1037
             +YITGWSVY+EITL+RDP   KP    TLGELLK KA EGV+VLMLVWDDRTSV   KKD
Sbjct  241   IYITGWSVYSEITLIRDPM--KPTTRITLGELLKMKAEEGVKVLMLVWDDRTSVPDFKKD  298

Query  1038  GLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDG  1217
             GLMATHD+ET +YFK+T+V CVLCPRNPDDG+SI+Q  E  TMFTHHQK +VVD ++  G
Sbjct  299   GLMATHDQETADYFKNTKVKCVLCPRNPDDGKSIVQGFETSTMFTHHQKTIVVDTQVAMG  358

Query  1218  DT-ERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
                ++R IVSF+GGIDLCDGRYD+  HPLF TL
Sbjct  359   QQGQKRTIVSFVGGIDLCDGRYDTQEHPLFSTL  391



>ref|XP_008394090.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Malus domestica]
Length=810

 Score =   452 bits (1164),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 220/383 (57%), Positives = 279/383 (73%), Gaps = 19/383 (5%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  344
             LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4     LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  345   IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  524
             IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59    IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  525   RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFF  704
              ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +  W  G++  ++ GVP TFF
Sbjct  119   DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAEDFHWSLGIRNPKYEGVPRTFF  178

Query  705   PQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVY  884
              QR GC+VTLYQD+HV + F P IP   G  YEPQRCWEDIFDAIT A+H +YITGWSVY
Sbjct  179   NQREGCRVTLYQDSHVADEFNPHIPTPLGGLYEPQRCWEDIFDAITNARHFIYITGWSVY  238

Query  885   TEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEE  1064
             T+ITL+RDPRR K   D TLG+LLK+KA EGV VL+LVWDDRTS+  LKKDGLM THD+E
Sbjct  239   TKITLLRDPRRRK--DDITLGQLLKRKADEGVLVLLLVWDDRTSIEELKKDGLMTTHDQE  296

Query  1065  TGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVS  1244
             T  YF++T+VHC LCPRNPD G+SIIQ  +  TMFTHHQK +V+D E+    +++RRIVS
Sbjct  297   TEEYFRNTKVHCFLCPRNPDVGKSIIQGFQTATMFTHHQKTIVLDSEISGRGSQKRRIVS  356

Query  1245  FIGGIDLCDGRYDSPFHPLFRTL  1313
             F+GGIDLCDGRYD+  HPLF TL
Sbjct  357   FVGGIDLCDGRYDTQEHPLFATL  379



>ref|XP_010648662.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=825

 Score =   452 bits (1162),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 277/389 (71%), Gaps = 15/389 (4%)
 Frame = +3

Query  192   AQLLLHGSLHVCVYEVDK----------IKTDGLHNLFHKIVEGAERVVGFNK--TASRL  335
             A  +LHG+L+  ++++D+          IKT    NL  +++   +R+V        S+L
Sbjct  3     APFVLHGTLYATIFDIDRLYGGCECGHIIKTSRTQNLPKRLLGEVKRMVLCRPEVIGSKL  62

Query  336   YATIDLEKARVGRTRLLDE--HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  509
             YAT+DLEKARV RTRL++   +  PRW+ESF IYCAH  SN++F++K DNP+GA LIGRA
Sbjct  63    YATVDLEKARVARTRLIENRAYSKPRWFESFRIYCAHRISNIIFTIKEDNPVGARLIGRA  122

Query  510   YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  689
             Y+P   +  G EVD  + +LD DRNP+  HS+IHVKL F    ++  W +G+       V
Sbjct  123   YVPVEAIKSGHEVDLQVEILDEDRNPLPGHSRIHVKLHFFHAKKQSDWSKGILNPELGEV  182

Query  690   PYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYIT  869
             P TFF QR+GCKV+LYQDAHVP    P+ PL+GGRF+E  RCWEDIF AI +A+HL+YIT
Sbjct  183   PCTFFMQRQGCKVSLYQDAHVPHGGKPQFPLSGGRFHEYHRCWEDIFYAIYRAQHLIYIT  242

