BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11940

Length=793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794279.1|  PREDICTED: hydroxyphenylpyruvate reductase         296   6e-95   Nicotiana sylvestris
ref|XP_009588864.1|  PREDICTED: hydroxyphenylpyruvate reductase         295   2e-94   Nicotiana tomentosiformis
ref|XP_004250408.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    291   1e-92   Solanum lycopersicum
ref|XP_006361376.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    291   1e-92   Solanum tuberosum [potatoes]
emb|CDP16491.1|  unnamed protein product                                284   5e-90   Coffea canephora [robusta coffee]
ref|XP_010317839.1|  PREDICTED: formate dehydrogenase, mitochondr...    273   5e-87   
gb|EYU28234.1|  hypothetical protein MIMGU_mgv1a007209mg                276   1e-86   Erythranthe guttata [common monkey flower]
ref|XP_002319339.2|  hypothetical protein POPTR_0013s10050g             272   1e-85   Populus trichocarpa [western balsam poplar]
ref|XP_008218923.1|  PREDICTED: formate dehydrogenase, mitochondr...    270   4e-85   
ref|XP_011003972.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    271   5e-85   Populus euphratica
ref|XP_011003977.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    270   5e-85   Populus euphratica
ref|XP_008218922.1|  PREDICTED: formate dehydrogenase, mitochondr...    270   5e-85   Prunus mume [ume]
ref|XP_008218920.1|  PREDICTED: formate dehydrogenase, mitochondr...    270   6e-85   Prunus mume [ume]
ref|XP_011003974.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    270   7e-85   Populus euphratica
ref|XP_011003978.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    269   8e-85   Populus euphratica
ref|XP_011003971.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    270   9e-85   Populus euphratica
ref|XP_011003975.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    270   1e-84   Populus euphratica
ref|XP_011003976.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    270   1e-84   Populus euphratica
ref|XP_008218916.1|  PREDICTED: formate dehydrogenase, mitochondr...    268   3e-84   
ref|XP_008218915.1|  PREDICTED: formate dehydrogenase, mitochondr...    268   3e-84   Prunus mume [ume]
gb|ABK96037.1|  unknown                                                 267   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_011074952.1|  PREDICTED: formate dehydrogenase, mitochondrial    269   3e-84   Sesamum indicum [beniseed]
ref|XP_007223301.1|  hypothetical protein PRUPE_ppa007293mg             267   1e-83   Prunus persica
ref|XP_010665337.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    266   2e-83   Vitis vinifera
ref|XP_002282092.2|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    266   2e-83   Vitis vinifera
ref|XP_010665338.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    265   2e-83   Vitis vinifera
gb|KJB55666.1|  hypothetical protein B456_009G087500                    265   3e-83   Gossypium raimondii
gb|KJB55664.1|  hypothetical protein B456_009G087500                    266   4e-83   Gossypium raimondii
gb|KJB55660.1|  hypothetical protein B456_009G087500                    265   5e-83   Gossypium raimondii
gb|KHG10814.1|  Glyoxylate reductase                                    265   5e-83   Gossypium arboreum [tree cotton]
ref|XP_010665339.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    263   1e-82   Vitis vinifera
ref|XP_007015902.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    261   3e-82   
ref|XP_007015900.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    261   7e-82   
ref|XP_008218917.1|  PREDICTED: formate dehydrogenase, mitochondr...    261   7e-82   Prunus mume [ume]
ref|XP_007015899.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    261   3e-81   
ref|XP_007015901.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    261   3e-81   
ref|XP_011457341.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    256   5e-80   Fragaria vesca subsp. vesca
ref|XP_010243882.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    256   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010243885.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    254   6e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010910119.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    253   2e-78   Elaeis guineensis
gb|KDO56053.1|  hypothetical protein CISIN_1g0174901mg                  248   3e-78   Citrus sinensis [apfelsine]
gb|KDO56054.1|  hypothetical protein CISIN_1g0174901mg                  248   3e-78   Citrus sinensis [apfelsine]
gb|KDO56056.1|  hypothetical protein CISIN_1g0174901mg                  247   3e-78   Citrus sinensis [apfelsine]
gb|KCW70960.1|  hypothetical protein EUGRSUZ_F04070                     248   6e-78   Eucalyptus grandis [rose gum]
gb|KCW70956.1|  hypothetical protein EUGRSUZ_F04070                     248   7e-78   Eucalyptus grandis [rose gum]
ref|XP_010910114.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    252   8e-78   Elaeis guineensis
ref|XP_006441523.1|  hypothetical protein CICLE_v10020311mg             248   2e-77   
ref|XP_006441524.1|  hypothetical protein CICLE_v10020311mg             248   2e-77   
ref|XP_009379254.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    251   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_008378743.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase      251   3e-77   
ref|XP_009379261.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    251   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_010535279.1|  PREDICTED: formate dehydrogenase, mitochondrial    250   4e-77   Tarenaya hassleriana [spider flower]
ref|XP_006390689.1|  hypothetical protein EUTSA_v10018793mg             249   6e-77   
ref|XP_006441520.1|  hypothetical protein CICLE_v10020311mg             248   1e-76   
ref|XP_010063709.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    248   2e-76   Eucalyptus grandis [rose gum]
gb|KDO56050.1|  hypothetical protein CISIN_1g0174901mg                  247   2e-76   Citrus sinensis [apfelsine]
ref|XP_010063710.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    247   2e-76   Eucalyptus grandis [rose gum]
ref|XP_002521771.1|  phosphoglycerate dehydrogenase, putative           248   2e-76   Ricinus communis
ref|XP_003598073.1|  D-3-phosphoglycerate dehydrogenase                 248   2e-76   Medicago truncatula
gb|KDO56049.1|  hypothetical protein CISIN_1g0174901mg                  247   3e-76   Citrus sinensis [apfelsine]
ref|XP_006441517.1|  hypothetical protein CICLE_v10020311mg             247   3e-76   Citrus clementina [clementine]
ref|XP_006478176.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    246   4e-76   Citrus sinensis [apfelsine]
gb|AFK43325.1|  unknown                                                 246   6e-76   Medicago truncatula
ref|XP_006478175.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    246   7e-76   
ref|XP_006478174.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    248   9e-76   
ref|XP_004499721.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    246   1e-75   Cicer arietinum [garbanzo]
gb|KJB55663.1|  hypothetical protein B456_009G087500                    246   2e-75   Gossypium raimondii
ref|XP_006441521.1|  hypothetical protein CICLE_v10020311mg             247   2e-75   Citrus clementina [clementine]
gb|KJB55658.1|  hypothetical protein B456_009G087500                    244   2e-75   Gossypium raimondii
ref|XP_006441518.1|  hypothetical protein CICLE_v10020311mg             247   2e-75   Citrus clementina [clementine]
ref|XP_004139684.2|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    244   2e-75   Cucumis sativus [cucumbers]
ref|XP_004499720.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    246   2e-75   
ref|XP_006478173.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    246   3e-75   Citrus sinensis [apfelsine]
ref|XP_007015897.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    244   4e-75   
ref|XP_007015898.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    243   4e-75   
ref|XP_012079725.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    243   6e-75   Jatropha curcas
tpg|DAA39792.1|  TPA: hypothetical protein ZEAMMB73_065837              245   6e-75   
ref|XP_008667394.1|  PREDICTED: uncharacterized protein LOC100217...    244   9e-75   Zea mays [maize]
gb|KHN24796.1|  D-3-phosphoglycerate dehydrogenase                      244   9e-75   Glycine soja [wild soybean]
ref|XP_008461934.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    242   1e-74   Cucumis melo [Oriental melon]
ref|XP_002888861.1|  oxidoreductase family protein                      243   2e-74   
ref|XP_010474292.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    241   2e-74   
ref|NP_001242647.1|  uncharacterized protein LOC100785085               243   2e-74   Glycine max [soybeans]
ref|NP_177364.2|  D-isomer specific 2-hydroxyacid dehydrogenase d...    243   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148628.1|  hypothetical protein PHAVU_005G002200g             243   3e-74   Phaseolus vulgaris [French bean]
gb|AAG51802.1|AC067754_18  phosphoglycerate dehydrogenase, putati...    242   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008461933.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    241   3e-74   
ref|XP_008667393.1|  PREDICTED: uncharacterized protein LOC100217...    244   4e-74   
ref|NP_001137068.1|  uncharacterized protein LOC100217241               242   5e-74   Zea mays [maize]
ref|XP_006577809.1|  PREDICTED: uncharacterized protein LOC100785...    241   6e-74   Glycine max [soybeans]
gb|KFK41640.1|  hypothetical protein AALP_AA2G154000                    240   3e-73   Arabis alpina [alpine rockcress]
ref|XP_008667395.1|  PREDICTED: uncharacterized protein LOC100217...    239   3e-73   Zea mays [maize]
ref|XP_010428086.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    240   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002459676.1|  hypothetical protein SORBIDRAFT_02g008660          240   4e-73   Sorghum bicolor [broomcorn]
ref|XP_008802909.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    239   1e-72   Phoenix dactylifera
ref|XP_010414841.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    238   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008802910.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    237   1e-72   Phoenix dactylifera
tpg|DAA39795.1|  TPA: hypothetical protein ZEAMMB73_065837              238   2e-72   
ref|XP_010471237.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    237   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_003557318.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    235   3e-71   Brachypodium distachyon [annual false brome]
ref|XP_006301744.1|  hypothetical protein CARUB_v10022205mg             234   4e-71   
ref|XP_010415950.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxylate r...    233   1e-70   Camelina sativa [gold-of-pleasure]
gb|EEC81831.1|  hypothetical protein OsI_25581                          233   1e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_007015896.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    233   1e-70   
gb|AER41609.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    233   2e-70   Oryza glaberrima
ref|XP_004984235.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    231   3e-70   
ref|XP_010683411.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    230   4e-70   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD31969.1|  phosphoglycerate dehydrogenase-like protein            230   9e-70   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059330.1|  Os07g0264100                                       231   1e-69   
ref|XP_009393479.1|  PREDICTED: formate dehydrogenase, mitochondr...    229   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393478.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    230   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX68275.1|  BnaA07g23150D                                          229   4e-69   
ref|XP_010095912.1|  Retrovirus-related Pol polyprotein from tran...    229   5e-69   
gb|EMT11768.1|  Glyoxylate reductase                                    228   6e-69   
gb|EMS56366.1|  Glyoxylate reductase                                    228   6e-69   Triticum urartu
emb|CDY50445.1|  BnaC06g24190D                                          229   6e-69   Brassica napus [oilseed rape]
gb|EPS66269.1|  hypothetical protein M569_08508                         228   8e-69   Genlisea aurea
dbj|BAK05235.1|  predicted protein                                      227   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03270.1|  predicted protein                                      227   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02358.1|  predicted protein                                      227   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009104868.1|  PREDICTED: formate dehydrogenase, mitochondr...    227   2e-68   Brassica rapa
dbj|BAK00574.1|  predicted protein                                      227   3e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009104867.1|  PREDICTED: formate dehydrogenase, mitochondr...    227   3e-68   Brassica rapa
ref|XP_006657609.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    223   3e-67   
ref|XP_009379247.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    224   8e-67   Pyrus x bretschneideri [bai li]
gb|ERN20040.1|  hypothetical protein AMTR_s00071p00183090               222   3e-66   Amborella trichopoda
ref|XP_011628648.1|  PREDICTED: formate dehydrogenase, mitochondrial    222   4e-66   
ref|XP_004963884.1|  PREDICTED: formate dehydrogenase 1, mitochon...    223   8e-65   
ref|XP_011628610.1|  PREDICTED: formate dehydrogenase, mitochondr...    212   6e-63   Amborella trichopoda
ref|XP_006858572.1|  PREDICTED: formate dehydrogenase, mitochondr...    212   1e-62   
gb|ABR18201.1|  unknown                                                 208   3e-61   Picea sitchensis
gb|KGN44470.1|  hypothetical protein Csa_7G302340                       201   6e-59   Cucumis sativus [cucumbers]
ref|XP_011659111.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    201   1e-58   Cucumis sativus [cucumbers]
ref|XP_001766047.1|  predicted protein                                  193   2e-55   
ref|XP_010683622.1|  PREDICTED: formate dehydrogenase 2, mitochon...    188   5e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001767463.1|  predicted protein                                  188   1e-53   
ref|XP_002459677.1|  hypothetical protein SORBIDRAFT_02g008670          186   2e-52   
dbj|BAC22329.1|  putative phosphoglycerate dehydrogenase                176   4e-49   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70397.1|  hypothetical protein VITISV_016521                     174   5e-49   Vitis vinifera
gb|AER41608.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    175   1e-48   Oryza glaberrima
gb|AER41626.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    174   2e-48   Oryza glumipatula
gb|KCW70958.1|  hypothetical protein EUGRSUZ_F04070                     162   2e-44   Eucalyptus grandis [rose gum]
gb|AER41584.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    164   5e-44   Oryza brachyantha
ref|XP_010473742.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    152   1e-41   
gb|KDO56044.1|  hypothetical protein CISIN_1g044056mg                   145   6e-39   Citrus sinensis [apfelsine]
ref|XP_005646982.1|  hypothetical protein COCSUDRAFT_37061              147   6e-38   Coccomyxa subellipsoidea C-169
gb|KCW70959.1|  hypothetical protein EUGRSUZ_F04070                     142   9e-37   Eucalyptus grandis [rose gum]
ref|XP_003063700.1|  predicted protein                                  134   6e-33   Micromonas pusilla CCMP1545
ref|XP_002505587.1|  predicted protein                                  132   4e-32   Micromonas commoda
ref|XP_005849953.1|  hypothetical protein CHLNCDRAFT_143308             130   9e-32   Chlorella variabilis
ref|XP_007015903.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    126   5e-31   
ref|XP_001422519.1|  predicted protein                                  120   3e-28   Ostreococcus lucimarinus CCE9901
ref|XP_003082919.1|  oxidoreductase family protein (ISS)                117   4e-27   Ostreococcus tauri
gb|KDD72690.1|  hypothetical protein H632_c3019p0                       114   4e-26   Helicosporidium sp. ATCC 50920
ref|XP_007509693.1|  predicted protein                                  115   4e-26   Bathycoccus prasinos
ref|XP_002179420.1|  predicted protein                                  113   2e-25   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_011399491.1|  D-3-phosphoglycerate dehydrogenase                 110   2e-24   Auxenochlorella protothecoides
ref|XP_008461935.1|  PREDICTED: formate dehydrogenase, mitochondr...    107   1e-23   
ref|WP_024966984.1|  lactate dehydrogenase                              107   1e-23   Pantoea sp. IMH
dbj|BAJ91330.1|  predicted protein                                      106   3e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005828939.1|  hypothetical protein GUITHDRAFT_46401              105   4e-23   Guillardia theta CCMP2712
ref|WP_025420783.1|  lactate dehydrogenase                              105   7e-23   Sodalis praecaptivus
ref|WP_012107589.1|  D-isomer specific 2-hydroxyacid dehydrogenase      104   1e-22   Methanoregula boonei
ref|WP_021184805.1|  D-3-phosphoglycerate dehydrogenase                 104   1e-22   Pantoea sp. AS-PWVM4
ref|WP_039329515.1|  lactate dehydrogenase                              104   1e-22   Pantoea
ref|WP_045815940.1|  lactate dehydrogenase                              103   3e-22   Pantoea sp. SM3
ref|WP_034826230.1|  lactate dehydrogenase                              103   4e-22   Enterobacter cancerogenus
ref|WP_028671049.1|  lactate dehydrogenase                              103   5e-22   Saccharospirillum impatiens
ref|WP_041287365.1|  hypothetical protein                               101   1e-21   
gb|AFM26624.1|  phosphoglycerate dehydrogenase-like oxidoreductase      102   1e-21   Desulfomonile tiedjei DSM 6799
ref|WP_013507782.1|  lactate dehydrogenase                              101   2e-21   Pantoea sp. At-9b
ref|WP_035265554.1|  lactate dehydrogenase                              101   2e-21   Desulfosarcina sp. BuS5
gb|EWM13769.1|  D-3-phosphoglycerate dehydrogenase                    99.4    2e-21   Kutzneria sp. 744
ref|XP_008189273.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    100   3e-21   Acyrthosiphon pisum
ref|WP_029912678.1|  lactate dehydrogenase                              100   4e-21   
ref|WP_043730098.1|  hypothetical protein                             95.5    5e-21   
ref|WP_045832844.1|  lactate dehydrogenase                            99.8    7e-21   Pantoea sp. BL1
ref|WP_013200656.1|  lactate dehydrogenase                            99.4    9e-21   Erwinia billingiae
ref|WP_015906531.1|  lactate dehydrogenase                            99.0    1e-20   Desulfobacterium autotrophicum
ref|WP_020880970.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  97.8    3e-20   Desulfovibrio sp. X2
ref|WP_034897846.1|  lactate dehydrogenase                            97.1    6e-20   Erwinia typographi
ref|WP_015878860.1|  lactate dehydrogenase                            97.1    6e-20   Tolumonas auensis
ref|WP_020711063.1|  hypothetical protein                             97.1    6e-20   Acidobacteriaceae bacterium KBS 83
gb|AHF97449.1|  lactate dehydrogenase                                 96.3    1e-19   Desulfurella acetivorans A63
ref|WP_038649217.1|  lactate dehydrogenase                            96.3    1e-19   Pantoea rwandensis
ref|WP_018335712.1|  hypothetical protein                             95.1    2e-19   Actinomycetospora chiangmaiensis
ref|WP_034949039.1|  lactate dehydrogenase                            94.4    4e-19   Erwinia oleae
ref|WP_040401337.1|  hypothetical protein                             92.4    2e-18   
ref|WP_034912135.1|  lactate dehydrogenase                            92.0    2e-18   Erwinia sp. 9145
ref|WP_009201581.1|  glyoxylate reductase                             90.9    8e-18   Acetomicrobium hydrogeniformans
ref|WP_038572953.1|  hypothetical protein                             89.7    1e-17   
ref|WP_014806274.1|  glyoxylate reductase                             90.1    1e-17   Acetomicrobium
ref|WP_018114836.1|  hypothetical protein                             89.0    3e-17   Rhizobiales bacterium
ref|WP_013570641.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  89.0    3e-17   Terriglobus saanensis
ref|WP_026988575.1|  hypothetical protein                             88.2    5e-17   Fodinicurvata fenggangensis
ref|WP_041919487.1|  hypothetical protein                             86.7    1e-16   
ref|WP_022842734.1|  lactate dehydrogenase                            87.0    1e-16   Acidobacteriaceae bacterium TAA166
gb|AFZ33157.1|  Glyoxylate reductase                                  86.7    2e-16   Gloeocapsa sp. PCC 7428
ref|WP_037135542.1|  2-hydroxyacid dehydrogenase                      84.7    8e-16   Rhizobium sp. CF394
ref|WP_017800580.1|  lactate dehydrogenase                            84.7    8e-16   Erwinia toletana
ref|WP_024821851.1|  hypothetical protein                             84.7    8e-16   Aminobacterium mobile
ref|WP_033397128.1|  lactate dehydrogenase                            84.3    1e-15   
ref|WP_041446076.1|  hypothetical protein                             83.2    3e-15   
gb|AER67036.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  83.2    3e-15   Thermovirga lienii DSM 17291
ref|WP_004073201.1|  lactate dehydrogenase                            80.9    2e-14   Desulfobacter postgatei
ref|WP_012940091.1|  3-phosphoglycerate dehydrogenase                 82.8    2e-14   Archaeoglobus profundus
ref|WP_022726624.1|  lactate dehydrogenase                            80.9    2e-14   
ref|WP_029716541.1|  hypothetical protein                             80.5    3e-14   
ref|WP_017824164.1|  3-phosphoglycerate dehydrogenase                 79.7    2e-13   Brachybacterium muris
ref|WP_038369993.1|  3-phosphoglycerate dehydrogenase                 79.7    2e-13   Brachybacterium phenoliresistens
ref|WP_044400573.1|  2-hydroxyacid dehydrogenase                      77.8    3e-13   Lacinutrix sp. Hel_I_90
gb|KJU82091.1|  NAD-binding D-isomer specific 2-hydroxyacid dehyd...  76.6    5e-13   Candidatus Magnetobacterium bavaricum
emb|CCK81373.1|  D-isomer specific 2-hydroxyacid dehydrogenase NA...  73.6    9e-13   Desulfobacula toluolica Tol2
ref|WP_006877083.1|  phosphoglycerate dehydrogenase                   75.9    1e-12   Anaerotruncus colihominis
ref|WP_007127461.1|  phosphoglycerate dehydrogenase                   75.9    1e-12   Paenibacillus lactis
ref|WP_012269747.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        75.9    1e-12   Thermoanaerobacter
ref|WP_012994332.1|  2-hydroxyacid dehydrogenase                      75.5    2e-12   Thermoanaerobacter italicus
ref|WP_020812372.1|  3-phosphoglycerate dehydrogenase                 75.1    2e-12   Agrobacterium
ref|WP_015775903.1|  D-3-phosphoglycerate dehydrogenase               76.6    2e-12   Brachybacterium faecium
ref|WP_002705675.1|  phosphoglycerate dehydrogenase                   75.1    2e-12   Microscilla marina
ref|WP_026414719.1|  3-phosphoglycerate dehydrogenase                 76.3    2e-12   Actinomadura oligospora
ref|WP_015782796.1|  2-hydroxyacid dehydrogenase                      75.1    2e-12   Capnocytophaga ochracea
ref|WP_002671550.1|  2-hydroxyacid dehydrogenase                      75.1    2e-12   Capnocytophaga ochracea
ref|WP_013048792.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  75.1    3e-12   Aminobacterium colombiense
ref|WP_027884821.1|  2-hydroxyacid dehydrogenase                      74.7    3e-12   Mesonia mobilis
ref|WP_009418381.1|  2-hydroxyacid dehydrogenase                      74.7    3e-12   Capnocytophaga sp. oral taxon 335
ref|WP_022827611.1|  2-hydroxyacid dehydrogenase                      74.7    3e-12   Flavobacterium antarcticum
ref|WP_010974651.1|  MULTISPECIES: phosphoglycerate dehydrogenase     74.7    3e-12   Agrobacterium tumefaciens complex
ref|WP_038240094.1|  2-hydroxyacid dehydrogenase                      74.7    3e-12   Zobellia uliginosa
gb|EDP97261.1|  phosphoglycerate dehydrogenase                        74.3    4e-12   Kordia algicida OT-1
ref|WP_012966581.1|  3-phosphoglycerate dehydrogenase                 75.5    4e-12   Ferroglobus placidus
ref|WP_028404925.1|  phosphoglycerate dehydrogenase                   74.3    4e-12   Bacillus sp. J13
ref|WP_013149652.1|  2-hydroxyacid dehydrogenase                      74.3    5e-12   Thermoanaerobacter mathranii
ref|WP_009411355.1|  4-phosphoerythronate dehydrogenase               73.9    5e-12   Capnocytophaga sp. oral taxon 324
ref|WP_019153484.1|  hypothetical protein                             74.3    5e-12   Bacillus massiliosenegalensis
ref|WP_028991991.1|  2-hydroxyacid dehydrogenase                      73.9    5e-12   Thermoanaerobacter thermocopriae
ref|WP_040559680.1|  2-hydroxyacid dehydrogenase                      73.9    5e-12   Kordia algicida
ref|WP_003868999.1|  2-hydroxyacid dehydrogenase                      73.9    6e-12   
ref|WP_009415814.1|  4-phosphoerythronate dehydrogenase               73.9    6e-12   Capnocytophaga sp. oral taxon 332
ref|XP_008347855.1|  PREDICTED: uncharacterized protein LOC103410984  71.2    6e-12   
ref|WP_003868264.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        73.9    6e-12   Thermoanaerobacter
ref|WP_034132100.1|  hypothetical protein                             73.9    6e-12   
ref|WP_004097881.1|  hydroxyacid dehydrogenase                        73.6    7e-12   Acetonema longum
ref|WP_021640963.1|  putative glyoxylate reductase [                  73.6    7e-12   [Clostridium] symbiosum
ref|WP_015752989.1|  2-hydroxyacid dehydrogenase                      73.6    8e-12   Robiginitalea biformata
ref|WP_011246686.1|  3-phosphoglycerate dehydrogenase                 74.7    8e-12   Bacillus
ref|WP_003504829.1|  MULTISPECIES: hypothetical protein               73.6    8e-12   Clostridiales
ref|WP_002678833.1|  2-hydroxyacid dehydrogenase                      73.6    9e-12   Capnocytophaga sputigena
ref|WP_044231804.1|  dihydrofolate reductase                          73.2    9e-12   Porphyromonas sp. COT-290 OH3588
ref|WP_010552280.1|  3-phosphoglycerate dehydrogenase                 74.3    1e-11   Brachybacterium paraconglomeratum
ref|WP_028289702.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        72.8    1e-11   Olleya
ref|WP_044186408.1|  dihydrofolate reductase                          72.8    1e-11   Porphyromonas sp. COT-290 OH860
ref|WP_013253378.1|  phosphoglycerate dehydrogenase                   72.8    1e-11   Sediminispirochaeta smaragdinae
gb|EIW93851.1|  4-phosphoerythronate dehydrogenase                    72.4    2e-11   Capnocytophaga sp. oral taxon 412 str. F0487
ref|WP_026451779.1|  2-hydroxyacid dehydrogenase                      72.4    2e-11   Aequorivita capsosiphonis
ref|WP_014757321.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   73.6    2e-11   Thermoanaerobacterium aotearoense
ref|WP_016478770.1|  D-3-phosphoglycerate dehydrogenase               72.4    2e-11   Capnocytophaga sp. oral taxon 336
ref|WP_019633072.1|  3-phosphoglycerate dehydrogenase                 73.6    2e-11   Actinomadura atramentaria
ref|WP_009389133.1|  2-hydroxyacid dehydrogenase                      72.4    2e-11   Capnocytophaga sp. oral taxon 329
ref|WP_011021352.1|  glycerate dehydrogenase                          72.4    2e-11   
ref|WP_044637687.1|  2-hydroxyacid dehydrogenase                      72.4    2e-11   Siansivirga zeaxanthinifaciens
ref|WP_026913907.1|  2-hydroxyacid dehydrogenase                      72.4    2e-11   Gramella portivictoriae
ref|WP_013276648.1|  2-hydroxyacid dehydrogenase                      72.0    2e-11   Thermosediminibacter oceani
ref|WP_034575496.1|  2-hydroxyacid dehydrogenase                      72.0    2e-11   Capnocytophaga sp. oral taxon 412
ref|WP_035759920.1|  2-hydroxyacid dehydrogenase                      72.0    3e-11   
ref|WP_025641806.1|  phosphoglycerate dehydrogenase [                 72.0    3e-11   [Clostridium] scindens
ref|WP_004569424.1|  2-hydroxyacid dehydrogenase                      72.0    3e-11   Polaribacter irgensii
ref|WP_003866641.1|  2-hydroxyacid dehydrogenase                      72.0    3e-11   Thermoanaerobacter ethanolicus
ref|WP_012853865.1|  3-phosphoglycerate dehydrogenase                 72.8    3e-11   Thermomonospora curvata
ref|WP_015481519.1|  2-hydroxyacid dehydrogenase                      72.0    3e-11   Polaribacter sp. MED152
ref|WP_009589488.1|  phosphoglycerate dehydrogenase                   72.0    3e-11   Paenibacillus sp. HGF5
ref|WP_039109356.1|  2-hydroxyacid dehydrogenase                      72.0    3e-11   
ref|WP_041220149.1|  3-phosphoglycerate dehydrogenase                 72.8    3e-11   Dehalogenimonas lykanthroporepellens
ref|WP_020613473.1|  phosphoglycerate dehydrogenase                   72.0    3e-11   Sediminispirochaeta bajacaliforniensis
ref|WP_027065169.1|  2-hydroxyacid dehydrogenase                      71.6    3e-11   Maribacter sp. Hel_I_7
ref|WP_009419324.1|  4-phosphoerythronate dehydrogenase               71.6    3e-11   Capnocytophaga sp. oral taxon 380
gb|ADJ26050.1|  D-3-phosphoglycerate dehydrogenase                    72.8    3e-11   Dehalogenimonas lykanthroporepellens BL-DC-9
ref|WP_034060877.1|  2-hydroxyacid dehydrogenase                      71.6    4e-11   Lacinutrix jangbogonensis
ref|WP_046114008.1|  hypothetical protein                             72.0    4e-11   Aquincola tertiaricarbonis
ref|WP_019597101.1|  hypothetical protein                             71.6    4e-11   
ref|WP_016776361.1|  hydroxyacid dehydrogenase                        71.6    4e-11   
ref|WP_012875377.1|  3-phosphoglycerate dehydrogenase                 72.4    4e-11   
ref|WP_021685008.1|  phosphoglycerate dehydrogenase                   72.4    4e-11   
ref|WP_035354477.1|  glycerate dehydrogenase                          71.2    4e-11   
ref|XP_003447434.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  72.4    4e-11   
ref|WP_003609903.1|  3-phosphoglycerate dehydrogenase                 72.4    4e-11   
ref|WP_013993483.1|  2-hydroxyacid dehydrogenase                      71.6    4e-11   
ref|WP_030367266.1|  3-phosphoglycerate dehydrogenase                 71.2    4e-11   
ref|WP_014026236.1|  3-phosphoglycerate dehydrogenase                 71.6    4e-11   
ref|XP_004557758.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  72.4    4e-11   
ref|WP_034672669.1|  2-hydroxyacid dehydrogenase                      71.2    4e-11   
ref|WP_013684189.1|  3-phosphoglycerate dehydrogenase                 72.4    5e-11   
ref|WP_027393323.1|  2-hydroxyacid dehydrogenase                      71.2    5e-11   
ref|WP_025730676.1|  glycerate dehydrogenase                          71.2    5e-11   
ref|WP_014898107.1|  D-2-hydroxyacid dehydrogenase                    71.2    5e-11   
gb|EEX68770.1|  phosphoglycerate dehydrogenase                        72.4    5e-11   
ref|WP_015919681.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        71.2    5e-11   
ref|WP_003869389.1|  2-hydroxyacid dehydrogenase                      71.2    5e-11   
ref|WP_039324046.1|  2-hydroxyacid dehydrogenase                      71.2    5e-11   
ref|WP_004405741.1|  MULTISPECIES: Phosphoglycerate dehydrogenase...  71.2    5e-11   
ref|WP_014063250.1|  2-hydroxyacid dehydrogenase                      71.2    5e-11   
ref|WP_002571480.1|  hypothetical protein [                           71.2    6e-11   
ref|WP_036373718.1|  D-3-phosphoglycerate dehydrogenase               72.0    6e-11   
ref|WP_037045120.1|  3-phosphoglycerate dehydrogenase                 72.0    6e-11   
ref|WP_033343935.1|  3-phosphoglycerate dehydrogenase                 72.0    6e-11   
dbj|BAB05321.1|  D-3-phosphoglycerate dehydrogenase                   72.0    6e-11   
ref|WP_041821413.1|  D-3-phosphoglycerate dehydrogenase               72.0    6e-11   
ref|WP_034709363.1|  2-hydroxyacid dehydrogenase                      70.9    6e-11   
ref|WP_040636085.1|  D-3-phosphoglycerate dehydrogenase               72.0    6e-11   
ref|WP_036553081.1|  hypothetical protein                             70.9    7e-11   
ref|WP_024769896.1|  2-hydroxyacid dehydrogenase                      70.9    7e-11   
ref|WP_019154013.1|  hypothetical protein                             70.9    7e-11   
ref|XP_006788556.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  71.6    7e-11   
ref|WP_040491300.1|  2-hydroxyacid dehydrogenase                      70.9    8e-11   
gb|ACG30212.1|  hypothetical protein                                  67.8    8e-11   
ref|WP_014435324.1|  D-3-phosphoglycerate dehydrogenase               70.9    8e-11   
ref|WP_045470170.1|  2-hydroxyacid dehydrogenase                      70.9    8e-11   
ref|XP_008276911.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    71.6    8e-11   
ref|WP_041306383.1|  hypothetical protein                             70.5    8e-11   
gb|ADG07683.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  70.9    8e-11   
gb|EMQ96154.1|  D-3-phosphoglycerate dehydrogenase                    70.5    8e-11   
ref|WP_038505794.1|  2-hydroxyacid dehydrogenase                      70.5    9e-11   
ref|WP_015735794.1|  MULTISPECIES: phosphoglycerate dehydrogenase     70.5    9e-11   
ref|WP_034646575.1|  2-hydroxyacid dehydrogenase                      70.5    9e-11   
ref|WP_009604978.1|  3-phosphoglycerate dehydrogenase                 71.2    1e-10   
ref|WP_028892154.1|  2-hydroxyacid dehydrogenase                      70.5    1e-10   
ref|WP_013621326.1|  2-hydroxyacid dehydrogenase                      70.5    1e-10   
ref|WP_016483762.1|  D-3-phosphoglycerate dehydrogenase               71.2    1e-10   
ref|WP_042665584.1|  hypothetical protein                             70.5    1e-10   
ref|WP_025741279.1|  2-hydroxyacid dehydrogenase                      70.5    1e-10   
ref|WP_008255692.1|  2-hydroxyacid dehydrogenase                      70.5    1e-10   
ref|WP_010422163.1|  hydroxyacid dehydrogenase                        70.5    1e-10   
ref|WP_022897574.1|  phosphoglycerate dehydrogenase                   70.5    1e-10   
ref|WP_045413690.1|  3-phosphoglycerate dehydrogenase                 71.2    1e-10   
ref|WP_008269682.1|  2-hydroxyacid dehydrogenase                      70.5    1e-10   
ref|XP_007260013.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  70.9    1e-10   
ref|WP_018655350.1|  3-phosphoglycerate dehydrogenase                 70.9    1e-10   
ref|WP_045426166.1|  hypothetical protein                             70.1    1e-10   
ref|WP_013598110.1|  2-hydroxyacid dehydrogenase                      70.1    1e-10   
ref|WP_020879502.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  70.1    1e-10   
ref|WP_015049191.1|  3-phosphoglycerate dehydrogenase                 70.9    1e-10   
ref|WP_035675622.1|  2-hydroxyacid dehydrogenase                      70.1    1e-10   
ref|WP_036151541.1|  2-hydroxyacid dehydrogenase                      70.1    1e-10   
ref|WP_010135756.1|  2-hydroxyacid dehydrogenase                      70.1    1e-10   
ref|WP_026754692.1|  2-hydroxyacid dehydrogenase                      70.1    1e-10   
ref|WP_034246299.1|  2-hydroxyacid dehydrogenase                      70.1    1e-10   
ref|WP_028872303.1|  2-hydroxyacid dehydrogenase                      70.1    1e-10   
ref|WP_040389226.1|  hydroxyacid dehydrogenase                        70.1    2e-10   
ref|WP_034268243.1|  3-phosphoglycerate dehydrogenase                 70.5    2e-10   
ref|WP_040473670.1|  2-hydroxyacid dehydrogenase                      69.7    2e-10   
ref|WP_015590372.1|  D-3-phosphoglycerate dehydrogenase               70.5    2e-10   
ref|XP_008397929.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    70.5    2e-10   
ref|WP_005444086.1|  3-phosphoglycerate dehydrogenase                 70.5    2e-10   
ref|WP_012056351.1|  2-hydroxyacid dehydrogenase                      69.7    2e-10   
ref|WP_035652829.1|  2-hydroxyacid dehydrogenase                      69.7    2e-10   
gb|KHJ49564.1|  putative phosphoglycerate dehydrogenase               69.7    2e-10   
gb|EIA09848.1|  D-3-phosphoglycerate dehydrogenase                    70.5    2e-10   
ref|WP_042720719.1|  2-hydroxyacid dehydrogenase                      69.7    2e-10   
ref|WP_034422257.1|  hypothetical protein                             69.7    2e-10   
ref|WP_025346097.1|  hydroxyacid dehydrogenase                        69.7    2e-10   
ref|WP_008237375.1|  2-hydroxyacid dehydrogenase                      69.7    2e-10   
ref|WP_010534892.1|  3-phosphoglycerate dehydrogenase                 70.5    2e-10   
emb|CDW53280.1|  d 3 phosphoglycerate dehydrogenase                   69.3    2e-10   
ref|WP_027879560.1|  2-hydroxyacid dehydrogenase                      69.3    2e-10   
ref|WP_038034463.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   69.3    2e-10   
ref|WP_015651061.1|  D-3-phosphoglycerate dehydrogenase               70.1    2e-10   
ref|XP_008326872.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    70.1    2e-10   
gb|EFX42426.1|  D-3-phosphoglycerate dehydrogenase                    68.2    2e-10   
ref|XP_007546509.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    70.1    2e-10   
ref|WP_035693885.1|  2-hydroxyacid dehydrogenase                      69.3    2e-10   
ref|WP_012311121.1|  2-hydroxyacid dehydrogenase                      69.3    2e-10   
ref|WP_029682952.1|  3-phosphoglycerate dehydrogenase                 69.3    2e-10   
gb|KHC94274.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  69.3    2e-10   
ref|XP_005815897.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  68.6    2e-10   
ref|WP_029229471.1|  hypothetical protein                             70.1    2e-10   
ref|WP_013174222.1|  3-phosphoglycerate dehydrogenase                 70.1    3e-10   
ref|WP_008195136.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        69.3    3e-10   
ref|WP_031398880.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        69.3    3e-10   
ref|NP_001015929.1|  D-3-phosphoglycerate dehydrogenase               70.1    3e-10   
ref|WP_024980653.1|  2-hydroxyacid dehydrogenase                      69.3    3e-10   
ref|WP_015406996.1|  phosphoglycerate dehydrogenase                   70.1    3e-10   
ref|WP_012984255.1|  3-phosphoglycerate dehydrogenase                 70.1    3e-10   
gb|AKB74281.1|  D-3-phosphoglycerate dehydrogenase                    69.3    3e-10   
ref|WP_032132241.1|  2-hydroxyacid dehydrogenase                      69.3    3e-10   
ref|WP_034692535.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
gb|ADC51085.1|  D-3-phosphoglycerate dehydrogenase                    70.1    3e-10   
ref|WP_030164540.1|  3-phosphoglycerate dehydrogenase                 70.1    3e-10   
ref|WP_027386982.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_013788984.1|  3-phosphoglycerate dehydrogenase                 70.1    3e-10   
ref|WP_027411562.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_035623508.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
gb|ERN54129.1|  3-phosphoglycerate dehydrogenase                      70.1    3e-10   
ref|WP_028064131.1|  hypothetical protein                             68.9    3e-10   
ref|WP_028890009.1|  2-hydroxyacid dehydrogenase                      69.3    3e-10   
ref|WP_011928943.1|  3-phosphoglycerate dehydrogenase                 69.7    3e-10   
ref|WP_041822705.1|  D-3-phosphoglycerate dehydrogenase               69.7    3e-10   
ref|XP_005918214.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  69.7    3e-10   
ref|WP_041203341.1|  D-3-phosphoglycerate dehydrogenase               69.7    3e-10   
ref|WP_028986962.1|  D-3-phosphoglycerate dehydrogenase               69.7    3e-10   
ref|WP_026727466.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_039139706.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_014559623.1|  D-3-phosphoglycerate dehydrogenase               69.7    3e-10   
ref|WP_043191286.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_007809770.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_024934965.1|  hydroxyacid dehydrogenase                        68.9    3e-10   
ref|WP_012731867.1|  3-phosphoglycerate dehydrogenase                 69.7    3e-10   
ref|WP_029476138.1|  hypothetical protein                             69.7    3e-10   
ref|WP_038526208.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_004104023.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_010936374.1|  3-phosphoglycerate dehydrogenase                 69.7    3e-10   
ref|WP_029894730.1|  2-hydroxyacid dehydrogenase                      68.9    3e-10   
ref|WP_003928685.1|  3-phosphoglycerate dehydrogenase                 69.7    4e-10   
dbj|GAF17933.1|  D-3-phosphoglycerate dehydrogenase                   68.9    4e-10   
ref|WP_027383337.1|  2-hydroxyacid dehydrogenase                      68.9    4e-10   
ref|WP_041341612.1|  3-phosphoglycerate dehydrogenase                 69.7    4e-10   
ref|WP_012896480.1|  2-hydroxyacid dehydrogenase                      68.6    4e-10   
ref|WP_020927595.1|  D-3-phosphoglycerate dehydrogenase               68.9    4e-10   
ref|WP_006386349.1|  2-hydroxyacid dehydrogenase                      68.9    4e-10   
ref|YP_001244972.1|  NAD-binding D-isomer specific 2-hydroxyacid ...  68.6    4e-10   
ref|XP_011440418.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...  69.3    4e-10   
ref|WP_004081620.1|  hydroxypyruvate reductase                        68.6    4e-10   
ref|WP_007844133.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        68.6    4e-10   
ref|XP_003961897.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    69.3    4e-10   
gb|ADF50817.1|  D-3-phosphoglycerate dehydrogenase                    68.6    4e-10   
ref|WP_038336211.1|  2-hydroxyacid dehydrogenase                      68.6    4e-10   
ref|WP_041075886.1|  D-3-phosphoglycerate dehydrogenase               69.3    5e-10   
dbj|GAF12142.1|  D-3-phosphoglycerate dehydrogenase                   69.3    5e-10   
ref|WP_027077208.1|  2-hydroxyacid dehydrogenase                      68.6    5e-10   
ref|WP_037317787.1|  2-hydroxyacid dehydrogenase                      68.6    5e-10   
ref|WP_019975488.1|  hypothetical protein                             68.6    5e-10   
ref|XP_007888162.1|  PREDICTED: kelch-like protein 23 isoform X1      69.7    5e-10   
ref|WP_033957281.1|  2-hydroxyacid dehydrogenase                      68.6    5e-10   
ref|WP_013931861.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  68.6    5e-10   
ref|WP_023652107.1|  D-3-phosphoglycerate dehydrogenase               69.3    5e-10   
ref|XP_007783912.1|  D-3-phosphoglycerate dehydrogenase               69.3    5e-10   
ref|WP_021292044.1|  MULTISPECIES: hypothetical protein               69.3    5e-10   
ref|WP_027137916.1|  2-hydroxyacid dehydrogenase                      68.6    5e-10   
ref|WP_012881855.1|  3-phosphoglycerate dehydrogenase                 69.3    5e-10   
ref|WP_042563523.1|  2-hydroxyacid dehydrogenase                      68.6    5e-10   
ref|WP_025665762.1|  2-hydroxyacid dehydrogenase                      68.6    5e-10   
ref|WP_041578552.1|  2-hydroxyacid dehydrogenase                      68.6    5e-10   
ref|WP_015264046.1|  phosphoglycerate dehydrogenase-like oxidored...  68.2    5e-10   
ref|WP_014063714.1|  3-phosphoglycerate dehydrogenase                 68.9    5e-10   
ref|WP_026875430.1|  3-phosphoglycerate dehydrogenase                 68.9    5e-10   
ref|WP_040999341.1|  2-hydroxyacid dehydrogenase                      68.2    5e-10   
ref|WP_021596753.1|  3-phosphoglycerate dehydrogenase                 68.9    6e-10   
ref|WP_010901192.1|  2-hydroxyacid dehydrogenase                      68.2    6e-10   
ref|WP_025617573.1|  3-phosphoglycerate dehydrogenase                 68.9    6e-10   
ref|WP_027378875.1|  2-hydroxyacid dehydrogenase                      68.2    6e-10   
ref|WP_013787739.1|  2-hydroxyacid dehydrogenase                      68.2    6e-10   
ref|WP_011728303.1|  D-3-phosphoglycerate dehydrogenase               68.9    6e-10   
emb|CKH57347.1|  D-3-phosphoglycerate dehydrogenase                   68.9    6e-10   
ref|WP_003893746.1|  phosphoglycerate dehydrogenase                   68.9    6e-10   
ref|WP_037962034.1|  hydroxyacid dehydrogenase                        68.2    6e-10   
ref|XP_003839668.1|  similar to d-3-phosphoglycerate dehydrogenase    68.9    6e-10   
ref|WP_045676069.1|  3-phosphoglycerate dehydrogenase                 68.9    6e-10   
ref|WP_043325995.1|  3-phosphoglycerate dehydrogenase                 68.9    6e-10   
gb|EPC73785.1|  Putative 2-hydroxyacid dehydrogenase                  65.9    6e-10   
ref|WP_014890861.1|  3-phosphoglycerate dehydrogenase                 68.9    6e-10   
ref|XP_005707843.1|  D-3-phosphoglycerate dehydrogenase               68.9    6e-10   
ref|XP_005723511.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  68.9    6e-10   
ref|WP_007456368.1|  3-phosphoglycerate dehydrogenase                 68.9    6e-10   
ref|WP_038306467.1|  3-phosphoglycerate dehydrogenase                 68.2    6e-10   
ref|WP_012498776.1|  3-phosphoglycerate dehydrogenase                 68.9    6e-10   
ref|XP_003304604.1|  hypothetical protein PTT_17253                   68.9    6e-10   
ref|WP_034420544.1|  hypothetical protein                             67.8    7e-10   
ref|WP_009655673.1|  3-phosphoglycerate dehydrogenase                 68.9    7e-10   
tpg|DAA39793.1|  TPA: hypothetical protein ZEAMMB73_065837            67.8    7e-10   
ref|WP_034684163.1|  2-hydroxyacid dehydrogenase                      68.2    7e-10   
ref|WP_008285814.1|  3-phosphoglycerate dehydrogenase                 68.9    7e-10   
ref|WP_007075138.1|  3-phosphoglycerate dehydrogenase                 68.9    7e-10   
ref|WP_045191604.1|  3-phosphoglycerate dehydrogenase                 68.6    7e-10   
ref|WP_030337236.1|  3-phosphoglycerate dehydrogenase                 68.6    7e-10   
ref|WP_014501073.1|  3-phosphoglycerate dehydrogenase                 68.6    7e-10   
ref|XP_010744254.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    68.6    7e-10   
ref|WP_013732031.1|  3-phosphoglycerate dehydrogenase                 68.6    7e-10   
ref|XP_007684918.1|  hypothetical protein COCMIDRAFT_23723            68.9    7e-10   
ref|WP_039351020.1|  2-hydroxyacid dehydrogenase                      67.8    8e-10   
ref|WP_012579513.1|  2-hydroxyacid dehydrogenase                      67.8    8e-10   
ref|WP_036288531.1|  3-phosphoglycerate dehydrogenase                 68.6    8e-10   
ref|XP_002160624.2|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  67.8    8e-10   
ref|WP_015740268.1|  3-phosphoglycerate dehydrogenase                 68.6    8e-10   
ref|WP_020895649.1|  D-3-phosphoglycerate dehydrogenase               67.8    8e-10   
ref|WP_013299001.1|  3-phosphoglycerate dehydrogenase                 68.6    8e-10   
ref|WP_043884048.1|  3-phosphoglycerate dehydrogenase                 66.2    8e-10   
ref|WP_008600740.1|  D-3-phosphoglycerate dehydrogenase               68.6    8e-10   
ref|WP_016370056.1|  Putative 2-hydroxyacid dehydrogenase             65.9    8e-10   
ref|WP_011018669.1|  3-phosphoglycerate dehydrogenase                 68.6    8e-10   
emb|CBJ29093.1|  D-3-phosphoglycerate dehydrogenase                   68.6    8e-10   
ref|WP_041495180.1|  2-hydroxyacid dehydrogenase                      67.8    8e-10   
ref|WP_039118132.1|  2-hydroxyacid dehydrogenase                      67.8    8e-10   
gb|EEG25789.1|  phosphoglycerate dehydrogenase                        68.6    8e-10   
ref|WP_030913649.1|  3-phosphoglycerate dehydrogenase                 68.6    8e-10   
ref|WP_010225057.1|  2-hydroxyacid dehydrogenase                      67.8    9e-10   
gb|KFD54585.1|  hypothetical protein M513_04530                       68.9    9e-10   
gb|AKB28851.1|  D-3-phosphoglycerate dehydrogenase                    67.8    9e-10   
gb|EGF34364.1|  2-hydroxyacid dehydrogenase                           67.8    9e-10   
emb|CEF67819.1|  D-3-phosphoglycerate dehydrogenase                   67.8    9e-10   
ref|WP_008520048.1|  3-phosphoglycerate dehydrogenase                 67.8    9e-10   
ref|WP_027373038.1|  2-hydroxyacid dehydrogenase                      67.8    9e-10   