Query  870   GWSVYTEITLVRDPRRPKPGG-DATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLM  1046
             GWSVYT+ITLVRD   PKP     TLGELLK KA +GVRVLML+WDDRTSV  LKKDGLM
Sbjct  243   GWSVYTKITLVRDSMEPKPAQIMMTLGELLKLKADQGVRVLMLIWDDRTSVEALKKDGLM  302

Query  1047  ATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTE  1226
              THD+ET +YF+DT+V CVLCPR  D GRS +Q  E  TMFTHHQK VVVD EM D   E
Sbjct  303   ETHDQETADYFRDTKVRCVLCPRYSDRGRSTVQGFETSTMFTHHQKTVVVDSEMADIGYE  362

Query  1227  RRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             +RRIVSF+GGIDLC GRYD+  HPLFRTL
Sbjct  363   KRRIVSFVGGIDLCGGRYDTQEHPLFRTL  391



>ref|XP_007225238.1| hypothetical protein PRUPE_ppa001818mg [Prunus persica]
 gb|EMJ26437.1| hypothetical protein PRUPE_ppa001818mg [Prunus persica]
Length=761

 Score =   448 bits (1153),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 210/330 (64%), Positives = 260/330 (79%), Gaps = 7/330 (2%)
 Frame = +3

Query  324   ASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG  503
              S+LYAT+DL+KARVGRTR++++  NP+W E FHIYCAH  S+++F+VK ++ IGA LIG
Sbjct  7     GSKLYATVDLDKARVGRTRMVNDPNNPKWREDFHIYCAHNISHLIFTVKSNDLIGATLIG  66

Query  504   RAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFP  683
             RAY+P   ++ G  VD W+ +LD D NPI+ +S+IHVKLQF  V  +  W  G+K+ ++ 
Sbjct  67    RAYIPVEEIIKGYAVDRWVEILDEDGNPIYGNSRIHVKLQFSTVKDDFHWSLGIKSPKYD  126

Query  684   GVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVY  863
             GVP+TFF QR GC+VTLYQD+HVP +FI  IP      +EPQRCWEDIFDAIT A+H +Y
Sbjct  127   GVPWTFFNQREGCRVTLYQDSHVPNDFISHIPA-----HEPQRCWEDIFDAITNARHFIY  181

Query  864   ITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGL  1043
             ITGWSVYTEITL+RDP R K   D TLGELLK+KA+EGV VL+LVWDDRTSV  LKKDGL
Sbjct  182   ITGWSVYTEITLLRDPSRRK--DDITLGELLKRKANEGVSVLLLVWDDRTSVEELKKDGL  239

Query  1044  MATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDT  1223
             M THD+ T  YF +T+VHC LCPRNPD G+SIIQ  +  TMFTHHQK +VVD EMP  ++
Sbjct  240   MTTHDQGTEEYFLNTKVHCFLCPRNPDVGKSIIQGFQTATMFTHHQKTIVVDSEMPGAES  299

Query  1224  ERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             ++RRIVSF+GGIDLCDGRYD+P HPLF TL
Sbjct  300   QKRRIVSFVGGIDLCDGRYDTPKHPLFATL  329



>ref|XP_008445210.1| PREDICTED: phospholipase D alpha 1-like [Cucumis melo]
Length=814

 Score =   449 bits (1156),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/381 (57%), Positives = 280/381 (73%), Gaps = 12/381 (3%)
 Frame = +3

Query  201   LLHGSLHVCVYEVDKIKTDGLHNLF--------HKIVEGAERVVGFNK--TASRLYATID  350
             LLHG+LH  +Y +DK++T     +F         K + G +R +        SR+YAT+D
Sbjct  4     LLHGTLHADIYGIDKLQTG--FPIFCGKDKRSTKKFLAGVKRCILCRPEIVGSRMYATVD  61

Query  351   LEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  530
             L+KARVGRTR++D+  +P+W + F IYCAH  S+++F+VK  + IGA LIGRAY+P   +
Sbjct  62    LDKARVGRTRIVDQPYSPQWNDHFRIYCAHTVSHIIFTVKDGDFIGATLIGRAYVPVEEI  121