>ref|XP_009794279.1| PREDICTED: hydroxyphenylpyruvate reductase [Nicotiana sylvestris]
Length=400

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            KMG N SSH+TRVLFCGP+FPA+HNYTREY++ Y F+QVDD+P   +PAVI DY+ICVVK
Sbjct  57   KMGDNSSSHVTRVLFCGPHFPASHNYTREYLQGYPFVQVDDVPLENVPAVIGDYEICVVK  116

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            +  +NSD++SRAK MKLIMQFGVGLEGVDI AAT HGIKVARIP GATGNA SCAEMAIY
Sbjct  117  SFRMNSDVLSRAKSMKLIMQFGVGLEGVDINAATEHGIKVARIPGGATGNAASCAEMAIY  176

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            LILGLLRKQH++ I+++QK LGEPIGD L GKTVFIMG+GNIGIHLAKRLRPFDV
Sbjct  177  LILGLLRKQHQLKISVEQKKLGEPIGDNLEGKTVFIMGFGNIGIHLAKRLRPFDV  231



>ref|XP_009588864.1| PREDICTED: hydroxyphenylpyruvate reductase [Nicotiana tomentosiformis]
Length=401

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 6/193 (3%)
 Frame = +3

Query  228  RHCSSAGILGKNL-----KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDI  392
            +HCS A   G N      KMG N SS +TRVLFCGP+FPA+HNYTREY++ Y F+QVDD+
Sbjct  41   KHCSLAHA-GANASPEVQKMGDNSSSQVTRVLFCGPHFPASHNYTREYLQGYPFVQVDDV  99

Query  393  PFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVAR  572
            P   +PAVI DY+ICVVK+  +NSD++SRAK MKLIMQFGVGLEGVDI AAT HGIKVAR
Sbjct  100  PLENVPAVIGDYEICVVKSFRMNSDVLSRAKSMKLIMQFGVGLEGVDINAATEHGIKVAR  159

Query  573  IPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNI  752
            IP GATGNA SCAEMAIYLILGLLRKQH++ I+++QK LGEPIGD L GKTVFIMG+GNI
Sbjct  160  IPGGATGNAASCAEMAIYLILGLLRKQHQLKISVEQKKLGEPIGDNLEGKTVFIMGFGNI  219

Query  753  GIHLAKRLRPFDV  791
            GIHLAKRLRPFDV
Sbjct  220  GIHLAKRLRPFDV  232



>ref|XP_004250408.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Solanum 
lycopersicum]
Length=398

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/236 (63%), Positives = 177/236 (75%), Gaps = 11/236 (5%)
 Frame = +3

Query  90   SASDSLLTAVKSTLRKRTSLFSNNSPTSGGGWRVVEDNFSHqqqqqRHCSSAGILGKN--  263
            S ++S L   ++ +    +L + N         VVE  F H+Q Q+    S    G N  
Sbjct  3    SKTNSALLLCRTWISNAKTLITCN---------VVEKTFLHRQHQRHWFCSLAQAGANSS  53

Query  264  LKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVV  443
             KM  N  +H+TRVLFCGP+FP +HNYTREY++ Y F+QVDD+P   +PAVI DYDICVV
Sbjct  54   QKMSDNRCNHVTRVLFCGPHFPDSHNYTREYLQGYPFVQVDDVPLESVPAVIGDYDICVV  113

Query  444  KNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAI  623
            K+  +NSD++SRAKRMKLIMQFGVGLEGVDITAAT HGIKVA+IP GATGNA SCAEMAI
Sbjct  114  KSFRMNSDVLSRAKRMKLIMQFGVGLEGVDITAATKHGIKVAKIPGGATGNAASCAEMAI  173

Query  624  YLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            YLILGLLRKQH+M I+++QK LGEP G  L GKTVFI+G+GNIGIHLAKRLRPFDV
Sbjct  174  YLILGLLRKQHQMKISVEQKKLGEPTGVNLQGKTVFILGFGNIGIHLAKRLRPFDV  229



>ref|XP_006361376.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Solanum tuberosum]
Length=398

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 178/240 (74%), Gaps = 13/240 (5%)
 Frame = +3

Query  78   MYRSSASDSLLTAVKSTLRKRTSLFSNNSPTSGGGWRVVEDNFSHqqqqqRHCSSAGILG  257
            MY  S S  LL   K+ +    +L + N         V+E+ + H Q Q+    S    G
Sbjct  1    MYSKSTSALLL--CKTWVSNTKTLITCN---------VLENTYLHHQHQRHWFCSLAQAG  49

Query  258  KNL--KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYD  431
             N   KM  N  SH+TRVLFCGP+FP +HNYTREY++ Y F+QVDD+P   +PAVI DY+
Sbjct  50   ANTFQKMSDNRCSHVTRVLFCGPHFPDSHNYTREYLQGYPFVQVDDVPLESVPAVIGDYE  109

Query  432  ICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCA  611
            ICVVK+  +NSD++SRAKRMKLIMQFGVGLEGVDI AAT HGIKVA+IP GATGNA SCA
Sbjct  110  ICVVKSFRMNSDVLSRAKRMKLIMQFGVGLEGVDINAATKHGIKVAKIPGGATGNAASCA  169

Query  612  EMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            EMAIYLILGLLRKQ++M I+++QK LGEP GD L GKTVFI+G+GNIGIHLAKRLRPFDV
Sbjct  170  EMAIYLILGLLRKQNQMKISVEQKKLGEPTGDNLQGKTVFILGFGNIGIHLAKRLRPFDV  229



>emb|CDP16491.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 185/244 (76%), Gaps = 16/244 (7%)
 Frame = +3

Query  78   MYRSSASDSL--LTAVKST----LRKRTSLFSNNSPTSGGGWRVVEDNFSHqqqqqRHCS  239
            M+R+ +S SL  +T VKS     L  R+S   + SP+S      +  +F   +   RH  
Sbjct  1    MHRAGSSTSLFLVTVVKSLEAVGLVGRSSGRWSQSPSS---HHTLHRHFFISRIPGRHS-  56

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
                 G+  KM  NGS  +TRVLFCGP+FPA+H+YTREY++DY F++VDD+PF  +P VI
Sbjct  57   -----GEGQKM-DNGSDQVTRVLFCGPHFPASHDYTREYLQDYPFVKVDDVPFDSVPDVI  110

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
             +Y +CVVK++ LNS+LIS AKRMKLIMQ+GVGLEGVDI AA+ HGIK+ARIPSGATGNA
Sbjct  111  GNYHLCVVKSMRLNSELISHAKRMKLIMQYGVGLEGVDIGAASKHGIKIARIPSGATGNA  170

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYLILGLLRKQ+EM IA+KQ+ LG P+GDTLLGKTVFIMG+GNIGI LA+RLR
Sbjct  171  VSCAEMAIYLILGLLRKQNEMQIAVKQRKLGVPVGDTLLGKTVFIMGFGNIGIKLAQRLR  230

Query  780  PFDV  791
            PF V
Sbjct  231  PFGV  234



>ref|XP_010317839.1| PREDICTED: formate dehydrogenase, mitochondrial-like [Solanum 
lycopersicum]
Length=295

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M  N  SH+TRVLFCGP+FP +HNYTREY++ Y F+QVDD+P   +PAVI DYDICVVK+
Sbjct  1    MSDNRCSHVTRVLFCGPHFPDSHNYTREYLQGYPFVQVDDVPLESVPAVIGDYDICVVKS  60

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              +NSD+ SRAKRMKLIMQFGVGLEGVDITAAT H IKVA+I  GATGNA S AEMAIYL
Sbjct  61   FRMNSDVHSRAKRMKLIMQFGVGLEGVDITAATNHCIKVAKISGGATGNAASYAEMAIYL  120

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            ILGLLRKQH+M I+++QK LGEP G  L GKTVFI+G+GNIGIHLAKRLRPFDV
Sbjct  121  ILGLLRKQHQMKISVEQKKLGEPTGVNLHGKTVFILGFGNIGIHLAKRLRPFDV  174



>gb|EYU28234.1| hypothetical protein MIMGU_mgv1a007209mg [Erythranthe guttata]
Length=415

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 162/190 (85%), Gaps = 2/190 (1%)
 Frame = +3

Query  228  RHCSSA-GILGKNLKM-GKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFV  401
            R+CSS+ G+L K  +M G +    ITRVLFCGP+FPA+HNYT EY++ + FIQVD +P  
Sbjct  59   RNCSSSPGLLKKVKEMTGDSSKPIITRVLFCGPHFPASHNYTIEYLQSHPFIQVDVVPLD  118

Query  402  YIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
             +  VI +YDICVVK+L LN+D+ISRA +MKLIMQFGVGLEGVDI AAT HGIKVA+IPS
Sbjct  119  DVREVIGNYDICVVKSLRLNADIISRANKMKLIMQFGVGLEGVDINAATKHGIKVAKIPS  178

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIH  761
              TGNATSCAEM+IYL+LGLLRKQ+EM +A++QK+LG+PIGDTLLGKTVFIMG+GNIGIH
Sbjct  179  DGTGNATSCAEMSIYLMLGLLRKQYEMQVAVRQKLLGDPIGDTLLGKTVFIMGFGNIGIH  238

Query  762  LAKRLRPFDV  791
            LAKRLRPF V
Sbjct  239  LAKRLRPFGV  248



>ref|XP_002319339.2| hypothetical protein POPTR_0013s10050g [Populus trichocarpa]
 gb|EEE95262.2| hypothetical protein POPTR_0013s10050g [Populus trichocarpa]
Length=388

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            S G L +  +M  N   HITRVLFCGP FPA+H YT+EY++ Y FIQVDD+P   +P VI
Sbjct  36   STGTLSEVEQMVGNSDKHITRVLFCGPYFPASHQYTKEYLQKYPFIQVDDVPLAVVPDVI  95

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
             +Y+IC+VKN+ L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA
Sbjct  96   SNYNICIVKNMRLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNA  155

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL+LGLLRKQ+EM I+IKQK LGEP G+TL GKTVFIMG+GNIGI LAKRLR
Sbjct  156  ASCAEMAIYLMLGLLRKQNEMQISIKQKRLGEPAGETLFGKTVFIMGFGNIGIDLAKRLR  215

Query  780  PFDV  791
            PF V
Sbjct  216  PFGV  219



>ref|XP_008218923.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
Length=355

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            SA I GK  +M  N    ITRVLFCGP+FPA+H YTREY+K+Y F+QVDD+P   +P VI
Sbjct  4    SANISGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVI  63

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
            ++Y+IC+VK +  +S+L+SRA++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA
Sbjct  64   QNYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNA  123

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL+LGLLRKQ+EM IAIKQ+ +G+PIGDTLLGKTVFI+G+GNIGI LAKRLR
Sbjct  124  ASCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDTLLGKTVFILGFGNIGIDLAKRLR  183

Query  780  PFDV  791
            PF V
Sbjct  184  PFGV  187



>ref|XP_011003972.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Populus euphratica]
Length=390

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            S   L +  +M  N   HITRVLFCGP F A+H YT+EY++ Y FIQVDD+PF  +P VI
Sbjct  38   STDTLSEVEQMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVI  97

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
             +Y+IC+VKN+ L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA
Sbjct  98   SNYNICIVKNMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNA  157

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL+LGLLRKQ+EM I+IKQK LGEP G+TLLGKTVFIMG+GNIGI LAKRLR
Sbjct  158  ASCAEMAIYLMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIMGFGNIGIDLAKRLR  217

Query  780  PFDV  791
            PF V
Sbjct  218  PFGV  221



>ref|XP_011003977.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X6 [Populus euphratica]
Length=373

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            +M  N   HITRVLFCGP F A+H YT+EY++ Y FIQVDD+PF  +P VI +Y+IC+VK
Sbjct  51   QMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVK  110

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            N+ L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIY
Sbjct  111  NMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIY  170

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ+EM I+IKQK LGEP G+TLLGKTVFIMG+GNIGI LAKRLRPF V
Sbjct  171  LMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIMGFGNIGIDLAKRLRPFGV  225



>ref|XP_008218922.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X2 [Prunus mume]
Length=374

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            SA I GK  +M  N    ITRVLFCGP+FPA+H YTREY+K+Y F+QVDD+P   +P VI
Sbjct  25   SANISGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVI  84

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
            ++Y+IC+VK +  +S+L+SRA++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA
Sbjct  85   QNYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNA  144

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL+LGLLRKQ+EM IAIKQ+ +G+PIGDTLLGKTVFI+G+GNIGI LAKRLR
Sbjct  145  ASCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDTLLGKTVFILGFGNIGIDLAKRLR  204

Query  780  PFDV  791
            PF V
Sbjct  205  PFGV  208



>ref|XP_008218920.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X1 [Prunus mume]
Length=376

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            SA I GK  +M  N    ITRVLFCGP+FPA+H YTREY+K+Y F+QVDD+P   +P VI
Sbjct  25   SANISGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVI  84

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
            ++Y+IC+VK +  +S+L+SRA++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA
Sbjct  85   QNYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNA  144

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL+LGLLRKQ+EM IAIKQ+ +G+PIGDTLLGKTVFI+G+GNIGI LAKRLR
Sbjct  145  ASCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDTLLGKTVFILGFGNIGIDLAKRLR  204

Query  780  PFDV  791
            PF V
Sbjct  205  PFGV  208



>ref|XP_011003974.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X3 [Populus euphratica]
Length=390

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            +M  N   HITRVLFCGP F A+H YT+EY++ Y FIQVDD+PF  +P VI +Y+IC+VK
Sbjct  47   QMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVK  106

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            N+ L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIY
Sbjct  107  NMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIY  166

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ+EM I+IKQK LGEP G+TLLGKTVFIMG+GNIGI LAKRLRPF V
Sbjct  167  LMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIMGFGNIGIDLAKRLRPFGV  221



>ref|XP_011003978.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X7 [Populus euphratica]
Length=343

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M  N   HITRVLFCGP F A+H YT+EY++ Y FIQVDD+PF  +P VI +Y+IC+VKN
Sbjct  1    MVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVKN  60

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIYL
Sbjct  61   MQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYL  120

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM I+IKQK LGEP G+TLLGKTVFIMG+GNIGI LAKRLRPF V
Sbjct  121  MLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIMGFGNIGIDLAKRLRPFGV  174



>ref|XP_011003971.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Populus euphratica]
Length=394

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            +M  N   HITRVLFCGP F A+H YT+EY++ Y FIQVDD+PF  +P VI +Y+IC+VK
Sbjct  51   QMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVK  110

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            N+ L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIY
Sbjct  111  NMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIY  170

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ+EM I+IKQK LGEP G+TLLGKTVFIMG+GNIGI LAKRLRPF V
Sbjct  171  LMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIMGFGNIGIDLAKRLRPFGV  225



>ref|XP_011003975.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X4 [Populus euphratica]
Length=388

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            +M  N   HITRVLFCGP F A+H YT+EY++ Y FIQVDD+PF  +P VI +Y+IC+VK
Sbjct  45   QMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVK  104

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            N+ L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIY
Sbjct  105  NMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIY  164

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ+EM I+IKQK LGEP G+TLLGKTVFIMG+GNIGI LAKRLRPF V
Sbjct  165  LMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIMGFGNIGIDLAKRLRPFGV  219



>ref|XP_011003976.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X5 [Populus euphratica]
Length=388

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            +M  N   HITRVLFCGP F A+H YT+EY++ Y FIQVDD+PF  +P VI +Y+IC+VK
Sbjct  51   QMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVK  110

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            N+ L S++ISRA +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIY
Sbjct  111  NMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIY  170

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ+EM I+IKQK LGEP G+TLLGKTVFIMG+GNIGI LAKRLRPF V
Sbjct  171  LMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIMGFGNIGIDLAKRLRPFGV  225



>ref|XP_008218916.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X2 [Prunus mume]
Length=353

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  243  AGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIK  422
            A ILGK  +M       ITRVLFCGP+FPA+H YTREY+K++ F+QVDD+P   +P VI+
Sbjct  5    ADILGKVERMIDKDEKKITRVLFCGPHFPASHTYTREYLKEFPFVQVDDVPLDDVPGVIQ  64

Query  423  DYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNAT  602
            +Y+IC+VK +  +S+L+SRA++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  65   NYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAA  124

Query  603  SCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRP  782
            SCAEMAIYL+LGLLRKQ+EM IAIKQ+ LG+PIGDTLLGKTVFI+G+GNIGI LAKRLRP
Sbjct  125  SCAEMAIYLMLGLLRKQNEMQIAIKQRKLGDPIGDTLLGKTVFILGFGNIGIDLAKRLRP  184

Query  783  FDV  791
            F V
Sbjct  185  FGV  187



>ref|XP_008218915.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X1 [Prunus mume]
Length=355

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  243  AGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIK  422
            A ILGK  +M       ITRVLFCGP+FPA+H YTREY+K++ F+QVDD+P   +P VI+
Sbjct  5    ADILGKVERMIDKDEKKITRVLFCGPHFPASHTYTREYLKEFPFVQVDDVPLDDVPGVIQ  64

Query  423  DYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNAT  602
            +Y+IC+VK +  +S+L+SRA++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  65   NYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAA  124

Query  603  SCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRP  782
            SCAEMAIYL+LGLLRKQ+EM IAIKQ+ LG+PIGDTLLGKTVFI+G+GNIGI LAKRLRP
Sbjct  125  SCAEMAIYLMLGLLRKQNEMQIAIKQRKLGDPIGDTLLGKTVFILGFGNIGIDLAKRLRP  184

Query  783  FDV  791
            F V
Sbjct  185  FGV  187



>gb|ABK96037.1| unknown [Populus trichocarpa]
Length=343

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M  N   HITRVLFCGP FPA+H YT+EY++ Y FIQVDD+P   +P VI +Y+IC+VKN
Sbjct  1    MVGNSDKHITRVLFCGPYFPASHQYTKEYLQKYPFIQVDDVPLAVVPDVISNYNICIVKN  60

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L S++ISRA +MKLIMQFGVG+EGVDI AAT +GIKVARIP  ATGNA SCAEMAIYL
Sbjct  61   MRLTSNIISRATQMKLIMQFGVGIEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYL  120

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM I+IKQK LGEP G+TL GKTVFIMG+GNIGI LAKRLRPF V
Sbjct  121  MLGLLRKQNEMQISIKQKRLGEPAGETLFGKTVFIMGFGNIGIDLAKRLRPFGV  174



>ref|XP_011074952.1| PREDICTED: formate dehydrogenase, mitochondrial [Sesamum indicum]
Length=406

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 177/240 (74%), Gaps = 5/240 (2%)
 Frame = +3

Query  78   MYRSSAS-DSLLTAVKSTLRKRTSLFSNNSPTSGGGWRVVEDNFSHqqqqqRHC-SSAGI  251
            MYRS+ +  SL T +K+ L +  ++ +  S +S    ++         Q  RHC SS G+
Sbjct  1    MYRSTTTYPSLSTLLKALLGEIGTIATIRSTSSS---QLFAPPRYTPAQHHRHCFSSPGL  57

Query  252  LGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYD  431
            LG   +M  +    ITRVLFCGP FPA+HNYT+EY++ +  I+VD +P   +P  I +YD
Sbjct  58   LGNFQEMTGDSGKPITRVLFCGPQFPASHNYTKEYLQSHPCIKVDVVPLDDVPHAIGNYD  117

Query  432  ICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCA  611
            ICVVKN+ L++D+I+RA ++KLIMQFGVGLEGVD+ +AT HGIKVARIP  ATGNA SCA
Sbjct  118  ICVVKNMRLSADVIARANKLKLIMQFGVGLEGVDLNSATKHGIKVARIPGDATGNAASCA  177

Query  612  EMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            EMAIY +LGLLRKQ+EM +A+KQK LGEP+GD LLGKT+FIMGYGNIG HLAKRLRPF V
Sbjct  178  EMAIYQMLGLLRKQYEMQVAVKQKKLGEPVGDMLLGKTIFIMGYGNIGNHLAKRLRPFGV  237



>ref|XP_007223301.1| hypothetical protein PRUPE_ppa007293mg [Prunus persica]
 gb|EMJ24500.1| hypothetical protein PRUPE_ppa007293mg [Prunus persica]
Length=374

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            SA ILGK  +M  N    ITRVLFCGP+FPA+H YTREY+K+Y F+QVDD+P   +P VI
Sbjct  25   SANILGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVI  84

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
            ++Y+IC+VK +  +S L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA
Sbjct  85   QNYNICIVKTMKFDSILLSHAEKMKLIMQYGVGLEGVDIDSATEFGIKVARIPSHVTGNA  144

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL+LGLLRKQ+EM IAIKQ+ +G+PIGD LLGKTVFI+G+GNIGI LAKRLR
Sbjct  145  ASCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDMLLGKTVFILGFGNIGIDLAKRLR  204

Query  780  PFDV  791
            PF V
Sbjct  205  PFGV  208



>ref|XP_010665337.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X2 [Vitis vinifera]
Length=356

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +3

Query  234  CSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPA  413
            C  A    K  KM K+ +  ITR+LFCGPNFPA++ YTREY+++Y FIQVDD  F  +P 
Sbjct  2    CLDAVFPRKIEKMVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPD  61

Query  414  VIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATG  593
            VI DYD+C+VK++ L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TG
Sbjct  62   VIADYDMCIVKSMRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETG  121

Query  594  NATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKR  773
            NA SCAEMAIYL+LGLLRKQ EM I++KQK++GEPIGDTL GKTVFIMG+GNIGI LAKR
Sbjct  122  NAASCAEMAIYLMLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIMGFGNIGIDLAKR  181

Query  774  LRPFDV  791
            LRPF V
Sbjct  182  LRPFGV  187



>ref|XP_002282092.2| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X1 [Vitis vinifera]
Length=382

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  237  SSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAV  416
            SSA    K  KM K+ +  ITR+LFCGPNFPA++ YTREY+++Y FIQVDD  F  +P V
Sbjct  29   SSAVFPRKIEKMVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPDV  88

Query  417  IKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGN  596
            I DYD+C+VK++ L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TGN
Sbjct  89   IADYDMCIVKSMRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETGN  148

Query  597  ATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            A SCAEMAIYL+LGLLRKQ EM I++KQK++GEPIGDTL GKTVFIMG+GNIGI LAKRL
Sbjct  149  AASCAEMAIYLMLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIMGFGNIGIDLAKRL  208

Query  777  RPFDV  791
            RPF V
Sbjct  209  RPFGV  213



>ref|XP_010665338.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X3 [Vitis vinifera]
Length=351

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            KM K+ +  ITR+LFCGPNFPA++ YTREY+++Y FIQVDD  F  +P VI DYD+C+VK
Sbjct  8    KMVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPDVIADYDMCIVK  67

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            ++ L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TGNA SCAEMAIY
Sbjct  68   SMRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETGNAASCAEMAIY  127

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ EM I++KQK++GEPIGDTL GKTVFIMG+GNIGI LAKRLRPF V
Sbjct  128  LMLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIMGFGNIGIDLAKRLRPFGV  182



>gb|KJB55666.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=338

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+  YTREY++ Y FIQVDD+P   +P  I +YD+CV KN+  +S+++
Sbjct  16   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  75

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRAK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLRKQ
Sbjct  76   SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLRKQ  135

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I++KQKMLGEPIG+TLLGKTVFIMG+GNIGI LAKRL+PFDV
Sbjct  136  NEMQISVKQKMLGEPIGETLLGKTVFIMGFGNIGIDLAKRLKPFDV  181



>gb|KJB55664.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=383

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            SAG+     K   +    ITRVLFCGP+FPA+  YTREY++ Y FIQVDD+P   +P  I
Sbjct  32   SAGMSSMAEKKDVDKDKPITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHI  91

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
             +YD+CV KN+  +S+++SRAK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA
Sbjct  92   GNYDLCVSKNMLFDSNVLSRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNA  151

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL LGLLRKQ+EM I++KQKMLGEPIG+TLLGKTVFIMG+GNIGI LAKRL+
Sbjct  152  ASCAEMAIYLTLGLLRKQNEMQISVKQKMLGEPIGETLLGKTVFIMGFGNIGIDLAKRLK  211

Query  780  PFDV  791
            PFDV
Sbjct  212  PFDV  215



>gb|KJB55660.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55661.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55662.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=349

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+  YTREY++ Y FIQVDD+P   +P  I +YD+CV KN+  +S+++
Sbjct  16   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  75

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRAK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLRKQ
Sbjct  76   SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLRKQ  135

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I++KQKMLGEPIG+TLLGKTVFIMG+GNIGI LAKRL+PFDV
Sbjct  136  NEMQISVKQKMLGEPIGETLLGKTVFIMGFGNIGIDLAKRLKPFDV  181



>gb|KHG10814.1| Glyoxylate reductase [Gossypium arboreum]
Length=383

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            SAG+     K   +    ITRVLFCGP+FPA+  YTREY++ Y FIQVDD+P   +P  I
Sbjct  32   SAGMSSMAEKKDVDNDKPITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHI  91

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
             +YD+CV KN+  +S+++SRAK+MKLIMQFGVGLEG+DI AA  HGIKVARIP  ATGNA
Sbjct  92   GNYDLCVSKNMRFDSNVLSRAKQMKLIMQFGVGLEGIDIDAAKKHGIKVARIPGDATGNA  151

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL+LGLLRKQ+EM I++KQKMLGEPIG+TLLGKTVFIMG+GNIGI LAKRL+
Sbjct  152  ASCAEMAIYLMLGLLRKQNEMQISVKQKMLGEPIGETLLGKTVFIMGFGNIGIDLAKRLK  211

Query  780  PFDV  791
            PFDV
Sbjct  212  PFDV  215



>ref|XP_010665339.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X4 [Vitis vinifera]
 emb|CBI39250.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M K+ +  ITR+LFCGPNFPA++ YTREY+++Y FIQVDD  F  +P VI DYD+C+VK+
Sbjct  1    MVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPDVIADYDMCIVKS  60

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TGNA SCAEMAIYL
Sbjct  61   MRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETGNAASCAEMAIYL  120

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ EM I++KQK++GEPIGDTL GKTVFIMG+GNIGI LAKRLRPF V
Sbjct  121  MLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIMGFGNIGIDLAKRLRPFGV  174



>ref|XP_007015902.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 4, partial [Theobroma cacao]
 gb|EOY33521.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 4, partial [Theobroma cacao]
Length=321

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            K   +    ITRVLFCGP+FPA+ NYTREY++ Y +IQVDD+P   +P  I +Y +CVVK
Sbjct  7    KRDADNDKPITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLCVVK  66

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            N+ L+S++ISRA +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEMAIY
Sbjct  67   NMRLDSNVISRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEMAIY  126

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ+EM I++KQK LGEP+G+TLLG+TVFIMG+GNIGI LAKRL+PF V
Sbjct  127  LMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIMGFGNIGIDLAKRLKPFGV  181



>ref|XP_007015900.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY33519.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
Length=349

 Score =   261 bits (668),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            K   +    ITRVLFCGP+FPA+ NYTREY++ Y +IQVDD+P   +P  I +Y +CVVK
Sbjct  7    KRDADNDKPITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLCVVK  66

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
            N+ L+S++ISRA +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEMAIY
Sbjct  67   NMRLDSNVISRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEMAIY  126

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ+EM I++KQK LGEP+G+TLLG+TVFIMG+GNIGI LAKRL+PF V
Sbjct  127  LMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIMGFGNIGIDLAKRLKPFGV  181



>ref|XP_008218917.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
 ref|XP_008218918.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
Length=342

 Score =   261 bits (667),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+H YTREY+K++ F+QVDD+P   +P VI++Y+IC+VK +  +S+L+
Sbjct  9    ITRVLFCGPHFPASHTYTREYLKEFPFVQVDDVPLDDVPGVIQNYNICIVKTMKFDSNLL  68

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAIYL+LGLLRKQ
Sbjct  69   SRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAASCAEMAIYLMLGLLRKQ  128

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM IAIKQ+ LG+PIGDTLLGKTVFI+G+GNIGI LAKRLRPF V
Sbjct  129  NEMQIAIKQRKLGDPIGDTLLGKTVFILGFGNIGIDLAKRLRPFGV  174



>ref|XP_007015899.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY33518.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
Length=384

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+ NYTREY++ Y +IQVDD+P   +P  I +Y +CVVKN+ L+S++I
Sbjct  51   ITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLCVVKNMRLDSNVI  110

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEMAIYL+LGLLRKQ
Sbjct  111  SRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEMAIYLMLGLLRKQ  170

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I++KQK LGEP+G+TLLG+TVFIMG+GNIGI LAKRL+PF V
Sbjct  171  NEMQISVKQKKLGEPVGETLLGQTVFIMGFGNIGIDLAKRLKPFGV  216



>ref|XP_007015901.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY33520.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
Length=387

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+ NYTREY++ Y +IQVDD+P   +P  I +Y +CVVKN+ L+S++I
Sbjct  54   ITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLCVVKNMRLDSNVI  113

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEMAIYL+LGLLRKQ
Sbjct  114  SRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEMAIYLMLGLLRKQ  173

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I++KQK LGEP+G+TLLG+TVFIMG+GNIGI LAKRL+PF V
Sbjct  174  NEMQISVKQKKLGEPVGETLLGQTVFIMGFGNIGIDLAKRLKPFGV  219



>ref|XP_011457341.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457342.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457343.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457344.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=335

 Score =   256 bits (655),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            IT VLFCGP+FPA+ +YTREY+ DY F+QVDD+P   +P VI++YDIC+VK++ L+ D++
Sbjct  8    ITHVLFCGPHFPASEDYTREYLIDYPFVQVDDVPLADVPDVIENYDICIVKSMKLDFDVL  67

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRAK+MKLIMQ+GVGLEGV+I AAT  GIKVARIPS ATGNA SCAEM+IYL+LGLLRKQ
Sbjct  68   SRAKKMKLIMQYGVGLEGVEIDAATKFGIKVARIPSHATGNAASCAEMSIYLMLGLLRKQ  127

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I+IKQ+ LG+PIG+TLLGKTVFI+GYGNIG+ LAKRL+PF V
Sbjct  128  NEMQISIKQRKLGDPIGETLLGKTVFILGYGNIGMDLAKRLKPFGV  173



>ref|XP_010243882.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Nelumbo nucifera]
 ref|XP_010243884.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Nelumbo nucifera]
Length=404

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            KM +N  S +TRVLFCGP FPA+H YTREY+++Y FIQVDD+P   +P+VI +YDICV K
Sbjct  54   KMVENNDSQVTRVLFCGPQFPASHKYTREYLQNYPFIQVDDVPLDDVPSVIGNYDICVPK  113

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
               L+S +I  A R+KLI+QFGVGLEGVD+ AAT +GIKVARIP   TGNA SCAEMAIY
Sbjct  114  MKKLDSKVIDCAIRLKLIVQFGVGLEGVDVDAATRYGIKVARIPGNVTGNAASCAEMAIY  173

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            LIL LLRKQ EM IA+ QK LGEPIG+TL GKTVFIMG+GNIGI LAKRLRPF V
Sbjct  174  LILSLLRKQKEMQIAVDQKRLGEPIGETLFGKTVFIMGFGNIGIDLAKRLRPFGV  228



>ref|XP_010243885.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243886.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243887.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243888.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
Length=350

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M +N  S +TRVLFCGP FPA+H YTREY+++Y FIQVDD+P   +P+VI +YDICV K 
Sbjct  1    MVENNDSQVTRVLFCGPQFPASHKYTREYLQNYPFIQVDDVPLDDVPSVIGNYDICVPKM  60

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              L+S +I  A R+KLI+QFGVGLEGVD+ AAT +GIKVARIP   TGNA SCAEMAIYL
Sbjct  61   KKLDSKVIDCAIRLKLIVQFGVGLEGVDVDAATRYGIKVARIPGNVTGNAASCAEMAIYL  120

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            IL LLRKQ EM IA+ QK LGEPIG+TL GKTVFIMG+GNIGI LAKRLRPF V
Sbjct  121  ILSLLRKQKEMQIAVDQKRLGEPIGETLFGKTVFIMGFGNIGIDLAKRLRPFGV  174



>ref|XP_010910119.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Elaeis guineensis]
Length=344

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  273  GKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNL  452
             +NG +HITRVLFCG +FPA+ NYTREY++ Y FIQVDD+    +P VI  Y ICV KN 
Sbjct  6    AENGYNHITRVLFCGFHFPASQNYTREYLQKYPFIQVDDVALDDVPDVIDKYHICVAKNR  65

Query  453  GLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLI  632
             L+S +I++A +MKLIMQFGVGLEGVDI AAT H IKVARIP   TGN+ SCAEMAIYL+
Sbjct  66   RLDSKVIAKAVQMKLIMQFGVGLEGVDIDAATQHKIKVARIPGSVTGNSASCAEMAIYLM  125

Query  633  LGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            LGLLRKQ EMD+A+KQK LGEPIGDT+LGKTVFI+G+G IG+ LAKRLRPF V
Sbjct  126  LGLLRKQKEMDVAVKQKNLGEPIGDTILGKTVFILGFGAIGVDLAKRLRPFGV  178



>gb|KDO56053.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=226

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  177



>gb|KDO56054.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=218

 Score =   248 bits (632),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  177



>gb|KDO56056.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
 gb|KDO56057.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
 gb|KDO56058.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
 gb|KDO56059.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=210

 Score =   247 bits (631),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  177



>gb|KCW70960.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=252

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++G   +TRVLFCGP+FPA+ +YTREY+  Y FIQVD+     +P VI +Y +CVVKN  
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
             +SD+I+RAK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ+E+  ++ Q+ LGEP+G+TL GKTV IMGYGNIGI LAKRLRPF V
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIMGYGNIGIDLAKRLRPFGV  175



>gb|KCW70956.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=272

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++G   +TRVLFCGP+FPA+ +YTREY+  Y FIQVD+     +P VI +Y +CVVKN  
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
             +SD+I+RAK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ+E+  ++ Q+ LGEP+G+TL GKTV IMGYGNIGI LAKRLRPF V
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIMGYGNIGIDLAKRLRPFGV  175



>ref|XP_010910114.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Elaeis guineensis]
Length=379

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  273  GKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNL  452
             +NG +HITRVLFCG +FPA+ NYTREY++ Y FIQVDD+    +P VI  Y ICV KN 
Sbjct  41   AENGYNHITRVLFCGFHFPASQNYTREYLQKYPFIQVDDVALDDVPDVIDKYHICVAKNR  100

Query  453  GLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLI  632
             L+S +I++A +MKLIMQFGVGLEGVDI AAT H IKVARIP   TGN+ SCAEMAIYL+
Sbjct  101  RLDSKVIAKAVQMKLIMQFGVGLEGVDIDAATQHKIKVARIPGSVTGNSASCAEMAIYLM  160

Query  633  LGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            LGLLRKQ EMD+A+KQK LGEPIGDT+LGKTVFI+G+G IG+ LAKRLRPF V
Sbjct  161  LGLLRKQKEMDVAVKQKNLGEPIGDTILGKTVFILGFGAIGVDLAKRLRPFGV  213



>ref|XP_006441523.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54763.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|KDO56055.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=269

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  177



>ref|XP_006441524.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54764.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=285

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  79   MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  138

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  139  MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  198

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  199  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  252



>ref|XP_009379254.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X1 [Pyrus x bretschneideri]
Length=392

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ++R+LFCG +FPAA  YTREY+KDY FIQVDD+P   +P VI++Y +C+VK + L+SDL+
Sbjct  61   VSRLLFCGSHFPAAETYTREYLKDYPFIQVDDVPHKDVPGVIQNYTMCIVKLMKLDSDLL  120

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA++MKL++Q+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAIYL+LGLLRKQ
Sbjct  121  SRAEKMKLVLQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAASCAEMAIYLMLGLLRKQ  180

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I+IK + +G+P+G+TLLGKTVFI+GYGNIGI LAKRLRPF V
Sbjct  181  NEMQISIKLRKVGDPVGETLLGKTVFILGYGNIGIELAKRLRPFGV  226



>ref|XP_008378743.1| PREDICTED: D-3-phosphoglycerate dehydrogenase [Malus domestica]
Length=394

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITR+LFCG +FPAA  YTREY+KDY FIQVDD+P   +P VI++Y +C+VK + L+SD++
Sbjct  63   ITRLLFCGSHFPAAETYTREYLKDYPFIQVDDVPHKDVPGVIQNYSMCIVKMMKLDSDIL  122

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA++MKL++Q+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAIYL+LGLLRKQ
Sbjct  123  SRAEKMKLVLQYGVGLEGVDIDSATKSGIKVARIPSHVTGNAASCAEMAIYLMLGLLRKQ  182

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I+IK   +G+P+G+TLLGKTVFI+GYGNIGI LAKRLRPF V
Sbjct  183  NEMQISIKLGKVGDPVGETLLGKTVFILGYGNIGIELAKRLRPFGV  228



>ref|XP_009379261.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X2 [Pyrus x bretschneideri]
Length=390

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ++R+LFCG +FPAA  YTREY+KDY FIQVDD+P   +P VI++Y +C+VK + L+SDL+
Sbjct  59   VSRLLFCGSHFPAAETYTREYLKDYPFIQVDDVPHKDVPGVIQNYTMCIVKLMKLDSDLL  118

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA++MKL++Q+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAIYL+LGLLRKQ
Sbjct  119  SRAEKMKLVLQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAASCAEMAIYLMLGLLRKQ  178

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I+IK + +G+P+G+TLLGKTVFI+GYGNIGI LAKRLRPF V
Sbjct  179  NEMQISIKLRKVGDPVGETLLGKTVFILGYGNIGIELAKRLRPFGV  224



>ref|XP_010535279.1| PREDICTED: formate dehydrogenase, mitochondrial [Tarenaya hassleriana]
Length=367

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +3

Query  228  RHCSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYI  407
            R   S   + K  +M       +TRVLFCGP+FP++HNYTR Y++ Y FIQVD +P   +
Sbjct  24   RSLHSESEVVKPERMVGKDDKQVTRVLFCGPHFPSSHNYTRGYLQKYPFIQVDVVPLSDV  83

Query  408  PAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGA  587
            P VIK+Y +CVVK + L+S++ISRA +MKLIMQ+GVGLEGVDI AAT HGIKVARI S  
Sbjct  84   PDVIKNYQMCVVKTMRLDSNVISRASQMKLIMQYGVGLEGVDIDAATKHGIKVARILSDG  143

Query  588  TGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLA  767
            TGNA SCAEMA+YL+LGLL+KQ+EM I+++ ++LG+P G+TLLGKTVFI+GYGNIGI LA
Sbjct  144  TGNAASCAEMAMYLMLGLLKKQNEMQISVRDRLLGQPAGETLLGKTVFILGYGNIGIELA  203

Query  768  KRLRPFDV  791
            KRL+PF V
Sbjct  204  KRLQPFGV  211



>ref|XP_006390689.1| hypothetical protein EUTSA_v10018793mg [Eutrema salsugineum]
 gb|ESQ27975.1| hypothetical protein EUTSA_v10018793mg [Eutrema salsugineum]
Length=350

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            +TRVLFCGP+FP ++N+TR+YV+ Y FIQVD +P   +P VIK+Y ICVVK++ L+S++I
Sbjct  28   VTRVLFCGPHFPDSNNFTRDYVQPYPFIQVDVVPLGDVPEVIKNYHICVVKSMQLDSNVI  87

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA +MK+IMQ+GVGLEGVDI AAT +GIKVARIPS  TGNA SC+EMAIYL+LGLL+KQ
Sbjct  88   SRATKMKIIMQYGVGLEGVDIDAATKNGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQ  147

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            +EM I+++ ++LG+P GDTLLGKTVFI+GYGNIGI LAKRLRPF
Sbjct  148  NEMQISVQSRLLGQPTGDTLLGKTVFILGYGNIGIELAKRLRPF  191



>ref|XP_006441520.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441525.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54760.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54765.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=344

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  79   MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  138

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  139  MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  198

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  199  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  252



>ref|XP_010063709.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=344

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++G   +TRVLFCGP+FPA+ +YTREY+  Y FIQVD+     +P VI +Y +CVVKN  
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
             +SD+I+RAK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ+E+  ++ Q+ LGEP+G+TL GKTV IMGYGNIGI LAKRLRPF V
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIMGYGNIGIDLAKRLRPFGV  175



>gb|KDO56050.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
 gb|KDO56051.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
 gb|KDO56052.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
Length=324

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  177



>ref|XP_010063710.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic 
isoform X2 [Eucalyptus grandis]
 gb|KCW70957.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=343

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++G   +TRVLFCGP+FPA+ +YTREY+  Y FIQVD+     +P VI +Y +CVVKN  
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
             +SD+I+RAK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ+E+  ++ Q+ LGEP+G+TL GKTV IMGYGNIGI LAKRLRPF V
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIMGYGNIGIDLAKRLRPFGV  175



>ref|XP_002521771.1| phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gb|EEF40581.1| phosphoglycerate dehydrogenase, putative [Ricinus communis]
Length=380

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = +3

Query  231  HCSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIP  410
            H +   +   +  M  + S++ITRVLFCGP+FPA+H YT++Y++ Y FIQVDD+P   +P
Sbjct  25   HSTLCSLSAPDRLMAGDNSNYITRVLFCGPHFPASHIYTKQYLQKYPFIQVDDVPLNDVP  84

Query  411  AVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGAT  590
             VI +Y ICV K   ++S +ISRA +MKLIMQFGVGLEG++I AA+  GIKVARIP   T
Sbjct  85   NVIANYHICVSKTTRIDSSIISRATQMKLIMQFGVGLEGINIDAASRCGIKVARIPGDFT  144

Query  591  GNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAK  770
            GNA SCAEMAIYL+LGLLRKQ++M ++IKQK LGEPIG+TLLGKTVFI+GYGNIGI LAK
Sbjct  145  GNAASCAEMAIYLMLGLLRKQNQMQVSIKQKKLGEPIGETLLGKTVFILGYGNIGIELAK  204

Query  771  RLRPFDV  791
            RL+PF V
Sbjct  205  RLQPFGV  211



>ref|XP_003598073.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula]
 gb|AES68324.1| D-isomer specific 2-hydroxyacid dehydrogenase domain protein 
[Medicago truncatula]
Length=382

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 149/184 (81%), Gaps = 7/184 (4%)
 Frame = +3

Query  258  KNLKMGKNGS------SHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            KNL M +NGS         TRVLFCGP FP +H YT EY++++S I+VD +P   IP  I
Sbjct  36   KNL-MERNGSMINDVERKTTRVLFCGPQFPCSHLYTTEYLQNHSSIKVDVLPLEEIPKAI  94

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
             +Y +CVVK + L+S++ISRA +MKLIMQ+GVGLEGVDI AAT HGIKVARIPSG TGN+
Sbjct  95   ANYHVCVVKMMKLDSNIISRAVQMKLIMQYGVGLEGVDIDAATKHGIKVARIPSGGTGNS  154

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
            T+CAEMAIYL+LGLLRKQ+EM I+I+Q+ LGEPIGDTL GKT+FI+G+GNIGI LA+RL+
Sbjct  155  TACAEMAIYLMLGLLRKQNEMQISIQQRKLGEPIGDTLFGKTIFILGFGNIGIDLARRLK  214

Query  780  PFDV  791
            PF V
Sbjct  215  PFGV  218



>gb|KDO56049.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
Length=348

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  246  GILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKD  425
            G + K   M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +
Sbjct  20   GDISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIAN  79

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            Y +CVVK + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA S
Sbjct  80   YHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAAS  139

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            CAE+ IYL+LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF
Sbjct  140  CAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPF  199

Query  786  DV  791
             V
Sbjct  200  GV  201



>ref|XP_006441517.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441519.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441522.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54757.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54759.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54762.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=346

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  177



>ref|XP_006478176.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X4 
[Citrus sinensis]
 ref|XP_006478177.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X5 
[Citrus sinensis]
Length=346

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD IP    P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAPDVIANYHLCVVKT  63

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  177



>gb|AFK43325.1| unknown [Medicago truncatula]
Length=344

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 146/180 (81%), Gaps = 6/180 (3%)
 Frame = +3

Query  270  MGKNGS------SHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYD  431
            M +NGS         TRVLFCGP FP +H YT EY++++S I+VD +P   IP  I +Y 
Sbjct  1    MERNGSMINDVERKTTRVLFCGPQFPCSHLYTTEYLQNHSSIKVDVLPLEEIPKAIANYH  60

Query  432  ICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCA  611
            +CVVK + L+S++ISRA +MKLIMQ+GVGLEGVDI AAT HGIKVARIPSG TGN+T+CA
Sbjct  61   VCVVKMMKLDSNIISRAVQMKLIMQYGVGLEGVDIDAATKHGIKVARIPSGGTGNSTACA  120

Query  612  EMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            EMAIYL+LGLLRKQ+EM I+I+Q+ LGEPIGDTL GKT+FI+G+GNIGI LA+RL+PF V
Sbjct  121  EMAIYLMLGLLRKQNEMQISIQQRKLGEPIGDTLFGKTIFILGFGNIGIDLARRLKPFGV  180



>ref|XP_006478175.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X3 
[Citrus sinensis]
Length=370

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = +3

Query  246  GILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKD  425
            G + K   M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD IP    P VI +
Sbjct  20   GDISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAPDVIAN  79

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            Y +CVVK + L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA S
Sbjct  80   YHLCVVKTMRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAAS  139

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            CAE+ IYL+LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF
Sbjct  140  CAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPF  199

Query  786  DV  791
             V
Sbjct  200  GV  201



>ref|XP_006478174.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=411

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = +3

Query  231  HCSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIP  410
            H S +  + K   M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD IP    P
Sbjct  56   HDSQSTDISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAP  115

Query  411  AVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGAT  590
             VI +Y +CVVK + L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   T
Sbjct  116  DVIANYHLCVVKTMRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVT  175

Query  591  GNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAK  770
            GNA SCAE+ IYL+LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAK
Sbjct  176  GNAASCAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAK  235

Query  771  RLRPFDV  791
            RLRPF V
Sbjct  236  RLRPFGV  242



>ref|XP_004499721.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X2 
[Cicer arietinum]
Length=379

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +3

Query  231  HCSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIP  410
            H +   ++ K+  + K+    ITRVLFCGP+FPA+H YT EY++++SFI+VD +P   +P
Sbjct  31   HNTRKNLMEKHGNLTKDFEKKITRVLFCGPHFPASHQYTTEYLQNHSFIKVDVLPLEEVP  90

Query  411  AVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGAT  590
              I +Y +C+VK + L+S++ISRA +M+LIMQ+GVGLEG+DI AAT HGIKVARIPS  T
Sbjct  91   KAISNYHVCIVKMMRLDSNIISRAVQMQLIMQYGVGLEGIDIDAATKHGIKVARIPSDVT  150

Query  591  GNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAK  770
            GNA SCAEMAIYL+LGLLRKQ+E+ I+I+Q+ LG+PI DTL GKT+FI+G+GNIG+ LA+
Sbjct  151  GNAASCAEMAIYLMLGLLRKQNELQISIQQRKLGDPITDTLFGKTIFILGFGNIGMDLAR  210

Query  771  RLRPFDV  791
            RL+PF V
Sbjct  211  RLKPFGV  217



>gb|KJB55663.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=374

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 143/184 (78%), Gaps = 9/184 (5%)
 Frame = +3

Query  240  SAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVI  419
            SAG+     K   +    ITRVLFCGP+FPA+  YTREY++ Y FIQVDD+P   +P  I
Sbjct  32   SAGMSSMAEKKDVDKDKPITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHI  91

Query  420  KDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNA  599
             +YD+CV KN+  +S+++SRAK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA
Sbjct  92   GNYDLCVSKNMLFDSNVLSRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNA  151

Query  600  TSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             SCAEMAIYL LGLLR         KQKMLGEPIG+TLLGKTVFIMG+GNIGI LAKRL+
Sbjct  152  ASCAEMAIYLTLGLLR---------KQKMLGEPIGETLLGKTVFIMGFGNIGIDLAKRLK  202

Query  780  PFDV  791
            PFDV
Sbjct  203  PFDV  206



>ref|XP_006441521.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54761.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=421

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  79   MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  138

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  139  MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  198

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  199  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  252



>gb|KJB55658.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55659.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55665.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=340

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 9/166 (5%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+  YTREY++ Y FIQVDD+P   +P  I +YD+CV KN+  +S+++
Sbjct  16   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  75

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRAK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLR  
Sbjct  76   SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLR--  133

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
                   KQKMLGEPIG+TLLGKTVFIMG+GNIGI LAKRL+PFDV
Sbjct  134  -------KQKMLGEPIGETLLGKTVFIMGFGNIGIDLAKRLKPFDV  172



>ref|XP_006441518.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54758.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=418

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD +P   +P VI +Y +CVVK 
Sbjct  79   MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  138

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S+ ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  139  MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  198

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  199  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  252



>ref|XP_004139684.2| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 isoform 
X1 [Cucumis sativus]
Length=337

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++ S  + RVLFCG  FP++HNYT EY+ +Y F+QVD IP   +P VI +Y ICVVK + 
Sbjct  6    EDSSKGLIRVLFCGSQFPSSHNYTCEYLLNYPFVQVDIIPCEDVPKVISNYHICVVKMMK  65

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
             + DLISRA +MKLI+QFGVGL+GVD+ AAT  GIKVARIPSG TGNA SCAEMAIYL+L
Sbjct  66   FDFDLISRASQMKLIVQFGVGLDGVDVDAATKRGIKVARIPSGVTGNALSCAEMAIYLML  125