Query  531   LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  710
             + G   ++W+ +LD D  P++  S+IHVKLQF  V  +R W RG+    F  VP+TFF Q
Sbjct  122   IKGFVFEKWVDILDEDGKPLYGRSRIHVKLQFSSVNEDRNWSRGILDPNFECVPFTFFKQ  181

Query  711   RRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVYITGWSVYTE  890
             R GCKV+LYQDAHV  NF+PR+ L+GG F+E  RCWEDIFDAI+ A+HL+YITGWSVYTE
Sbjct  182   RWGCKVSLYQDAHVLNNFLPRVGLSGGNFHEVHRCWEDIFDAISNARHLIYITGWSVYTE  241

Query  891   ITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETG  1070
             ITL+RD  R + G D TLG+LLKKKA EGV VL+LVWDDRTS+ + K+DGLMATHD+ET 
Sbjct  242   ITLIRDRERRQTGDDITLGQLLKKKAEEGVTVLLLVWDDRTSIEVFKRDGLMATHDQETA  301

Query  1071  NYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDTERRRIVSFI  1250
              YF++++V CVLCPR+PD GRS IQ  E  TMFTHHQK VV+D E+  G TE+RRI+SF+
Sbjct  302   EYFRNSKVRCVLCPRSPDVGRSTIQGFETDTMFTHHQKTVVLDSEIVGGGTEKRRIISFV  361

Query  1251  GGIDLCDGRYDSPFHPLFRTL  1313
             GGIDLCDGRYD+  HPLF TL
Sbjct  362   GGIDLCDGRYDTSQHPLFSTL  382



>gb|EPS71739.1| hypothetical protein M569_03019, partial [Genlisea aurea]
Length=782

 Score =   444 bits (1142),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 213/330 (65%), Positives = 256/330 (78%), Gaps = 4/330 (1%)
 Frame = +3

Query  327   SRLYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG  503
             SR+YAT+DLE AR+GRTR++ +   NPRWYE+F IYCAH  SNVVF+VK DNPIGA LIG
Sbjct  21    SRIYATVDLEGARMGRTRMISKKASNPRWYENFRIYCAHTLSNVVFTVKDDNPIGATLIG  80

Query  504   RAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFP  683
             RAY+P   +L G+ +D W+ +LD D+NPI+  SKIHVKLQ+  V +E  W +G++   F 
Sbjct  81    RAYLPVEDILDGQIIDRWIQILDEDKNPINGGSKIHVKLQYFHVSQENNWSQGIRTPSFN  140

Query  684   GVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVY  863
             GVP+TFF QR+GCKVTLY DAHV  + + +  L+ G +  P  CWEDIFD IT AKHLVY
Sbjct  141   GVPHTFFRQRQGCKVTLYPDAHVTNDNVTQFLLSKG-YTTPNCCWEDIFDGITNAKHLVY  199

Query  864   ITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGL  1043
             I GWSVYT+ITL+RDPR  KPGGD TLGELL +KA EGV VLML+WDDRTSV  LKKDGL
Sbjct  200   IAGWSVYTKITLIRDPRVHKPGGDMTLGELLVRKADEGVNVLMLIWDDRTSVPDLKKDGL  259

Query  1044  MATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDT  1223
             MATHD+ET  YF++T V CVLCPRNPD+G SI Q IE+ TMFTHHQK V+VD +  D   
Sbjct  260   MATHDQETREYFQNTNVRCVLCPRNPDEGTSIFQGIEVSTMFTHHQKTVIVDYQ--DQSQ  317

Query  1224  ERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             ++RRI SF+GGIDLCDGRYD+  H LFRTL
Sbjct  318   QKRRIFSFLGGIDLCDGRYDTRSHSLFRTL  347



>ref|XP_009355736.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   444 bits (1142),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 256/330 (78%), Gaps = 2/330 (1%)
 Frame = +3

Query  324   ASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG  503
              S+LYATIDL+KARVGRTR++++   P+W E FHIYCAH  S+++F+VK D+ IGA LIG
Sbjct  49    GSKLYATIDLDKARVGRTRMVNDPNKPKWGEEFHIYCAHNISHIIFTVKDDDLIGATLIG  108