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ EM IA+  KMLG P GDTLLGKTVFIMG+GNIG+ LAKRLRPF V
Sbjct  126  GLLRKQKEMQIAVDHKMLGVPTGDTLLGKTVFIMGFGNIGLELAKRLRPFGV  177



>ref|XP_004499720.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X1 
[Cicer arietinum]
Length=388

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 151/187 (81%), Gaps = 0/187 (0%)
 Frame = +3

Query  231  HCSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIP  410
            H +   ++ K+  + K+    ITRVLFCGP+FPA+H YT EY++++SFI+VD +P   +P
Sbjct  31   HNTRKNLMEKHGNLTKDFEKKITRVLFCGPHFPASHQYTTEYLQNHSFIKVDVLPLEEVP  90

Query  411  AVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGAT  590
              I +Y +C+VK + L+S++ISRA +M+LIMQ+GVGLEG+DI AAT HGIKVARIPS  T
Sbjct  91   KAISNYHVCIVKMMRLDSNIISRAVQMQLIMQYGVGLEGIDIDAATKHGIKVARIPSDVT  150

Query  591  GNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAK  770
            GNA SCAEMAIYL+LGLLRKQ+E+ I+I+Q+ LG+PI DTL GKT+FI+G+GNIG+ LA+
Sbjct  151  GNAASCAEMAIYLMLGLLRKQNELQISIQQRKLGDPITDTLFGKTIFILGFGNIGMDLAR  210

Query  771  RLRPFDV  791
            RL+PF V
Sbjct  211  RLKPFGV  217



>ref|XP_006478173.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=421

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++   +ITRVLFCGP+FPA+HNYT+EY+++Y  IQVD IP    P VI +Y +CVVK 
Sbjct  79   MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAPDVIANYHLCVVKT  138

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S++ISRA +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  139  MRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  198

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM +AI+QK LG P G+TLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  199  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFILGFGNIGVELAKRLRPFGV  252



>ref|XP_007015897.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY33516.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
Length=343

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+ NYTREY++ Y FIQVD++    +P  I +Y +CVV N+ L+S++I
Sbjct  10   ITRVLFCGPHFPASQNYTREYLEKYPFIQVDEVALKDVPDHIGNYHLCVVLNMRLDSNVI  69

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA +MKLIMQFGVGLEGVD+ AAT  GIKVARIP  ATGNA SCAEMAIYLILGLLRKQ
Sbjct  70   SRANQMKLIMQFGVGLEGVDVDAATRLGIKVARIPGDATGNAASCAEMAIYLILGLLRKQ  129

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I++KQK LGEP+G+TL GKTVFIMG+GNIGI LA  L+PF V
Sbjct  130  NEMQISVKQKKLGEPLGETLFGKTVFIMGFGNIGIALANLLKPFGV  175



>ref|XP_007015898.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY33517.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
Length=329

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ITRVLFCGP+FPA+ NYTREY++ Y FIQVD++    +P  I +Y +CVV N+ L+S++I
Sbjct  10   ITRVLFCGPHFPASQNYTREYLEKYPFIQVDEVALKDVPDHIGNYHLCVVLNMRLDSNVI  69

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA +MKLIMQFGVGLEGVD+ AAT  GIKVARIP  ATGNA SCAEMAIYLILGLLRKQ
Sbjct  70   SRANQMKLIMQFGVGLEGVDVDAATRLGIKVARIPGDATGNAASCAEMAIYLILGLLRKQ  129

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +EM I++KQK LGEP+G+TL GKTVFIMG+GNIGI LA  L+PF V
Sbjct  130  NEMQISVKQKKLGEPLGETLFGKTVFIMGFGNIGIALANLLKPFGV  175



>ref|XP_012079725.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase [Jatropha 
curcas]
 ref|XP_012079726.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase [Jatropha 
curcas]
 gb|KDP31626.1| hypothetical protein JCGZ_14851 [Jatropha curcas]
Length=343

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M +    HIT+VLFCGP+FPA+H YT+EY++ Y FIQVD      +P VI +Y ICV K 
Sbjct  1    MERANDQHITKVLFCGPHFPASHIYTKEYLQSYPFIQVDVAQISDVPDVIGNYHICVSKT  60

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            + L+S +ISRA +MKLIMQFGVGL+G+DI AAT  GIKVARIP   TGNA SCAEMAIYL
Sbjct  61   VRLDSTVISRASQMKLIMQFGVGLDGIDIDAATRLGIKVARIPGVNTGNAASCAEMAIYL  120

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRKQ+EM ++IKQK LGEPIG TLLGKTVFI+G+GNIGI LAKRLRPF V
Sbjct  121  MLGLLRKQNEMQVSIKQKKLGEPIGQTLLGKTVFILGFGNIGIELAKRLRPFGV  174



>tpg|DAA39792.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=395

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 146/190 (77%), Gaps = 4/190 (2%)
 Frame = +3

Query  234  CSSAGILGKNLKMG----KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFV  401
            C  +G +G+  KMG    +NG   +TRVLFCGP +PA+ NYTREY++DY FIQVD++   
Sbjct  48   CFVSGCVGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLE  107

Query  402  YIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
             +P VI  Y ICVVKN  ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP 
Sbjct  108  QVPDVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPG  167

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIH  761
              TGNA SCAEMAIYL LG+LRKQ EMD A+ +K LG P+GDTL GKT+ I+G+G IGI 
Sbjct  168  STTGNAVSCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILILGFGAIGIE  227

Query  762  LAKRLRPFDV  791
            +AKRLRPF V
Sbjct  228  VAKRLRPFGV  237



>ref|XP_008667394.1| PREDICTED: uncharacterized protein LOC100217241 isoform X2 [Zea 
mays]
Length=386

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 146/191 (76%), Gaps = 4/191 (2%)
 Frame = +3

Query  231  HCSSAGILGKNLKMG----KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPF  398
              + AG+ G+  KMG    +NG   +TRVLFCGP +PA+ NYTREY++DY FIQVD++  
Sbjct  38   QVARAGLPGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGL  97

Query  399  VYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIP  578
              +P VI  Y ICVVKN  ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP
Sbjct  98   EQVPDVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIP  157

Query  579  SGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGI  758
               TGNA SCAEMAIYL LG+LRKQ EMD A+ +K LG P+GDTL GKT+ I+G+G IGI
Sbjct  158  GSTTGNAVSCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILILGFGAIGI  217

Query  759  HLAKRLRPFDV  791
             +AKRLRPF V
Sbjct  218  EVAKRLRPFGV  228



>gb|KHN24796.1| D-3-phosphoglycerate dehydrogenase [Glycine soja]
Length=391

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 161/222 (73%), Gaps = 5/222 (2%)
 Frame = +3

Query  126  TLRKRTSLFSNNSPTSGGGWRVVEDNFSHqqqqqRHCSSAGILGKNLKMGKNGSSHITRV  305
            T  +R +L   ++      W     +  H   + ++   AG++  N    K+    ITRV
Sbjct  11   TCCRRLTLARQSTQKQKQWW-----DHLHHHLRSKNLHWAGLMESNGNSVKDAEKQITRV  65

Query  306  LFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAK  485
            LFCGP FPA+H YT EY++++S I+VD +P   +P  I +Y +C+VKN+ L+S++ISRA 
Sbjct  66   LFCGPRFPASHEYTIEYLQNHSHIKVDVLPLEDVPKDIANYHVCIVKNMRLDSEIISRAV  125

Query  486  RMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMD  665
            +M+LIMQ+GVGLEGVDI AAT HGIKVARIP   +GN+ SCAEMAIYL+LGLLRKQ+E+ 
Sbjct  126  QMQLIMQYGVGLEGVDIDAATKHGIKVARIPGDVSGNSASCAEMAIYLMLGLLRKQNELQ  185

Query  666  IAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            ++I+QK LGEPI +TLLGKT+FI+G+GNIG+ LAKRL+PF V
Sbjct  186  VSIQQKKLGEPITETLLGKTIFILGFGNIGMDLAKRLQPFGV  227



>ref|XP_008461934.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Cucumis melo]
Length=329

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++ S  + RVLFCG +FP++HNYT EY+ +Y F+QVD +P   +P VI +Y ICV K + 
Sbjct  6    EDSSKGLIRVLFCGSHFPSSHNYTSEYLLNYPFVQVDVVPCEDVPKVISNYHICVTKMMK  65

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
             + DLISRA +MKLI+QFGVGL+GVD+ AAT  GIKVARIPSG TGNA SCAEMAIYL+L
Sbjct  66   FDFDLISRASQMKLIVQFGVGLDGVDVDAATKLGIKVARIPSGVTGNAMSCAEMAIYLML  125

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ EM IA+  K LGEP GDTLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  126  GLLRKQKEMQIAVDHKKLGEPTGDTLLGKTVFILGFGNIGLELAKRLRPFGV  177



>ref|XP_002888861.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65120.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  228  RHCSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYI  407
            R  S    + K  +M +    H+TRVL CGP FP ++N+TREY++ Y FIQVD + +  +
Sbjct  29   RSISRQSKVVKTERMVEKEDMHVTRVLCCGPYFPDSYNFTREYLQPYPFIQVDVVHYRDV  88

Query  408  PAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGA  587
            P VIK+Y ICV   + ++S++ISRA +MKLIMQ+GVGL+GVD+ AAT HGIKVARIPS  
Sbjct  89   PEVIKNYHICVAMTMQMDSNVISRASKMKLIMQYGVGLDGVDVDAATKHGIKVARIPSEG  148

Query  588  TGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLA  767
            TGNA SC+EMAIYL+LGLL+KQ+EM I+++ ++LGEP GDTLLGKTVFI+GYGNIG  LA
Sbjct  149  TGNAASCSEMAIYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFILGYGNIGTELA  208

Query  768  KRLRPF  785
            KRL+PF
Sbjct  209  KRLKPF  214



>ref|XP_010474292.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic-like 
[Camelina sativa]
Length=292

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = +3

Query  255  GKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDI  434
             K  +M +    ++TRVL CGP FP A N+TREY++ Y FIQVD + +  +P VIK+Y I
Sbjct  38   SKPERMVETNEMNVTRVLCCGPYFPDACNFTREYLQPYPFIQVDIVHYRDVPEVIKNYHI  97

Query  435  CVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAE  614
            CV   + ++S +ISRA +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+E
Sbjct  98   CVAMTMKMDSYVISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSE  157

Query  615  MAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            MAIYL+LGLL+KQ+EM ++++ ++LGEP GDTLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  158  MAIYLMLGLLKKQNEMQVSLRSRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPF  214



>ref|NP_001242647.1| uncharacterized protein LOC100785085 [Glycine max]
 gb|ACU23032.1| unknown [Glycine max]
Length=391

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 161/222 (73%), Gaps = 5/222 (2%)
 Frame = +3

Query  126  TLRKRTSLFSNNSPTSGGGWRVVEDNFSHqqqqqRHCSSAGILGKNLKMGKNGSSHITRV  305
            T  +R +L   ++      W     +  H   + ++   AG++  N    K+    ITRV
Sbjct  11   TCCRRLTLARQSTQKQKQWW-----DHLHHHLRSKNLHWAGLMESNGNSVKDAEKQITRV  65

Query  306  LFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAK  485
            LFCGP FPA+H YT EY++++S I+VD +P   +P  I +Y +C+VKN+ L+S++ISRA 
Sbjct  66   LFCGPRFPASHEYTIEYLQNHSHIKVDVLPLEDVPKDIANYHVCIVKNMRLDSEIISRAV  125

Query  486  RMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMD  665
            +M+LIMQ+GVGLEGVDI AAT HGIKVARIP   +GN+ SCAEMAIYL+LGLLRKQ+E+ 
Sbjct  126  QMQLIMQYGVGLEGVDIDAATKHGIKVARIPGDVSGNSASCAEMAIYLMLGLLRKQNELQ  185

Query  666  IAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            ++I+QK LGEPI +TLLGKT+FI+G+GNIG+ LAKRL+PF V
Sbjct  186  VSIQQKKLGEPITETLLGKTIFILGFGNIGMDLAKRLQPFGV  227



>ref|NP_177364.2| D-isomer specific 2-hydroxyacid dehydrogenase domain protein 
ARA [Arabidopsis thaliana]
 gb|AEE35287.1| D-isomer specific 2-hydroxyacid dehydrogenase-like protein [Arabidopsis 
thaliana]
Length=373

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  291  HITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDL  470
            H+TRVLFCGP+FP ++N+TREY++ Y FI+VD + +  +P VIK+Y ICV   + ++S++
Sbjct  50   HVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHICVAMTMQMDSNV  109

Query  471  ISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  650
            ISRA  +KLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIYL+LGLL+K
Sbjct  110  ISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKK  169

Query  651  QHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            Q+EM I+++ ++LGEP GDTLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  170  QNEMQISLRNRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPF  214



>ref|XP_007148628.1| hypothetical protein PHAVU_005G002200g [Phaseolus vulgaris]
 gb|ESW20622.1| hypothetical protein PHAVU_005G002200g [Phaseolus vulgaris]
Length=382

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +3

Query  228  RHCSSAGILGKNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYI  407
            ++  S G++  N  + K+     TRVLFCGP+FPA+H YT EY+K+++ I+VD + F  +
Sbjct  31   QYLHSTGLMEINGNLVKHVEKQTTRVLFCGPHFPASHEYTIEYLKNHAHIKVDVLSFEDV  90

Query  408  PAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGA  587
            P  I +Y +C+VK++ LNSD+ISRA +M+LIMQ+GVGLEGVDI AAT HGIKVARIPS  
Sbjct  91   PKDIANYHVCIVKSMRLNSDIISRAVQMQLIMQYGVGLEGVDIDAATKHGIKVARIPSDV  150

Query  588  TGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLA  767
            TGN+ SCAEMAIYL+LGLLRKQ+E+ ++I+QK LGEPI +TL GKT+FI+G+GNIG+ LA
Sbjct  151  TGNSASCAEMAIYLMLGLLRKQNELQLSIQQKKLGEPITETLYGKTIFILGFGNIGMDLA  210

Query  768  KRLRPFDV  791
            KRL+PF V
Sbjct  211  KRLQPFGV  218



>gb|AAG51802.1|AC067754_18 phosphoglycerate dehydrogenase, putative; 33424-31403 [Arabidopsis 
thaliana]
Length=344

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  291  HITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDL  470
            H+TRVLFCGP+FP ++N+TREY++ Y FI+VD + +  +P VIK+Y ICV   + ++S++
Sbjct  21   HVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHICVAMTMQMDSNV  80

Query  471  ISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  650
            ISRA  +KLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIYL+LGLL+K
Sbjct  81   ISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKK  140

Query  651  QHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            Q+EM I+++ ++LGEP GDTLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  141  QNEMQISLRNRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPF  185



>ref|XP_008461933.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X1 [Cucumis melo]
Length=337

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++ S  + RVLFCG +FP++HNYT EY+ +Y F+QVD +P   +P VI +Y ICV K + 
Sbjct  6    EDSSKGLIRVLFCGSHFPSSHNYTSEYLLNYPFVQVDVVPCEDVPKVISNYHICVTKMMK  65

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
             + DLISRA +MKLI+QFGVGL+GVD+ AAT  GIKVARIPSG TGNA SCAEMAIYL+L
Sbjct  66   FDFDLISRASQMKLIVQFGVGLDGVDVDAATKLGIKVARIPSGVTGNAMSCAEMAIYLML  125

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ EM IA+  K LGEP GDTLLGKTVFI+G+GNIG+ LAKRLRPF V
Sbjct  126  GLLRKQKEMQIAVDHKKLGEPTGDTLLGKTVFILGFGNIGLELAKRLRPFGV  177



>ref|XP_008667393.1| PREDICTED: uncharacterized protein LOC100217241 isoform X1 [Zea 
mays]
Length=423

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 146/189 (77%), Gaps = 4/189 (2%)
 Frame = +3

Query  237  SSAGILGKNLKMG----KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVY  404
            + AG+ G+  KMG    +NG   +TRVLFCGP +PA+ NYTREY++DY FIQVD++    
Sbjct  77   ARAGLPGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQ  136

Query  405  IPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSG  584
            +P VI  Y ICVVKN  ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP  
Sbjct  137  VPDVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGS  196

Query  585  ATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHL  764
             TGNA SCAEMAIYL LG+LRKQ EMD A+ +K LG P+GDTL GKT+ I+G+G IGI +
Sbjct  197  TTGNAVSCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILILGFGAIGIEV  256

Query  765  AKRLRPFDV  791
            AKRLRPF V
Sbjct  257  AKRLRPFGV  265



>ref|NP_001137068.1| uncharacterized protein LOC100217241 [Zea mays]
 gb|ACF83195.1| unknown [Zea mays]
 tpg|DAA39794.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=379

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = +3

Query  210  HqqqqqRHCSSAGILGKNLKMG----KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFI  377
            H     R  S +   G+  KMG    +NG   +TRVLFCGP +PA+ NYTREY++DY FI
Sbjct  24   HAAAHHRLHSPSSSQGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFI  83

Query  378  QVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHG  557
            QVD++    +P VI  Y ICVVKN  ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H 
Sbjct  84   QVDEVGLEQVPDVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHK  143

Query  558  IKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIM  737
            IKVARIP   TGNA SCAEMAIYL LG+LRKQ EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  144  IKVARIPGSTTGNAVSCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILIL  203

Query  738  GYGNIGIHLAKRLRPFDV  791
            G+G IGI +AKRLRPF V
Sbjct  204  GFGAIGIEVAKRLRPFGV  221



>ref|XP_006577809.1| PREDICTED: uncharacterized protein LOC100785085 isoform X1 [Glycine 
max]
 ref|XP_006577810.1| PREDICTED: uncharacterized protein LOC100785085 isoform X2 [Glycine 
max]
Length=344

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            K+    ITRVLFCGP FPA+H YT EY++++S I+VD +P   +P  I +Y +C+VKN+ 
Sbjct  9    KDAEKQITRVLFCGPRFPASHEYTIEYLQNHSHIKVDVLPLEDVPKDIANYHVCIVKNMR  68

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            L+S++ISRA +M+LIMQ+GVGLEGVDI AAT HGIKVARIP   +GN+ SCAEMAIYL+L
Sbjct  69   LDSEIISRAVQMQLIMQYGVGLEGVDIDAATKHGIKVARIPGDVSGNSASCAEMAIYLML  128

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            GLLRKQ+E+ ++I+QK LGEPI +TLLGKT+FI+G+GNIG+ LAKRL+PF V
Sbjct  129  GLLRKQNELQVSIQQKKLGEPITETLLGKTIFILGFGNIGMDLAKRLQPFGV  180



>gb|KFK41640.1| hypothetical protein AALP_AA2G154000 [Arabis alpina]
Length=367

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  291  HITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDL  470
             +TRVLFCGP+FP ++N+TREYV+ Y FIQ D +    +P VI +Y ICV+ ++ ++S++
Sbjct  44   EVTRVLFCGPHFPDSYNFTREYVQPYPFIQADVVHVHDVPEVINNYHICVIMSMQMDSNV  103

Query  471  ISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  650
            ISRA  MKLIMQ+GVGLEGVDI AAT HGIKVARIPS  TGNA SC+EMAIYL+LGLL+K
Sbjct  104  ISRASNMKLIMQYGVGLEGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKK  163

Query  651  QHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            Q+EM I+++ ++LG+P G TLLGKTVFI+GYGNIGI LAKRLRPF
Sbjct  164  QNEMQISVQSRLLGQPTGGTLLGKTVFILGYGNIGIELAKRLRPF  208



>ref|XP_008667395.1| PREDICTED: uncharacterized protein LOC100217241 isoform X3 [Zea 
mays]
 tpg|DAA39796.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=336

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 137/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            +NG   +TRVLFCGP +PA+ NYTREY++DY FIQVD++    +P VI  Y ICVVKN  
Sbjct  7    RNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQVPDVIHSYHICVVKNKR  66

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  67   IDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTL  126

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            G+LRKQ EMD A+ +K LG P+GDTL GKT+ I+G+G IGI +AKRLRPF V
Sbjct  127  GILRKQKEMDTAVNRKDLGVPVGDTLFGKTILILGFGAIGIEVAKRLRPFGV  178



>ref|XP_010428086.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic-like 
[Camelina sativa]
Length=371

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +3

Query  258  KNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDIC  437
            K  +M +    ++TRVL CGP FP A N+TREY++ Y F+QVD + +  +P VIK+Y IC
Sbjct  37   KPERMVETNEMNVTRVLCCGPYFPDACNFTREYLQPYPFVQVDIVHYRDVPEVIKNYHIC  96

Query  438  VVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEM  617
            V   + ++S +ISRA +MKLIMQFGVGL+GVDI AAT HGIKVARIPS  TGNA SC+EM
Sbjct  97   VAMTMKMDSYVISRASKMKLIMQFGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEM  156

Query  618  AIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            AIYL+LGLL+KQ+EM ++++ ++LGEP GDTLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  157  AIYLMLGLLKKQNEMQVSLRSRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPF  212



>ref|XP_002459676.1| hypothetical protein SORBIDRAFT_02g008660 [Sorghum bicolor]
 gb|EER96197.1| hypothetical protein SORBIDRAFT_02g008660 [Sorghum bicolor]
Length=385

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 142/183 (78%), Gaps = 4/183 (2%)
 Frame = +3

Query  255  GKNLKMG----KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIK  422
            G   KMG    KNG   +TRVLFCGP +PA+ NYT+EY++DY FIQVD++    +P VI 
Sbjct  45   GHYSKMGDSSEKNGHGTLTRVLFCGPYWPASTNYTKEYLQDYPFIQVDEVGLEQVPDVID  104

Query  423  DYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNAT  602
            +Y ICVVKN  ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA 
Sbjct  105  NYHICVVKNRRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAV  164

Query  603  SCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRP  782
            SCAEMAIYL LG+LRKQ EMD A+ +K LG P+GDTL GKTV I+G+G IG+ LAKRLRP
Sbjct  165  SCAEMAIYLALGVLRKQKEMDTAVNRKDLGIPVGDTLFGKTVLILGFGAIGVELAKRLRP  224

Query  783  FDV  791
            F V
Sbjct  225  FGV  227



>ref|XP_008802909.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=379

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 145/191 (76%), Gaps = 5/191 (3%)
 Frame = +3

Query  234  CSSAGILGKNL-KMGK----NGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPF  398
            CS A  LG    KM +    NG +HITRVLFCG  + A+  YTREY+++Y FIQ+D++  
Sbjct  23   CSPACFLGAGYSKMAEVTAENGYNHITRVLFCGFYWSASQKYTREYLQNYPFIQIDEVAL  82

Query  399  VYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIP  578
              +P VI  Y ICVVKN  ++S +I++A +MKLIMQFGVGLEGVDI AAT H IKVARIP
Sbjct  83   DDVPDVIDKYHICVVKNRRMDSKVIAKAVQMKLIMQFGVGLEGVDIDAATRHKIKVARIP  142

Query  579  SGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGI  758
               TGN+ SCAEMAIYL+LGLLRKQ EMD+A+KQK LGEP GDTLLGKTV I+G+G IG+
Sbjct  143  GSVTGNSASCAEMAIYLMLGLLRKQKEMDVAVKQKNLGEPTGDTLLGKTVLILGFGAIGV  202

Query  759  HLAKRLRPFDV  791
             LAKRLR F V
Sbjct  203  DLAKRLRSFGV  213



>ref|XP_010414841.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic-like 
[Camelina sativa]
Length=373

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +3

Query  258  KNLKMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDIC  437
            K  +M +    ++TRVL CGP FP A N+TREY++ Y F+QVD + +  +P VIK Y IC
Sbjct  39   KPERMVETNEMNVTRVLCCGPYFPDACNFTREYLQPYPFVQVDIVHYRDVPEVIKKYHIC  98

Query  438  VVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEM  617
            V   + ++S +ISRA +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EM
Sbjct  99   VAMTMKMDSYIISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEM  158

Query  618  AIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            AIYL+LGLL+KQ+EM ++++ ++LGEP GDTLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  159  AIYLMLGLLKKQNEMQVSLRSRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPF  214



>ref|XP_008802910.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Phoenix dactylifera]
 ref|XP_008802911.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=344

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  273  GKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNL  452
             +NG +HITRVLFCG  + A+  YTREY+++Y FIQ+D++    +P VI  Y ICVVKN 
Sbjct  6    AENGYNHITRVLFCGFYWSASQKYTREYLQNYPFIQIDEVALDDVPDVIDKYHICVVKNR  65

Query  453  GLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLI  632
             ++S +I++A +MKLIMQFGVGLEGVDI AAT H IKVARIP   TGN+ SCAEMAIYL+
Sbjct  66   RMDSKVIAKAVQMKLIMQFGVGLEGVDIDAATRHKIKVARIPGSVTGNSASCAEMAIYLM  125

Query  633  LGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            LGLLRKQ EMD+A+KQK LGEP GDTLLGKTV I+G+G IG+ LAKRLR F V
Sbjct  126  LGLLRKQKEMDVAVKQKNLGEPTGDTLLGKTVLILGFGAIGVDLAKRLRSFGV  178



>tpg|DAA39795.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=378

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 146/198 (74%), Gaps = 5/198 (3%)
 Frame = +3

Query  210  HqqqqqRHCSSAGILGKNLKMG----KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFI  377
            H     R  S +   G+  KMG    +NG   +TRVLFCGP +PA+ NYTREY++DY FI
Sbjct  24   HAAAHHRLHSPSSSQGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFI  83

Query  378  QVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHG  557
            QVD++    +P VI  Y ICVVKN  ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H 
Sbjct  84   QVDEVGLEQVPDVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHK  143

Query  558  IKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIM  737
            IKVARIP   TGNA SCAEMAIYL LG+LRKQ EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  144  IKVARIPGSTTGNAVSCAEMAIYLTLGILRKQ-EMDTAVNRKDLGVPVGDTLFGKTILIL  202

Query  738  GYGNIGIHLAKRLRPFDV  791
            G+G IGI +AKRLRPF V
Sbjct  203  GFGAIGIEVAKRLRPFGV  220



>ref|XP_010471237.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic-like 
[Camelina sativa]
Length=370

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 140/173 (81%), Gaps = 0/173 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            +M      ++TRVL CGP FP A N+TREY++ Y F+QVD + +  +P VIK+Y ICV  
Sbjct  39   RMVGTNEMNVTRVLCCGPYFPDACNFTREYLQPYPFVQVDIVHYRDVPEVIKNYHICVAM  98

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
             + ++S +ISRA +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIY
Sbjct  99   TMKMDSYVISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIY  158

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            L+LGLL+KQ+EM ++++ ++LGEP GDTLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  159  LMLGLLKKQNEMQVSLRSRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPF  211



>ref|XP_003557318.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Brachypodium 
distachyon]
Length=377

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G N  + +TRVLFCGP +PA+  YT+EYV++Y FIQVD++    +P VI +Y +CVVKN
Sbjct  46   IGNNDHNDVTRVLFCGPYWPASTIYTKEYVQNYPFIQVDEVDLEQVPEVIHNYHLCVVKN  105

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              ++SD+I++A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNA +CAEMAIYL
Sbjct  106  RRIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNAIACAEMAIYL  165

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             LG+LRKQ EMD A+KQK LG P+G+T+ GKTV I+G+G+IG+ +AKRLRPF V
Sbjct  166  TLGVLRKQKEMDAAVKQKDLGLPVGETIFGKTVLILGFGSIGVEVAKRLRPFGV  219



>ref|XP_006301744.1| hypothetical protein CARUB_v10022205mg, partial [Capsella rubella]
 gb|EOA34642.1| hypothetical protein CARUB_v10022205mg, partial [Capsella rubella]
Length=374

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  291  HITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDL  470
            H+T VLFCGP FP ++N+TREY++ Y FIQVD + +  +P VIK+Y ICV   + ++S++
Sbjct  51   HVTHVLFCGPYFPDSYNFTREYLQAYPFIQVDVVHYRDVPEVIKNYHICVSMTMQMDSNV  110

Query  471  ISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  650
            ISRA +MKLIMQ+GVGL+GVDI AAT +GIKVARIPS   GNA SC+EMAIYL+LGLL+K
Sbjct  111  ISRASKMKLIMQYGVGLDGVDIDAATKNGIKVARIPSEGNGNAASCSEMAIYLMLGLLKK  170

Query  651  QHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            Q+EM I+++ + LGEP G TLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  171  QNEMQISLRSRRLGEPTGGTLLGKTVFILGYGNIGIELAKRLQPF  215



>ref|XP_010415950.1| PREDICTED: LOW QUALITY PROTEIN: glyoxylate reductase/hydroxypyruvate 
reductase-like [Camelina sativa]
Length=370

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            +M  +   ++TRVL CGP FP A N+TREY++ Y F QVD + +  +P VIK+Y ICV  
Sbjct  39   RMVXDNEMNVTRVLCCGPYFPDACNFTREYLQPYPFAQVDIVHYRDVPEVIKNYHICVAM  98

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
             + ++S +ISRA +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIY
Sbjct  99   TMKMDSYIISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIY  158

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            L+LGLL+KQ+EM ++++ + LGEP GDTLLGKTVFI+G+GNIGI LAKRL+PF
Sbjct  159  LMLGLLKKQNEMQVSLRCRRLGEPTGDTLLGKTVFILGFGNIGIELAKRLKPF  211



>gb|EEC81831.1| hypothetical protein OsI_25581 [Oryza sativa Indica Group]
Length=383

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++GS  ITRVLFCGP +PA+ N+T+EY++ Y FIQVD++    +P VI++Y +CVVKN  
Sbjct  54   RSGSGDITRVLFCGPYWPASTNFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRR  113

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            L+SD+I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  114  LDSDIIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTL  173

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            G+LRKQ  MD A+K+K LG P+GDT+ GK+V I+G+G IG+ +AKRLRPF V
Sbjct  174  GVLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLILGFGAIGVEIAKRLRPFGV  225



>ref|XP_007015896.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY33515.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
Length=376

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 139/182 (76%), Gaps = 16/182 (9%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQ----------------VDDIPFVYIPAVIKD  425
            ITRVLFCGP+FPA+ NYTREY++ Y FIQ                VD++    +P  I +
Sbjct  28   ITRVLFCGPHFPASQNYTREYLEKYPFIQAICSNSHLMHLFAERFVDEVALKDVPDHIGN  87

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            Y +CVV N+ L+S++ISRA +MKLIMQFGVGLEGVD+ AAT  GIKVARIP  ATGNA S
Sbjct  88   YHLCVVLNMRLDSNVISRANQMKLIMQFGVGLEGVDVDAATRLGIKVARIPGDATGNAAS  147

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            CAEMAIYLILGLLRKQ+EM I++KQK LGEP+G+TL GKTVFIMG+GNIGI LA  L+PF
Sbjct  148  CAEMAIYLILGLLRKQNEMQISVKQKKLGEPLGETLFGKTVFIMGFGNIGIALANLLKPF  207

Query  786  DV  791
             V
Sbjct  208  GV  209



>gb|AER41609.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glaberrima]
Length=373

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++GS  ITRVLFCGP +PA+ N+T+EY++ Y FIQVD++    +P VI++Y +CVVKN  
Sbjct  44   RSGSGDITRVLFCGPYWPASTNFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRR  103

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            L+SD I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  104  LDSDTIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTL  163

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            G+LRKQ  MD A+K+K LG P+GDT+ GK+V I+G+G IG+ +AKRLRPF V
Sbjct  164  GVLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLILGFGAIGVEIAKRLRPFGV  215



>ref|XP_004984235.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Setaria italica]
Length=336

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 137/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  273  GKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNL  452
            G N    +TRVLFCGP +PA+ NYTREY+++Y +IQVD++    +  VI++Y ICVVKN 
Sbjct  6    GSNSHGAVTRVLFCGPYWPASTNYTREYLQNYPYIQVDEVGLEQVLDVIQNYHICVVKNK  65

Query  453  GLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLI  632
             ++SD+I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL 
Sbjct  66   RIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLT  125

Query  633  LGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            LG+LRKQ EMD A+ +K LG P+GDTL GKTV I+G+G IGI +AKRL+PF V
Sbjct  126  LGVLRKQKEMDTAVNRKDLGVPVGDTLFGKTVLILGFGAIGIEVAKRLKPFGV  178



>ref|XP_010683411.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683483.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683555.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  285  SSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNS  464
               +TRVLFCG  F A+++YT+EY+ +Y  IQVDD+    IP VI +Y +C+ +   L+S
Sbjct  5    EQQVTRVLFCGQQFSASYDYTKEYLSNYPHIQVDDVILSDIPNVIGNYHMCIPRMTRLDS  64

Query  465  DLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  644
            ++IS AK+MKLI+QFGVGLEGVD+ AAT HGIKVARIP+  TGNA SC EMAIYL+LGLL
Sbjct  65   EIISSAKQMKLIVQFGVGLEGVDVDAATKHGIKVARIPADGTGNAASCGEMAIYLMLGLL  124

Query  645  RKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            RKQ EM+I+I+ K LGEP G TL GKTVFI+GYGNIG  LAKRLRPFDV
Sbjct  125  RKQKEMEISIQLKRLGEPAGGTLFGKTVFILGYGNIGRELAKRLRPFDV  173



>dbj|BAD31969.1| phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD30579.1| phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica 
Group]
Length=336

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++GS  ITRVLFCGP +PA+ ++T+EY++ Y FIQVD++    +P VI++Y +CVVKN  
Sbjct  7    RSGSGDITRVLFCGPYWPASTSFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRR  66

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            L+SD I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  67   LDSDTIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTL  126

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            G+LRKQ  MD A+K+K LG P+GDT+ GK+V I+G+G IG+ +AKRLRPF V
Sbjct  127  GVLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLILGFGAIGVEIAKRLRPFGV  178



>ref|NP_001059330.1| Os07g0264100 [Oryza sativa Japonica Group]
 dbj|BAF21244.1| Os07g0264100 [Oryza sativa Japonica Group]
 dbj|BAG89417.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96786.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66922.1| hypothetical protein OsJ_23776 [Oryza sativa Japonica Group]
Length=374

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            ++GS  ITRVLFCGP +PA+ ++T+EY++ Y FIQVD++    +P VI++Y +CVVKN  
Sbjct  45   RSGSGDITRVLFCGPYWPASTSFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRR  104

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            L+SD I++A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  105  LDSDTIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTL  164

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            G+LRKQ  MD A+K+K LG P+GDT+ GK+V I+G+G IG+ +AKRLRPF V
Sbjct  165  GVLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLILGFGAIGVEIAKRLRPFGV  216



>ref|XP_009393479.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393480.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            IT VLFCG +FPA+ NYTREY+K Y FI+VD++P   +P VI  Y ICVVKN   ++ +I
Sbjct  12   ITNVLFCGFHFPASQNYTREYLKGYPFIKVDEVPLDEVPNVIHRYHICVVKNRRFDATVI  71

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
             +A +MKL+MQFGVGLEGVDI AAT   IKVARIP  +TGNA SCAEMAIYLILGLLRKQ
Sbjct  72   DKAVQMKLLMQFGVGLEGVDIEAATRCNIKVARIPGSSTGNAASCAEMAIYLILGLLRKQ  131

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             EMD A+K K LG P+G+TLLGKTVFI+G+G IG+ LAKRLRPF V
Sbjct  132  KEMDNAVKLKNLGVPVGETLLGKTVFILGFGAIGVDLAKRLRPFGV  177



>ref|XP_009393478.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=375

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 139/179 (78%), Gaps = 3/179 (2%)
 Frame = +3

Query  264  LKMG---KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDI  434
            L+MG   +   + IT VLFCG +FPA+ NYTREY+K Y FI+VD++P   +P VI  Y I
Sbjct  31   LRMGDGVEKSHNDITNVLFCGFHFPASQNYTREYLKGYPFIKVDEVPLDEVPNVIHRYHI  90

Query  435  CVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAE  614
            CVVKN   ++ +I +A +MKL+MQFGVGLEGVDI AAT   IKVARIP  +TGNA SCAE
Sbjct  91   CVVKNRRFDATVIDKAVQMKLLMQFGVGLEGVDIEAATRCNIKVARIPGSSTGNAASCAE  150

Query  615  MAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            MAIYLILGLLRKQ EMD A+K K LG P+G+TLLGKTVFI+G+G IG+ LAKRLRPF V
Sbjct  151  MAIYLILGLLRKQKEMDNAVKLKNLGVPVGETLLGKTVFILGFGAIGVDLAKRLRPFGV  209



>emb|CDX68275.1| BnaA07g23150D [Brassica napus]
Length=372

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 135/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            K     +TRVLFCGP+ P ++N+TR+Y++ Y FIQ D   F  +P VIK+Y ICV   + 
Sbjct  44   KEEDKKVTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQ  103

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            ++S +ISRA  MKLIMQFGVGL+GVDI AAT HGIKVARIPS   GNA SC+EMAIYL+L
Sbjct  104  MDSFVISRATNMKLIMQFGVGLDGVDIDAATKHGIKVARIPSEGNGNAASCSEMAIYLML  163

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            GLL+KQ+EM ++++ ++LG+P G TLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  164  GLLKKQNEMQMSVQSRLLGQPTGGTLLGKTVFILGYGNIGIELAKRLKPF  213



>ref|XP_010095912.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXB62506.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=358

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  279  NGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGL  458
            N    ITRV+FCGP+FPA+HNYTR+Y++DY FIQVD++P   +P VI++Y +CVVK + L
Sbjct  10   NAQEKITRVIFCGPHFPASHNYTRQYLQDYPFIQVDEVPLDDVPKVIENYHLCVVKMMKL  69

Query  459  NSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILG  638
            +S +I+RAK MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAEMAIYLILG
Sbjct  70   DSHIIARAKEMKLIMQFGVGLEGVDINAATKFGIKVARIPGDVTGNAASCAEMAIYLILG  129

Query  639  LLRKQHEMDIAIKQKMLGEPIGDTLLGKTV  728
            LLRKQ+EM IAIK++ LGEP+G+TL+GKT+
Sbjct  130  LLRKQNEMQIAIKERKLGEPVGETLVGKTL  159



>gb|EMT11768.1| Glyoxylate reductase [Aegilops tauschii]
Length=346

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G NG S +TRVLFCG  +PA+  YT+EY+++Y FIQVD++   ++P VI++Y ICVVKN
Sbjct  26   VGGNGYSDVTRVLFCGHYWPASTIYTKEYLQNYPFIQVDEVGLEHVPDVIQNYHICVVKN  85

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              ++SD+I++A +MK+IMQ+GVGLEGVDI AAT   IKVARIP   TGNA +CAEMAIYL
Sbjct  86   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEQKIKVARIPGSTTGNAIACAEMAIYL  145

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             LG+LRKQ EMD A+ QK LG P+G+T+ GKT+ I+G+G IG+ +AKRLRPF V
Sbjct  146  TLGVLRKQKEMDTAVIQKDLGLPVGETIFGKTILILGFGAIGMEIAKRLRPFGV  199



>gb|EMS56366.1| Glyoxylate reductase [Triticum urartu]
Length=346

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G NG S +TRVLFCG  +PA+  YT+EY+++Y FIQVD++   ++P VI++Y ICVVKN
Sbjct  26   VGGNGYSDVTRVLFCGHYWPASTIYTKEYLQNYPFIQVDEVGLEHVPDVIQNYHICVVKN  85

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              ++SD+I++A +MK+IMQ+GVGLEGVDI AAT   IKVARIP   TGNA +CAEMAIYL
Sbjct  86   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEQKIKVARIPGSTTGNAIACAEMAIYL  145

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             LG+LRKQ EMD A+ QK LG P+G+T+ GKT+ I+G+G IG+ +AKRLRPF V
Sbjct  146  TLGVLRKQKEMDTAVIQKDLGLPVGETIFGKTILILGFGAIGMEIAKRLRPFGV  199



>emb|CDY50445.1| BnaC06g24190D [Brassica napus]
Length=373

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 136/170 (80%), Gaps = 0/170 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            K     +TRVLFCGP+ P ++N+TR+Y++ Y FIQ D   F  +P VIK+Y ICV   + 
Sbjct  44   KEEDKKVTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQ  103

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            ++S +ISRA  MKLIMQFGVGL+GVDI AAT +GIKVARIPS  TGNA SC+EMAIYL+L
Sbjct  104  MDSFVISRASNMKLIMQFGVGLDGVDIDAATKNGIKVARIPSEGTGNAASCSEMAIYLML  163

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            GLL+KQ+EM ++++ ++LG+P G TLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  164  GLLKKQNEMQMSVQSRLLGQPTGGTLLGKTVFILGYGNIGIELAKRLKPF  213



>gb|EPS66269.1| hypothetical protein M569_08508, partial [Genlisea aurea]
Length=344

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 140/192 (73%), Gaps = 27/192 (14%)
 Frame = +3

Query  297  TRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLIS  476
            TRVLFCGPNFP +HNYT+EY++ +  I VD IPF  +P VI +YDICV K++ + S++I+
Sbjct  10   TRVLFCGPNFPGSHNYTQEYLQSHPSIVVDIIPFDAVPDVIGNYDICVSKDMKITSNIIA  69

Query  477  RA-KRMKLIMQFGVGLEG--------------------------VDITAATAHGIKVARI  575
            RA  R+KLIMQFGVG+EG                          +D+ AAT HGIKV RI
Sbjct  70   RAGNRLKLIMQFGVGIEGMISTSLSFFFFFRSHITQVLVFCHEGIDVGAATKHGIKVGRI  129

Query  576  PSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIG  755
            PS  TGNA+SCAEMAIYL++GLLRKQ+EM  ++K++ LG PIGDTLLGKTVFI+GYGNIG
Sbjct  130  PSDTTGNASSCAEMAIYLMMGLLRKQNEMQASLKKRSLGYPIGDTLLGKTVFILGYGNIG  189

Query  756  IHLAKRLRPFDV  791
             HLAKRLRPF V
Sbjct  190  KHLAKRLRPFGV  201



>dbj|BAK05235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G NG S +TRVLFCG  +PA+  YT+EY++ Y FIQVD++   ++P VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              ++SD+I++A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  124

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             LG+LRKQ EM+ A+ +K LG P+G+T+ GKT+ I+G+G IG+ +AKRLRPF V
Sbjct  125  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILILGFGAIGMEIAKRLRPFGV  178



>dbj|BAK03270.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G NG S +TRVLFCG  +PA+  YT+EY++ Y FIQVD++   ++P VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              ++SD+I++A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  124

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             LG+LRKQ EM+ A+ +K LG P+G+T+ GKT+ I+G+G IG+ +AKRLRPF V
Sbjct  125  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILILGFGAIGMEIAKRLRPFGV  178



>dbj|BAK02358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G NG S +TRVLFCG  +PA+  YT+EY++ Y FIQVD++   ++P VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              ++SD+I++A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  124

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             LG+LRKQ EM+ A+ +K LG P+G+T+ GKT+ I+G+G IG+ +AKRLRPF V
Sbjct  125  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILILGFGAIGMEIAKRLRPFGV  178



>ref|XP_009104868.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Brassica 
rapa]
Length=369

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            K     +TRVLFCGP+ P ++N+TR+Y++ Y FIQ D   F  +P VIK+Y ICV   + 
Sbjct  41   KEEDKKVTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQ  100

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            ++S +ISRA  MKLIMQFGVGL+GVDI AAT +GIKVARIPS   GNA SC+EMAIYL+L
Sbjct  101  MDSYVISRATNMKLIMQFGVGLDGVDIDAATKNGIKVARIPSEGNGNAASCSEMAIYLML  160

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            GLL+KQ+EM ++++ ++LG+P G TLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  161  GLLKKQNEMQMSVQSRLLGQPTGGTLLGKTVFILGYGNIGIELAKRLKPF  210



>dbj|BAK00574.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G NG S +TRVLFCG  +PA+  YT+EY++ Y FIQVD++   ++P VI++Y ICVVKN
Sbjct  47   VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  106

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
              ++SD+I++A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  107  KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  166

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             LG+LRKQ EM+ A+ +K LG P+G+T+ GKT+ I+G+G IG+ +AKRLRPF V
Sbjct  167  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILILGFGAIGMEIAKRLRPFGV  220



>ref|XP_009104867.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X1 [Brassica 
rapa]
Length=372

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            K     +TRVLFCGP+ P ++N+TR+Y++ Y FIQ D   F  +P VIK+Y ICV   + 
Sbjct  44   KEEDKKVTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQ  103

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            ++S +ISRA  MKLIMQFGVGL+GVDI AAT +GIKVARIPS   GNA SC+EMAIYL+L
Sbjct  104  MDSYVISRATNMKLIMQFGVGLDGVDIDAATKNGIKVARIPSEGNGNAASCSEMAIYLML  163

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            GLL+KQ+EM ++++ ++LG+P G TLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  164  GLLKKQNEMQMSVQSRLLGQPTGGTLLGKTVFILGYGNIGIELAKRLKPF  213



>ref|XP_006657609.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Oryza brachyantha]
Length=336

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            K+GS+  TRVLFCGP +PA+  YT+EY++++ FIQVD++    +P VI++Y +CVVKN  
Sbjct  7    KSGSADTTRVLFCGPYWPASTIYTKEYLQNHPFIQVDEVGLEEVPDVIQNYHLCVVKNRR  66

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            ++SD+I++A +MK+IMQ+GVG+EG+D+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  67   VDSDVIAKANQMKIIMQYGVGIEGIDVNAATKHKIKVARIPGSTTGNAISCAEMAIYLTL  126

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            G+LRKQ  MD A+K K LG P+GDT+ GK+V I+G+G IG+ +AKRLRPF V
Sbjct  127  GVLRKQKMMDTAVKCKDLGIPVGDTIFGKSVLILGFGAIGVEVAKRLRPFGV  178



>ref|XP_009379247.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
[Pyrus x bretschneideri]
Length=382

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 143/197 (73%), Gaps = 31/197 (16%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            ++R+LFCG + PAA  YTREY+KDY FIQVD +P   +P VI++Y +C+VK + L+SDL+
Sbjct  20   VSRLLFCGSHSPAAETYTREYLKDYPFIQVDGVPHKDVPGVIQNYSMCIVKLMKLDSDLL  79

Query  474  SRAKRMKLIMQFGVGLEGVDITAAT----------AH---------------------GI  560
             RA++MKL++Q+GVGLEGVDI +AT          +H                     GI
Sbjct  80   YRAEKMKLVLQYGVGLEGVDIDSATKFGIKVARIPSHVTGKQYGVGLEGVDIDSATKFGI  139

Query  561  KVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMG  740
            KVARIPS  TGNA SCAEMAIYL+LGLLRKQ+E+ I+IK + +G+P+G+TLLGKTVFI+G
Sbjct  140  KVARIPSHVTGNAASCAEMAIYLMLGLLRKQNEIQISIKLRKVGDPVGETLLGKTVFILG  199

Query  741  YGNIGIHLAKRLRPFDV  791
            YGNIGI LAKRLRPF V
Sbjct  200  YGNIGIELAKRLRPFGV  216



>gb|ERN20040.1| hypothetical protein AMTR_s00071p00183090 [Amborella trichopoda]
Length=373

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            K+GK   + IT++LFC  +FP+AH YTRE ++ Y FIQVDD+    +P VI DY IC+ +
Sbjct  30   KVGKMEGNAITKILFCSSHFPSAHEYTRECLQKYPFIQVDDVDIDDVPNVIGDYHICIPR  89

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
             + L+S++ISRAK+MKLIMQ+GVGLEGVDI AAT  GI+VARIPS  TGN+ SCAE AIY
Sbjct  90   MMRLDSEVISRAKQMKLIMQYGVGLEGVDIDAATMAGIRVARIPSNMTGNSFSCAEHAIY  149

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ EM+IA++++ LG P G+TL GKTVFI+GYGNIG+ LA RL+PF V
Sbjct  150  LVLGLLRKQKEMEIAVQERKLGWPAGETLFGKTVFILGYGNIGVDLAARLKPFGV  204



>ref|XP_011628648.1| PREDICTED: formate dehydrogenase, mitochondrial [Amborella trichopoda]
Length=380

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +3

Query  267  KMGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVK  446
            K+GK   + IT++LFC  +FP+AH YTRE ++ Y FIQVDD+    +P VI DY IC+ +
Sbjct  37   KVGKMEGNAITKILFCSSHFPSAHEYTRECLQKYPFIQVDDVDIDDVPNVIGDYHICIPR  96

Query  447  NLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIY  626
             + L+S++ISRAK+MKLIMQ+GVGLEGVDI AAT  GI+VARIPS  TGN+ SCAE AIY
Sbjct  97   MMRLDSEVISRAKQMKLIMQYGVGLEGVDIDAATMAGIRVARIPSNMTGNSFSCAEHAIY  156

Query  627  LILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            L+LGLLRKQ EM+IA++++ LG P G+TL GKTVFI+GYGNIG+ LA RL+PF V
Sbjct  157  LVLGLLRKQKEMEIAVQERKLGWPAGETLFGKTVFILGYGNIGVDLAARLKPFGV  211