Query  504   RAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFP  683
             RAY+P   +L G   D W+ +LD D NPIH +SKIHVKLQF  V  +  W  G++   + 
Sbjct  109   RAYIPVEEILKGYGADRWVEILDEDHNPIHGNSKIHVKLQFSSVAEDFHWSLGIRNPTYE  168

Query  684   GVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIFDAITKAKHLVY  863
             GVP TFF QR+GC+VTLYQD+H+ + F P IP+  G  YEPQRCWED+FDAIT A++ +Y
Sbjct  169   GVPRTFFNQRQGCRVTLYQDSHIADEFNPHIPMPLGGLYEPQRCWEDVFDAITNARYFIY  228

Query  864   ITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGL  1043
             ITGWSVYT+ITL+RDPRR K   D TLG+LLK+KA EGV VL+LVWDDRTS+  LKKDGL
Sbjct  229   ITGWSVYTQITLLRDPRRRK--DDITLGQLLKRKADEGVLVLLLVWDDRTSIEELKKDGL  286

Query  1044  MATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIVVVDGEMPDGDT  1223
             M THD+ET  YF++T+VHC LCPRNPD G+SIIQ  +  TMFTHHQK +VVD E+    +
Sbjct  287   MTTHDQETEEYFRNTKVHCFLCPRNPDVGQSIIQGFQTATMFTHHQKTIVVDSEISGRGS  346

Query  1224  ERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             ++RRIVSF+GGIDLCDGRYD+  HPLF TL
Sbjct  347   QKRRIVSFVGGIDLCDGRYDTQEHPLFATL  376



>ref|XP_002308663.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
 gb|EEE92186.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
Length=771

 Score =   442 bits (1138),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/341 (65%), Positives = 270/341 (79%), Gaps = 7/341 (2%)
 Frame = +3

Query  294   AERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVK  470
             +E VVG     SRLYAT+DL+KARV RTR++ +E  NPRW ESFH+YCAH  S+VVF++K
Sbjct  5     SENVVG-----SRLYATVDLDKARVARTRMVGNEPHNPRWNESFHVYCAHSISHVVFTIK  59

Query  471   VDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC  650
              D+ IGA LIGRAY+P   +  G  ++ W+ + D DR PI   S++H+KLQF DV ++R 
Sbjct  60    DDDAIGATLIGRAYLPVEDITNGNILERWVEVEDEDRKPIPGGSRVHIKLQFFDVNQDRH  119

Query  651   WGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVPENFIPRIPLAGGRFYEPQRCWEDIF  830
             W +G+K+ ++ GVPY FF QR+GC+VTLYQDAHVP++F P+I LAG + YE  RCWEDIF
Sbjct  120   WSQGIKSPQYEGVPYVFFNQRQGCRVTLYQDAHVPDSFSPKISLAG-KLYEAHRCWEDIF  178

Query  831   DAITKAKHLVYITGWSVYTEITLVRDPRRPKPGGDATLGELLKKKASEGVRVLMLVWDDR  1010
             DAI+ AKHL+YITGWSVYTEITL+RDP R KPGG+  LGELLKKKA EGV VLMLVWDDR
Sbjct  179   DAISDAKHLIYITGWSVYTEITLIRDPNRRKPGGELKLGELLKKKAEEGVTVLMLVWDDR  238

Query  1011  TSVGLLKKDGLMATHDEETGNYFKDTEVHCVLCPRNPDDGRSIIQNIEIGTMFTHHQKIV  1190
             TSV   KKDGLMATHDEET  YF+ ++VHC+LCPRNPD GRS+IQ  ++ TMFTHHQK V
Sbjct  239   TSVLDFKKDGLMATHDEETEKYFRGSKVHCILCPRNPDVGRSVIQGFQVSTMFTHHQKTV  298

Query  1191  VVDGEMPDGDTERRRIVSFIGGIDLCDGRYDSPFHPLFRTL  1313
             VVD EM D  + +R IVSFIGGIDLCDGRYD+  HPLF+TL
Sbjct  299   VVDSEMLDTVSGKRGIVSFIGGIDLCDGRYDTQDHPLFKTL  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3820435310730