>ref|XP_004963884.1| PREDICTED: formate dehydrogenase 1, mitochondrial-like [Setaria 
italica]
Length=548

 Score =   223 bits (567),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 136/173 (79%), Gaps = 0/173 (0%)
 Frame = +3

Query  273  GKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNL  452
            G NG S +TRVLFCGP +PA+  YTREY+++Y FIQVD++    +P VI++Y +C+V+N 
Sbjct  218  GSNGCSTVTRVLFCGPYWPASIVYTREYLQNYPFIQVDEVGLDQVPDVIQNYHLCIVRNR  277

Query  453  GLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLI  632
             ++SD+I+RA +MK+IMQ GVGLEGVDI AAT H IKVARIP   TGNA +CAEMAIYL 
Sbjct  278  RIDSDIIARATQMKIIMQNGVGLEGVDIGAATEHKIKVARIPGYTTGNAVACAEMAIYLT  337

Query  633  LGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            LG+LRKQ EMD A+ ++ LG P G+T+ G+T+FI+G+G IG  LAKRLR F V
Sbjct  338  LGVLRKQKEMDRAVNRRELGTPAGETIHGRTIFILGFGAIGYELAKRLRVFGV  390



>ref|XP_011628610.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Amborella 
trichopoda]
Length=326

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            IT++LFCG  FP+   +TRE ++ Y FIQVD++    +P VI DY IC+ +   L+S++I
Sbjct  6    ITKILFCGYVFPSGVQFTRENLQKYPFIQVDEVETDDVPNVIGDYHICIPRMQRLDSEVI  65

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRAK+MKLI+Q+GVGLEGVDI AAT  GI+V RIP   TGN+ SCAE AIYL+LGLLRKQ
Sbjct  66   SRAKQMKLILQYGVGLEGVDIDAATRAGIRVGRIPGHMTGNSYSCAEHAIYLVLGLLRKQ  125

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
              MDIA++++ LG P+G+TL GK VFI+GYGNIG+HLA RL+PF V
Sbjct  126  KLMDIAVQERKLGWPLGETLFGKAVFILGYGNIGVHLAARLKPFGV  171



>ref|XP_006858572.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X1 [Amborella 
trichopoda]
 ref|XP_011628609.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X1 [Amborella 
trichopoda]
 gb|ERN20039.1| hypothetical protein AMTR_s00071p00182560 [Amborella trichopoda]
Length=340

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 130/166 (78%), Gaps = 0/166 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            IT++LFCG  FP+   +TRE ++ Y FIQVD++    +P VI DY IC+ +   L+S++I
Sbjct  6    ITKILFCGYVFPSGVQFTRENLQKYPFIQVDEVETDDVPNVIGDYHICIPRMQRLDSEVI  65

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRAK+MKLI+Q+GVGLEGVDI AAT  GI+V RIP   TGN+ SCAE AIYL+LGLLRKQ
Sbjct  66   SRAKQMKLILQYGVGLEGVDIDAATRAGIRVGRIPGHMTGNSYSCAEHAIYLVLGLLRKQ  125

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
              MDIA++++ LG P+G+TL GK VFI+GYGNIG+HLA RL+PF V
Sbjct  126  KLMDIAVQERKLGWPLGETLFGKAVFILGYGNIGVHLAARLKPFGV  171



>gb|ABR18201.1| unknown [Picea sitchensis]
Length=355

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = +3

Query  297  TRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLIS  476
            TRVLFCG +FP +  YT++Y+  Y FIQVD IP   +P +I  Y+ICVV+ + L++++IS
Sbjct  14   TRVLFCGLSFPTSFEYTKQYLLPYPFIQVDAIPHDKVPDIIGGYEICVVRGMKLDANVIS  73

Query  477  RAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQH  656
             A++MKLI+QFGVGLEGVDI AAT  GIKVARIP   +GN+ SCAE AIYLILGLLR Q 
Sbjct  74   LARQMKLIVQFGVGLEGVDIEAATKFGIKVARIPGNTSGNSLSCAEHAIYLILGLLRDQK  133

Query  657  EMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             M+ A K++MLG P G+TL GKTV I+GYGNIG  LA RLRPF V
Sbjct  134  GMEKAFKERMLGVPAGETLYGKTVHIVGYGNIGKDLAVRLRPFGV  178



>gb|KGN44470.1| hypothetical protein Csa_7G302340 [Cucumis sativus]
Length=302

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +3

Query  378  QVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHG  557
            +VD IP   +P VI +Y ICVVK +  + DLISRA +MKLI+QFGVGL+GVD+ AAT  G
Sbjct  5    RVDIIPCEDVPKVISNYHICVVKMMKFDFDLISRASQMKLIVQFGVGLDGVDVDAATKRG  64

Query  558  IKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIM  737
            IKVARIPSG TGNA SCAEMAIYL+LGLLRKQ EM IA+  KMLG P GDTLLGKTVFIM
Sbjct  65   IKVARIPSGVTGNALSCAEMAIYLMLGLLRKQKEMQIAVDHKMLGVPTGDTLLGKTVFIM  124

Query  738  GYGNIGIHLAKRLRPFDV  791
            G+GNIG+ LAKRLRPF V
Sbjct  125  GFGNIGLELAKRLRPFGV  142



>ref|XP_011659111.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Cucumis sativus]
Length=315

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  381  VDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGI  560
            VD IP   +P VI +Y ICVVK +  + DLISRA +MKLI+QFGVGL+GVD+ AAT  GI
Sbjct  19   VDIIPCEDVPKVISNYHICVVKMMKFDFDLISRASQMKLIVQFGVGLDGVDVDAATKRGI  78

Query  561  KVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMG  740
            KVARIPSG TGNA SCAEMAIYL+LGLLRKQ EM IA+  KMLG P GDTLLGKTVFIMG
Sbjct  79   KVARIPSGVTGNALSCAEMAIYLMLGLLRKQKEMQIAVDHKMLGVPTGDTLLGKTVFIMG  138

Query  741  YGNIGIHLAKRLRPFDV  791
            +GNIG+ LAKRLRPF V
Sbjct  139  FGNIGLELAKRLRPFGV  155



>ref|XP_001766047.1| predicted protein [Physcomitrella patens]
 gb|EDQ69106.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            R+LFCG  FP A  +TRE++K Y+ + VD      +P  I DYDICV + + L++++I+R
Sbjct  10   RILFCGDEFPPAEFHTREHLKQYAHLYVDSWSREEVPGRIADYDICVPRMMRLDAEVIAR  69

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
            AKR++LI+QFGVGLEGVD+ AAT  GIKVARIPS  TGNA SCAE  IY++LGLLR Q +
Sbjct  70   AKRLQLIVQFGVGLEGVDVEAATKAGIKVARIPSANTGNAFSCAEHCIYMMLGLLRHQKD  129

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            M  +I  K LGEP G TL GKTVFI+GYG+IG  LA  LR F V
Sbjct  130  MWSSIAAKRLGEPAGSTLFGKTVFILGYGHIGHELAPLLRCFGV  173



>ref|XP_010683622.1| PREDICTED: formate dehydrogenase 2, mitochondrial isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=302

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 116/169 (69%), Gaps = 24/169 (14%)
 Frame = +3

Query  285  SSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNS  464
               +TRVLFCG  F A+++YT+EY+ +Y  IQVDD+    IP VI +Y +C+ +   L+S
Sbjct  5    EQQVTRVLFCGQQFSASYDYTKEYLSNYPHIQVDDVILSDIPNVIGNYHMCIPRMTRLDS  64

Query  465  DLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  644
            ++IS AK+MKLI+QFGVGLEGVD+ AAT HGIKVARIP+  TGNA SC EMAIYL+LGLL
Sbjct  65   EIISSAKQMKLIVQFGVGLEGVDVDAATKHGIKVARIPADGTGNAASCGEMAIYLMLGLL  124

Query  645  RKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            RKQ                        VFI+GYGNIG  LAKRLRPFDV
Sbjct  125  RKQ------------------------VFILGYGNIGRELAKRLRPFDV  149



>ref|XP_001767463.1| predicted protein [Physcomitrella patens]
 gb|EDQ67787.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 119/164 (73%), Gaps = 0/164 (0%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            R+LFCG  FPAA  YTR+ ++ Y  + +D  P   +   I DYDICV + + L++++I+R
Sbjct  14   RILFCGDEFPAAEFYTRKNLQQYPHLHLDSCPRTLVADRIGDYDICVPRMMRLDAEVIAR  73

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
            AK+++LI+QFGVGLEGVDI AAT  GIKVARIPS  TGNA +CAE  IY++LGLLR Q  
Sbjct  74   AKQLQLIVQFGVGLEGVDIEAATRAGIKVARIPSVNTGNALACAEHCIYMMLGLLRHQRV  133

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            M  +I  K LGEP G TL GKT+FI+GYG+IG  LA RLR F V
Sbjct  134  MASSIAAKRLGEPAGSTLYGKTIFILGYGHIGKELALRLRYFGV  177



>ref|XP_002459677.1| hypothetical protein SORBIDRAFT_02g008670 [Sorghum bicolor]
 gb|EER96198.1| hypothetical protein SORBIDRAFT_02g008670 [Sorghum bicolor]
Length=360

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 25/172 (15%)
 Frame = +3

Query  279  NGS-SHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLG  455
            NGS S +TRVLFCGP FPA+  YT EY++DY FI+VD++    +P VI +Y ICVVKN  
Sbjct  55   NGSNSKVTRVLFCGPYFPASTRYTTEYLQDYPFIEVDEVGLEQVPDVIHNYHICVVKNRR  114

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            ++SD+I++A +MK+IMQ+GVGLEGVD+  AT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  115  IDSDVIAKATQMKIIMQYGVGLEGVDVNTATEHKIKVARIPGSMTGNAVSCAEMAIYLTL  174

Query  636  GLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            G+LRKQ                        V I+G+G IG+ +AKRL+PF V
Sbjct  175  GVLRKQ------------------------VLILGFGAIGMEIAKRLKPFGV  202



>dbj|BAC22329.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAD31965.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica 
Group]
Length=316

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +3

Query  375  IQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAH  554
            I VD++    +P VI++Y +C+VKN  ++SD+I++A +MK+IMQ+GVG+EGVD+ AAT H
Sbjct  50   ILVDEVGLEEVPDVIQNYHLCIVKNRLIDSDIIAKASQMKVIMQYGVGIEGVDVNAATEH  109

Query  555  GIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFI  734
             IKVARI    TGNA SCAEMAIYL LG+LRKQ  MD A+K+K LG P+GDT+ GK V I
Sbjct  110  KIKVARINGSTTGNAVSCAEMAIYLTLGILRKQKMMDTAVKRKDLGSPVGDTIFGKRVLI  169

Query  735  MGYGNIGIHLAKRLRPFDV  791
            +G+G IG+ +AKR+RPF V
Sbjct  170  LGFGAIGVEIAKRIRPFGV  188



>emb|CAN70397.1| hypothetical protein VITISV_016521 [Vitis vinifera]
Length=274

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +3

Query  339  NYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVG  518
            +Y    V +Y  + VDD  F  +P VI DYD+C+VK++ L+S++ISRA +MKLIMQFGVG
Sbjct  111  SYLGHLVGNYQEV-VDDSSFEDVPDVIADYDMCIVKSMRLDSNIISRANKMKLIMQFGVG  169

Query  519  LEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEP  698
            LEGVDI AAT  GIKVARI SG TGNA SCAEMAIYL+LGLLRKQ EM I++KQK++GEP
Sbjct  170  LEGVDINAATKCGIKVARIASGETGNAASCAEMAIYLMLGLLRKQKEMQISLKQKIVGEP  229

Query  699  IGDTLLGKTV  728
            IGDTL GKTV
Sbjct  230  IGDTLFGKTV  239



>gb|AER41608.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glaberrima]
Length=333

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +3

Query  375  IQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAH  554
            I VD++    +P VI++Y +C+VKN  ++SD+I++A +MK+IMQ+GVG+EG+D+ AAT H
Sbjct  50   ILVDEVGLEEVPDVIQNYHLCIVKNRLIDSDIIAKASQMKVIMQYGVGIEGIDVNAATEH  109

Query  555  GIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFI  734
             IKVARI    TGNA SCAEMAIYL LG+LRKQ  MD A+K+K LG P+GDT+ GK V I
Sbjct  110  KIKVARINGSTTGNAVSCAEMAIYLTLGILRKQKMMDTAVKRKDLGSPVGDTIFGKRVLI  169

Query  735  MGYGNIGIHLAKRLRPFDV  791
            +G+G IG+ +AKR+RPF V
Sbjct  170  LGFGAIGVEIAKRIRPFGV  188



>gb|AER41626.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glumipatula]
Length=337

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +3

Query  375  IQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAH  554
            I VD++    +P VI++Y +C+VKN  ++SD+I++A +MK+IMQ+GVG+EGVD+ AAT H
Sbjct  57   ILVDEVGLEEVPDVIQNYHLCIVKNRLIDSDIIAKASQMKVIMQYGVGIEGVDVNAATEH  116

Query  555  GIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFI  734
             IKVARI    TGNA SCAEMAIYL LG+LRKQ  MD A+K+K LG P+GDT+ GK V +
Sbjct  117  KIKVARINGSTTGNAVSCAEMAIYLTLGILRKQKMMDTAVKRKDLGSPVGDTIFGKRVLV  176

Query  735  MGYGNIGIHLAKRLRPFDV  791
            +G+G IG+ +AKR+RPF V
Sbjct  177  LGFGAIGVEIAKRIRPFGV  195



>gb|KCW70958.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=269

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  489  MKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDI  668
            MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+LGLLRKQ+E+  
Sbjct  1    MKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLMLGLLRKQNEIQT  60

Query  669  AIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            ++ Q+ LGEP+G+TL GKTV IMGYGNIGI LAKRLRPF V
Sbjct  61   SVNQRKLGEPVGETLFGKTVLIMGYGNIGIDLAKRLRPFGV  101



>gb|AER41584.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza brachyantha]
Length=397

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 121/215 (56%), Gaps = 67/215 (31%)
 Frame = +3

Query  276  KNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQ-------------------------  380
            K+GS+  TRVLFCGP +PA+  YT+EY++++ FIQ                         
Sbjct  49   KSGSADTTRVLFCGPYWPASTIYTKEYLQNHPFIQFIDENMCFIYLSSNFVRAPSYSISG  108

Query  381  ------------------VDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQ  506
                              VD++    +P VI++Y +CVVKN  ++SD+I++A +MK+IMQ
Sbjct  109  ILSTILARSCYMEGNMYTVDEVGLEEVPDVIQNYHLCVVKNRRVDSDVIAKANQMKIIMQ  168

Query  507  FGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKM  686
            +GVG+EG+D+ AAT H IKVARIP   TGNA SCAEMAIYL LG+LRKQ           
Sbjct  169  YGVGIEGIDVNAATKHKIKVARIPGSTTGNAISCAEMAIYLTLGVLRKQ-----------  217

Query  687  LGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
                         V I+G+G IG+ +AKRLRPF V
Sbjct  218  -------------VLILGFGAIGVEVAKRLRPFGV  239



>ref|XP_010473742.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic-like 
[Camelina sativa]
Length=171

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  501  MQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQ  680
            +  GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIYL+LGLL+KQ+EM ++++ 
Sbjct  35   IHXGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQNEMQVSLRS  94

Query  681  KMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            ++LGEP GDTLLGKTVFI+GYGNIGI LAKRL+PF
Sbjct  95   RLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPF  129



>gb|KDO56044.1| hypothetical protein CISIN_1g044056mg, partial [Citrus sinensis]
Length=189

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 111/174 (64%), Gaps = 14/174 (8%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            M ++    IT VLF GP+FPA+HNY + Y+++Y  I+     F+ + ++   Y     + 
Sbjct  8    MARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIK-GLCFFLSMHSLYASYGTSE-QM  65

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYL  629
            +  +S++I+RA  M LI++F VGLEGVDI A T   IK ARI    +GNA SCAE++IYL
Sbjct  66   IASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCAELSIYL  125

Query  630  ILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +LGLLRK               P G+TLLGKTVFI G+GNIG+ LAKRLRPF V
Sbjct  126  MLGLLRKHI------------VPTGETLLGKTVFISGFGNIGVELAKRLRPFGV  167



>ref|XP_005646982.1| hypothetical protein COCSUDRAFT_37061 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22438.1| hypothetical protein COCSUDRAFT_37061 [Coccomyxa subellipsoidea 
C-169]
Length=345

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            + RVLFCG  F   + +T+E ++D + I+V   P   +   I   D+ V     L+S ++
Sbjct  8    VFRVLFCGQEFNWGYKFTKEALQDDAEIEVSCCPREEVGQHIGSTDLAVPLMARLDSYML  67

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            SRA R+K I+Q+GVG+EG+DI AAT  GI V+ IPS  TGNA SCAEMAIYL L  LR  
Sbjct  68   SRAPRLKAILQYGVGVEGIDIPAATERGIWVSNIPSEGTGNALSCAEMAIYLTLACLRSS  127

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            H    +I ++ +G P+G TL G  V I+G+G I   L  RLRPF
Sbjct  128  HACAESIAERRVGVPLGRTLFGTNVLIVGFGGIAKELLPRLRPF  171



>gb|KCW70959.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=270

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +3

Query  489  MKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDI  668
            M+   Q+    EGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+LGLLRKQ+E+  
Sbjct  1    MEFTTQYLHLHEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLMLGLLRKQNEIQT  60

Query  669  AIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            ++ Q+ LGEP+G+TL GKTV IMGYGNIGI LAKRLRPF V
Sbjct  61   SVNQRKLGEPVGETLFGKTVLIMGYGNIGIDLAKRLRPFGV  101



>ref|XP_003063700.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52073.1| predicted protein [Micromonas pusilla CCMP1545]
Length=390

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 101/165 (61%), Gaps = 1/165 (1%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            R+LFCG  FP A   T   +     ++V       +   I+  DI V     L++D+I+R
Sbjct  20   RILFCGEEFPDAARCTASSLSTDPGVEVVVCKREDVATEIERADIAVPLMTRLDADIIAR  79

Query  480  -AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQH  656
             AKR++L++QFGVGLEGVD  A    G+ VARIP+  TGNATS AEMA+YL+L  LR+ +
Sbjct  80   GAKRLRLVLQFGVGLEGVDERACAERGVLVARIPADRTGNATSTAEMAVYLVLAALRRVN  139

Query  657  EMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             M  ++K + LG P+G  L G  V I+G+GNI   +A R+ PF V
Sbjct  140  AMADSLKARTLGTPMGTQLKGLNVLIVGWGNIAREVAVRIAPFGV  184



>ref|XP_002505587.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66845.1| predicted protein [Micromonas sp. RCC299]
Length=388

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 105/167 (63%), Gaps = 5/167 (3%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFV-----YIPAVIKDYDICVVKNLGLNS  464
            +VLFCG  FPA    TR+ ++ +  +   +  FV      +   I D D+ V     ++ 
Sbjct  23   KVLFCGKEFPAGAEETRKALEKHDAVGNCEFRFVACAREQVATEIVDADVAVPLMTKIDE  82

Query  465  DLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  644
             L+++A  +KL++QFGVGLEGVD  A T  GI +ARIPS  TGNA S AEMA++L+L  L
Sbjct  83   TLLAKAPILKLVLQFGVGLEGVDEEACTKRGILLARIPSEKTGNADSTAEMAVFLLLAGL  142

Query  645  RKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            R+ +++  ++  + LGEP+   L GKTV I+G+G+IG  +A+RLR F
Sbjct  143  RRVNQLAKSLTDRRLGEPVTVQLKGKTVTIVGWGHIGKEVARRLRAF  189



>ref|XP_005849953.1| hypothetical protein CHLNCDRAFT_143308 [Chlorella variabilis]
 gb|EFN57851.1| hypothetical protein CHLNCDRAFT_143308 [Chlorella variabilis]
Length=330

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 98/151 (65%), Gaps = 0/151 (0%)
 Frame = +3

Query  339  NYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVG  518
             +T+E ++    ++V       +   +   D+ V     L++ L+  A+R+KLI+Q+GVG
Sbjct  6    QFTKEALQHEPGVEVVQCDRSQLAHELMGADVAVPLMARLDAQLLRSARRLKLIIQYGVG  65

Query  519  LEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEP  698
            +EG+D+ +AT  GI V+ IPS  TGNA SCAE AIYL+L  LR  + M  +I+++ LG P
Sbjct  66   VEGIDMPSATELGIWVSNIPSAGTGNAASCAEHAIYLMLATLRYHNAMADSIRERRLGVP  125

Query  699  IGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +G TLLGKTV ++G+GNI   LA RL+PF V
Sbjct  126  LGQTLLGKTVLLVGFGNIAKELAVRLKPFGV  156



>ref|XP_007015903.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 5 [Theobroma cacao]
 gb|EOY33522.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 5 [Theobroma cacao]
Length=261

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +3

Query  570  RIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGN  749
            RIPS ATGNA SCAEMAIYL+LGLLRKQ+EM I++KQK LGEP+G+TLLG+TVFIMG+GN
Sbjct  20   RIPSDATGNAASCAEMAIYLMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIMGFGN  79

Query  750  IGIHLAKRLRPFDV  791
            IGI LAKRL+PF V
Sbjct  80   IGIDLAKRLKPFGV  93



>ref|XP_001422519.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00836.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=332

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 96/166 (58%), Gaps = 3/166 (2%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVD-DIPFVYIPAVIKDYDICVVKNLGLNSDL--  470
            RVLFCG  F   + +TR YV D              +   I   D+ V     L+++L  
Sbjct  5    RVLFCGLEFEDGYAHTRAYVDDNDLDVDVARCAREDVAREISRCDVAVPLMTKLDAELLK  64

Query  471  ISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  650
            I  A  +  ++QFGVGLEGVDI  ATA G+ VARIPS  TGNATS AE+A+YL+L  LR+
Sbjct  65   IGAAGALTHVLQFGVGLEGVDIECATALGVTVARIPSEKTGNATSTAELAVYLVLAALRR  124

Query  651  QHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFD  788
               M  +++ + LG P G+ L    V I+G+G IG+ +A RLR F+
Sbjct  125  HDAMSASVRSRKLGAPTGNALSECEVMILGWGAIGVKIAARLRGFE  170



>ref|XP_003082919.1| oxidoreductase family protein (ISS) [Ostreococcus tauri]
 emb|CAL56874.1| D-isomer specific 2-hydroxyacid dehydrogenase,NAD-binding [Ostreococcus 
tauri]
Length=333

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 99/167 (59%), Gaps = 5/167 (3%)
 Frame = +3

Query  300  RVLFCGP-NFPAAHNYTREYV----KDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNS  464
            RVLFC   +FPA    T   +    ++Y  +   D   V+      D  + ++  L    
Sbjct  5    RVLFCCEHSFPAGFACTLAALTSSEREYVDVVRVDRDDVHREIAACDVAVPLMTRLDAQM  64

Query  465  DLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  644
              I  A R++L++QFGVGLEGVDI AATA G++VARIPS  TGNA+S AEMA++L+L  L
Sbjct  65   LKIGAAGRLRLVVQFGVGLEGVDIRAATACGVRVARIPSERTGNASSTAEMAVFLLLAAL  124

Query  645  RKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            R+ +EM  +I    LG P G +L    V I+G G IG+ +A+RLR F
Sbjct  125  RETNEMRASIAGSRLGNPCGRSLEDCEVMIVGMGAIGVKIAERLRGF  171



>gb|KDD72690.1| hypothetical protein H632_c3019p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=330

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = +3

Query  417  IKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGN  596
            IK+ D+ +     L    ++ A R+KLI+QFGVGLE VDI+AAT  G+ V+ +PS  TGN
Sbjct  13   IKNADVAIPLMTHLGRRELAEASRLKLILQFGVGLERVDISAATERGVWVSNVPSQFTGN  72

Query  597  ATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            A SCAE A+YL L  LR    M+ A++Q  +G+P G TL G+T  ++G+G I   L  RL
Sbjct  73   ARSCAEHAMYLALACLRDGRAMEDAVRQGRVGQPAGRTLFGRTALVLGFGGIAQELIPRL  132

Query  777  RPF  785
              F
Sbjct  133  HAF  135



>ref|XP_007509693.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18808.1| predicted protein [Bathycoccus prasinos]
Length=392

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 22/184 (12%)
 Frame = +3

Query  294  ITRVLFCGPNFPAAHNYTREYVK----------DYSFIQVDDIPFVYIPAVIKDYDICVV  443
            I RVLFCG  F      T+ Y +          D   ++V + P   +  +I++YD+ V 
Sbjct  23   IVRVLFCGEEFIGGFEATKRYTEASSSSSSSSSDGVTVKVQNCPRERVKDMIQEYDVLVP  82

Query  444  KNLGLNSDLISRA------------KRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGA  587
                 +  +I+ A             + KLI+QFGVGLEGV I  AT  GIKV RI S +
Sbjct  83   LMTRFDETVINSAAGNGSGDRGKKLSKCKLILQFGVGLEGVAIDLATKAGIKVGRIRSDS  142

Query  588  TGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLA  767
              NATS AEM ++L L  L+K +E  I+++ K+LG P+G++L G TV  +G+G +    A
Sbjct  143  NPNATSTAEMGVFLTLAALKKVNECQISVENKVLGSPMGESLFGATVLFVGWGRVAKAQA  202

Query  768  KRLR  779
            K  +
Sbjct  203  KMFK  206



>ref|XP_002179420.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49243.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=387

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 98/167 (59%), Gaps = 10/167 (6%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDY------DICVVKNLGLN  461
            RV++ GP+F A  +YT+  V++    Q   +  V+ P   + +      D+ V       
Sbjct  58   RVVYAGPHFQAGLSYTQALVRERGLEQC--VELVHAPTDAQLWELAPTVDVAVPFMQSFR  115

Query  462  SDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGL  641
            +D I RA RM+LIMQ+GVGLEGVD+ +AT HGI V+ IP+  TGNA + AE AI+L L L
Sbjct  116  ADFIERASRMRLIMQYGVGLEGVDVDSATKHGIAVSNIPAAGTGNAEATAEHAIFLSLSL  175

Query  642  LRKQ-HEMDIAIKQKMLGE-PIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            LR+   ++    + ++LG  PI  +L  K V ++GYG +G  + + L
Sbjct  176  LRRAFQDLPQRFQGRILGGLPIPKSLFQKNVTVVGYGAVGSKICEYL  222



>ref|XP_011399491.1| D-3-phosphoglycerate dehydrogenase [Auxenochlorella protothecoides]
 gb|KFM26553.1| D-3-phosphoglycerate dehydrogenase [Auxenochlorella protothecoides]
Length=338

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 79/125 (63%), Gaps = 0/125 (0%)
 Frame = +3

Query  411  AVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGAT  590
            A ++  D+ V   + + + ++  A R+KLI+QFGVG++ +DI AAT  GI VA IPS  T
Sbjct  31   AALQHVDVVVPIAVPITAGMLGAAPRLKLIIQFGVGVDAIDIPAATRLGITVANIPSLGT  90

Query  591  GNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAK  770
            GNA S AE AI+L L  LR    M  A++ + LG P G TL G TV ++GYGNI   L  
Sbjct  91   GNALSVAEHAIFLALASLRHHGAMRRALEAQRLGVPEGLTLWGSTVLVVGYGNIAQELVT  150

Query  771  RLRPF  785
            RL+PF
Sbjct  151  RLQPF  155



>ref|XP_008461935.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X3 [Cucumis 
melo]
Length=279

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +3

Query  603  SCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRP  782
            SCAEMAIYL+LGLLRKQ EM IA+  K LGEP GDTLLGKTVFI+G+GNIG+ LAKRLRP
Sbjct  2    SCAEMAIYLMLGLLRKQKEMQIAVDHKKLGEPTGDTLLGKTVFILGFGNIGLELAKRLRP  61

Query  783  FDV  791
            F V
Sbjct  62   FGV  64



>ref|WP_024966984.1| lactate dehydrogenase [Pantoea sp. IMH]
Length=315

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 84/148 (57%), Gaps = 4/148 (3%)
 Frame = +3

Query  348  REYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEG  527
            R+ + D  FI        +    +  YD  +     +   L+  A R+KLI Q G GLE 
Sbjct  20   RQTLPDVEFIASAG----HAAESLAGYDALIPGMAQIGDKLLQTADRLKLIQQAGAGLES  75

Query  528  VDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGD  707
            VDI +A A GI+VA +PS  +GNA S AE+ I++++GL R+  E+   I  + LG P+G 
Sbjct  76   VDINSAKALGIQVANVPSDCSGNADSVAELGIWMMIGLARRARELPDMIATRQLGLPVGL  135

Query  708  TLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             L GKTV ++G G IG  LAKRL PF V
Sbjct  136  GLSGKTVGLVGMGGIGKALAKRLSPFGV  163



>dbj|BAJ91330.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  270  MGKNGSSHITRVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKN  449
            +G NG S +TRVLFCG  +PA+  YT+EY++ Y FIQVD++   ++P VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  450  LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGI  560
              ++SD+I++A +MK+IMQ+GVGLE  +     + G+
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLEEGNECCCHSEGL  101



>ref|XP_005828939.1| hypothetical protein GUITHDRAFT_46401, partial [Guillardia theta 
CCMP2712]
 gb|EKX41959.1| hypothetical protein GUITHDRAFT_46401, partial [Guillardia theta 
CCMP2712]
Length=269

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 91/160 (57%), Gaps = 3/160 (2%)
 Frame = +3

Query  303  VLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRA  482
            +LFCG +FP + + TR     ++ +  D        A     D+ V     +++ L++ A
Sbjct  4    ILFCGRDFPLSLHATRSRRPTWNLLASDRAGLEEEMAS-HAVDVVVPLMTRIDASLVATA  62

Query  483  KR--MKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQH  656
             R  +KLI QFG GLEGVD  AA  HG+ V  IP+G + NA S AE AIYL++ ++R   
Sbjct  63   SRSGVKLIHQFGAGLEGVDKDAAERHGVAVRNIPAGESANAISSAEHAIYLLMSIMRNPR  122

Query  657  EMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
             M  ++++++LG P G T+  K   ++G+G +G  + +RL
Sbjct  123  AMRASLEERLLGLPAGTTIHSKRALVVGFGGLGQEITRRL  162



>ref|WP_025420783.1| lactate dehydrogenase [Sodalis sp. HS1]
 gb|AHF75653.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding, inverted 
[Sodalis sp. HS1]
Length=314

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 94/164 (57%), Gaps = 6/164 (4%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTR--EYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            RVLF  P       Y R  + + +  F+   D    +    + ++D  +     +++ L+
Sbjct  2    RVLFAAPEDAWGGIYARFCQALPEMEFVAASD----FRTLSLANFDAIIPTMTPVDAALL  57

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
              A R+KLI Q G GLEGVDI AA A GI VA +PS ++GNA S AE+AIYL+LGL R  
Sbjct  58   QSADRLKLIQQVGAGLEGVDIAAARARGISVANVPSASSGNADSVAELAIYLMLGLARNA  117

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             ++   +  + LG PIG  L+GKTV ++G G IG  LA+RL  F
Sbjct  118  ADIPRQLHLRQLGRPIGQGLMGKTVGLVGLGGIGKALARRLAAF  161



>ref|WP_012107589.1| D-isomer specific 2-hydroxyacid dehydrogenase [Methanoregula 
boonei]
 ref|YP_001405177.1| D-isomer specific 2-hydroxyacid dehydrogenase [Methanoregula 
boonei 6A8]
 gb|ABS56534.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Methanoregula 
boonei 6A8]
Length=325

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            ++LFCG  FP A       + D   +     P   I + I D DI VV  +    + + +
Sbjct  2    KILFCGEGFPEARKQLAALLPDDEILA---FPPDQIGSHIADADI-VVPTVNRVDEALMK  57

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
                  I QFGVGLEGVDI AAT +GI+VARIPS  +GNA S AE AI  +L L R  + 
Sbjct  58   KGHFAFIQQFGVGLEGVDIEAATRNGIRVARIPSEESGNAASVAEHAILFMLMLSRNWNR  117

Query  660  MDIAIKQKM---LGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +  A ++      G P G  L GKTV I+G G IG  LA+RL  F V
Sbjct  118  LARAREENKPLPWGSPEGVALRGKTVCIVGLGGIGRELARRLAGFQV  164



>ref|WP_021184805.1| D-3-phosphoglycerate dehydrogenase [Pantoea sp. AS-PWVM4]
 gb|ERK12456.1| D-3-phosphoglycerate dehydrogenase [Pantoea sp. AS-PWVM4]
Length=315

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = +3

Query  387  DIPFV----YIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAH  554
            D+ FV    +    +  +D  V     +++ L++ A R+KLI Q GVGLEGVDI AA   
Sbjct  25   DVEFVASAGHAAESLAGFDALVPGMCRVDARLLATADRLKLIQQAGVGLEGVDIAAAKKA  84

Query  555  GIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFI  734
            GI VA +PS  +GNA S AE+ I++++GL R+Q E+   + Q++LG+PIG  L+GKTV +
Sbjct  85   GIMVANVPSDHSGNADSVAELGIWMMIGLARRQQEIAQCLAQQLLGQPIGMGLMGKTVGL  144

Query  735  MGYGNIGIHLAKRLRPF  785
            +G G IG  LAKRL PF
Sbjct  145  VGLGGIGKALAKRLAPF  161



>ref|WP_039329515.1| lactate dehydrogenase [Pantoea rodasii]
 gb|KHJ68881.1| lactate dehydrogenase [Pantoea rodasii]
Length=315

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D  +     +++ LI+ A R+KLI Q GVGLEGVD+ AA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCRVDARLIATADRLKLIQQAGVGLEGVDLAAAKQAGIMVANVPSDNSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL R+QHE+   + Q+ LG+PIG  L+GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARRQHEIADCLAQQRLGQPIGLGLMGKTVGLVGLGGIGKALAKRLAPF  161



>ref|WP_045815940.1| lactate dehydrogenase [Pantoea sp. SM3]
 gb|KJV29023.1| lactate dehydrogenase [Pantoea sp. SM3]
Length=315

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D  +     +++ LI+ A R+KL+ Q GVGLEGVD+ AA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCWVDARLIATADRLKLVQQAGVGLEGVDLEAAKKAGIMVANVPSDHSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL R+QHE+   + Q+ LG+PIG  L+GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARRQHEIADCLAQQRLGQPIGLGLMGKTVGLVGLGGIGKALAKRLAPF  161



>ref|WP_034826230.1| lactate dehydrogenase [Enterobacter cancerogenus]
 gb|KGT89651.1| lactate dehydrogenase [Enterobacter cancerogenus]
Length=315

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D  +     +++ LI+ A R+KL+ Q GVGLEGVD+ AA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCRVDARLIATADRLKLVQQAGVGLEGVDLEAAKKAGIMVANVPSDHSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL R+QHE+   + Q+ LG+PIG  L+GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARRQHEIADCLAQQRLGQPIGLGLMGKTVGLVGLGGIGKALAKRLAPF  161



>ref|WP_028671049.1| lactate dehydrogenase [Saccharospirillum impatiens]
Length=314

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +3

Query  408  PAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGA  587
            P  +  Y++ +     +++ L+  A R++LI Q G GLEGVD+ AA   GI VA +P+  
Sbjct  35   PGSLAGYEVVIPTMSRIDARLLQTADRLQLIQQIGAGLEGVDLDAAKQQGIAVANVPTDV  94

Query  588  TGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLA  767
            +GNA S AEM IY +L L+R+  E      +  LG P+G +L+G TV I+G+G IG  ++
Sbjct  95   SGNADSVAEMVIYFMLALMRRTAEHTEQRHRMQLGVPVGRSLMGATVGIVGFGAIGKAVS  154

Query  768  KRLRPFDV  791
            +RL  F V
Sbjct  155  RRLSGFGV  162



>ref|WP_041287365.1| hypothetical protein, partial [Desulfomonile tiedjei]
Length=300

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 92/172 (53%), Gaps = 30/172 (17%)
 Frame = +3

Query  300  RVLFCGPNFPAAH-------------NYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICV  440
            ++LFCG  FP A              N   E+VK+   + VD    V IP + +      
Sbjct  2    KILFCGTTFPRAPELLALLLPEDQIVNCHSEHVKELG-LGVD----VIIPLMHR------  50

Query  441  VKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMA  620
                 L  +LI R    +LI Q+GVGLEGVDI AATA GI V  +P   T NA S AE A
Sbjct  51   -----LEPELIERTS-ARLIHQWGVGLEGVDIPAATARGILVCNVPGDVTVNADSTAEHA  104

Query  621  IYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            + L+LGL R+ HE   A ++ + G P+GD L+G+T  I+G G +G  LA RL
Sbjct  105  LLLMLGLSRRIHECFEAFQKGLWGAPVGDILMGRTALIVGLGRVGKALASRL  156



>gb|AFM26624.1| phosphoglycerate dehydrogenase-like oxidoreductase [Desulfomonile 
tiedjei DSM 6799]
Length=331

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 92/172 (53%), Gaps = 30/172 (17%)
 Frame = +3

Query  300  RVLFCGPNFPAAH-------------NYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICV  440
            ++LFCG  FP A              N   E+VK+   + VD    V IP + +      
Sbjct  2    KILFCGTTFPRAPELLALLLPEDQIVNCHSEHVKELG-LGVD----VIIPLMHR------  50

Query  441  VKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMA  620
                 L  +LI R    +LI Q+GVGLEGVDI AATA GI V  +P   T NA S AE A
Sbjct  51   -----LEPELIERTS-ARLIHQWGVGLEGVDIPAATARGILVCNVPGDVTVNADSTAEHA  104

Query  621  IYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            + L+LGL R+ HE   A ++ + G P+GD L+G+T  I+G G +G  LA RL
Sbjct  105  LLLMLGLSRRIHECFEAFQKGLWGAPVGDILMGRTALIVGLGRVGKALASRL  156



>ref|WP_013507782.1| lactate dehydrogenase [Pantoea sp. At-9b]
 gb|ADU67914.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Pantoea sp. At-9b]
Length=315

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D  V     +++ L++ A R+KLI Q GVGLEGVDI AA   GI VA +PS  +GNA S
Sbjct  42   FDALVPGMCRVDAPLLATADRLKLIQQVGVGLEGVDIAAAKKAGIMVANVPSDHSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL R+  E+   + Q+ LG+PIG  L+GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARRHQEIAPCLAQQQLGQPIGMGLMGKTVGLVGLGGIGKALAKRLAPF  161



>ref|WP_035265554.1| lactate dehydrogenase [Desulfosarcina sp. BuS5]
Length=320

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = +3

Query  417  IKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGN  596
            +K YD+ +     +   +I+ + R++LI Q G GLEGVD+ AA  + I VA +P+  +GN
Sbjct  39   LKGYDVLIPTMCSVTEQMITASDRLRLIQQCGSGLEGVDVEAAIKNNIWVANVPTANSGN  98

Query  597  ATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            A S AE+ IY+++GL R    M  ++    +GEP G +L GKT  ++G G IG  L KRL
Sbjct  99   ADSVAEIGIYMMIGLSRNFKNMAQSMLAGKMGEPRGKSLCGKTAGLVGLGGIGQALIKRL  158

Query  777  RPFDV  791
            + FDV
Sbjct  159  KAFDV  163



>gb|EWM13769.1| D-3-phosphoglycerate dehydrogenase [Kutzneria sp. 744]
Length=194

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = +3

Query  429  DICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSC  608
            D+       ++++L+SRA     + QFGVGLE VD+ AATA G+ VAR+P   TGNA + 
Sbjct  40   DVVTPIAATVDANLLSRAT-FGFVQQFGVGLETVDMDAATAAGVWVARLPGDVTGNADAV  98

Query  609  AEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            AE AI L L L R+  E   A++++   +P G +L G TV I+G G IG+ +AKRL P+
Sbjct  99   AEQAILLTLALSRQLDEARQALRERKWAQPAGRSLSGGTVAIIGLGAIGLAVAKRLAPW  157



>ref|XP_008189273.1| PREDICTED: D-3-phosphoglycerate dehydrogenase-like [Acyrthosiphon 
pisum]
Length=326

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = +3

Query  387  DIPFV----YIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAH  554
            D+ FV    +    +  +D  +     +++ L++ A R++LI Q GVGLEG+D+ AA  H
Sbjct  36   DVEFVASAGHAAESLAGFDALIPGMCRVDARLLATADRLRLIQQAGVGLEGIDLRAAKQH  95

Query  555  GIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFI  734
            GI VA +PS  +GNA S AE+ I++++GL R+Q+E+   + Q+ LG+PIG  L GKTV +
Sbjct  96   GIMVANVPSDDSGNADSVAELGIWMMIGLARRQNEIADCLAQQKLGQPIGMGLKGKTVGL  155

Query  735  MGYGNIGIHLAKRLRPF  785
            +G G IG  LAKRL PF
Sbjct  156  VGLGGIGKALAKRLAPF  172



>ref|WP_029912678.1| lactate dehydrogenase [Pelobacter seleniigenes]
Length=316

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 96/166 (58%), Gaps = 6/166 (4%)
 Frame = +3

Query  300  RVLFCGPN--FPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
            +VLF  P   +    N  R    D  F    D    Y    +  Y++ +     +++ L+
Sbjct  2    KVLFAAPEQAWGGILNKFRAAHPDLHFTATGD----YYIDSLAGYEVLIPTMCRVDAALL  57

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            + A R++LI Q G GLEGVDI AA A GI VA +PSGA+GNA S AE+ IYL+LGLLRK 
Sbjct  58   ASADRLQLIQQMGTGLEGVDIAAARARGIMVANVPSGASGNADSVAELGIYLLLGLLRKA  117

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             E+   ++   LG P+G TL GK + ++G G++G  L ++L  FDV
Sbjct  118  WEIPAVLQAGRLGRPMGGTLQGKNIGLVGLGDLGQALLRKLAGFDV  163



>ref|WP_043730098.1| hypothetical protein, partial [Kutzneria sp. 744]
Length=104

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  498  IMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIK  677
            + QFGVGLE VD+ AATA G+ VAR+P   TGNA + AE AI L L L R+  E   A++
Sbjct  1    VQQFGVGLETVDMDAATAAGVWVARLPGDVTGNADAVAEQAILLTLALSRQLDEARQALR  60

Query  678  QKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            ++   +P G +L G TV I+G G IG+ +AKRL P+
Sbjct  61   ERKWAQPAGRSLSGGTVAIIGLGAIGLAVAKRLAPW  96



>ref|WP_045832844.1| lactate dehydrogenase [Pantoea sp. BL1]
 gb|KJV48421.1| lactate dehydrogenase [Pantoea sp. BL1]
Length=315

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D  +     +++ LI+ + R+KL+ Q GVGLEGVD+ AA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCRVDARLIATSDRLKLVQQAGVGLEGVDLEAAKKAGIMVANVPSDHSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL R+QHE+   +  + LG+PIG  L+GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARRQHEIANCLAHQRLGQPIGLGLMGKTVGLVGLGGIGKALAKRLAPF  161



>ref|WP_013200656.1| lactate dehydrogenase [Erwinia billingiae]
 emb|CAX58151.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Erwinia 
billingiae Eb661]
Length=315

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            YD  +     +  DL+  A R+KLI Q G GLEGVD+ +A A GI+VA +PS  +GNA S
Sbjct  42   YDALIPGMAKVTPDLLKTADRLKLIQQAGAGLEGVDLASAKALGIQVANVPSDRSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL RK  E+   I  + LG P+G  L+GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARKAREIPEMIATRQLGLPVGMGLMGKTVGLVGLGGIGKALAKRLAPF  161

Query  786  DV  791
             V
Sbjct  162  GV  163



>ref|WP_015906531.1| lactate dehydrogenase [Desulfobacterium autotrophicum]
 gb|ACN17821.1| SerA2 [Desulfobacterium autotrophicum HRM2]
Length=315

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +3

Query  417  IKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGN  596
            +K  D+ +     +  +++    R++LI Q G GLEGVDI AAT  G+ VA +P+G +GN
Sbjct  39   LKGVDVLIPAMTWITREMMETGDRLRLIQQCGSGLEGVDIKAATDQGVSVANVPAGTSGN  98

Query  597  ATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            A S AE+ IY+++GL R    M  +++ K +GEP+G  L GKTV I+G G IG  L +RL
Sbjct  99   ADSVAELGIYMMIGLSRNIQGMAQSLRNKKMGEPLGMALPGKTVGIIGLGGIGQALVQRL  158

Query  777  RPFDV  791
            +PF V
Sbjct  159  KPFGV  163



>ref|WP_020880970.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Desulfovibrio sp. X2]
 gb|EPR41690.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Desulfovibrio sp. X2]
Length=322

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 89/166 (54%), Gaps = 10/166 (6%)
 Frame = +3

Query  303  VLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIK---DYDICVVKNLGLNSDLI  473
            +LFC  +FPAAH       +    +  D I F     V +   + D+ V     ++ ++I
Sbjct  3    ILFCSKSFPAAHE------RIPGLLPEDRIEFCGPEDVARLAPEADVLVPLITPISEEII  56

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
            + + R  LI QFGVGLE VD+ AAT HG+ VAR+PS  +GNA S AE A+ L++ L R  
Sbjct  57   A-SGRFGLIHQFGVGLEVVDMEAATRHGVMVARVPSAESGNAGSVAEHALMLMIMLSRNL  115

Query  654  HEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
                        G P G  L+G+T  ++G G +G  LAKRL  F++
Sbjct  116  GAAARNFASGRFGAPTGQALIGRTACVVGLGGLGRELAKRLSAFEM  161



>ref|WP_034897846.1| lactate dehydrogenase [Erwinia typographi]
 gb|KGT88455.1| lactate dehydrogenase [Erwinia typographi]
Length=315

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D  +     + ++L+  A R+KLI Q G GLEGVD+ +A AHG++VA +PS  +GNA S
Sbjct  42   FDALIPGMAKVTAELLKTADRLKLIQQAGAGLEGVDLASAKAHGVQVANVPSDRSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL R+  ++   +  + LG P+G  L+GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARRARDIPEMMATRQLGLPVGMGLMGKTVGLVGLGGIGKALAKRLAPF  161

Query  786  DV  791
             V
Sbjct  162  GV  163



>ref|WP_015878860.1| lactate dehydrogenase [Tolumonas auensis]
 gb|ACQ93389.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Tolumonas 
auensis DSM 9187]
Length=315

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 89/151 (59%), Gaps = 4/151 (3%)
 Frame = +3

Query  339  NYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVG  518
            N  R+ + D +F+        Y    ++ +D+ +     +++ L++ A ++KLI Q G G
Sbjct  17   NKFRQALPDVAFVAAGG----YGTQSLQGFDVLIPTMTKIDARLLATADQLKLIQQIGAG  72

Query  519  LEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEP  698
            LEGVD+ AA  H I VA +P+  +GNA S AE+ IY++L L R  HE+    +Q+  G P
Sbjct  73   LEGVDLEAAKQHQIAVANVPTDISGNADSVAELGIYMMLALARNAHEIPHHFRQRESGRP  132

Query  699  IGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +G  L GKTV ++G G IG  LAKRL  FD+
Sbjct  133  MGLGLKGKTVGLIGLGGIGKVLAKRLTAFDM  163



>ref|WP_020711063.1| hypothetical protein [Acidobacteriaceae bacterium KBS 83]
Length=316

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 93/164 (57%), Gaps = 2/164 (1%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            R+LFCG  FP A  Y RE++   +  ++   P   I   +   D+ + K   + ++ I +
Sbjct  2    RILFCGNTFPDAPEYLREHLDPGANDEIIVCPDADIVPHLAGVDVIIPKMQRIGAEAI-Q  60

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
            A   +L+ Q+G GLEGVDI AA   G+ VA +P+   GNA S AE A+ L L LLR   +
Sbjct  61   AGTFRLVQQWGAGLEGVDIDAARRKGVFVANVPA-TGGNAESVAEHAMLLTLALLRDLPK  119

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
                ++  +LG P+G  L G+TV + G G I + L+KRLR FDV
Sbjct  120  AQTHVRTGVLGAPLGKVLAGRTVCLYGLGAIALPLSKRLRAFDV  163



>gb|AHF97449.1| lactate dehydrogenase [Desulfurella acetivorans A63]
Length=319

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 92/170 (54%), Gaps = 14/170 (8%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDY-----DICVVKNLGLNS  464
            +V   G +F    NY  E +        D + F +IP    +Y     D+ +     +++
Sbjct  5    KVFVAGIHFVGIQNYINECL--------DVLEFEFIPESALEYRIHECDVLIPAMSKIDA  56

Query  465  DLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  644
            +LI +A+ +KLI Q+G GL+GVDI AAT  GI VA +P+  TGNA S AE +I   + L 
Sbjct  57   NLIEKAQNLKLIHQWGAGLDGVDIVAATKKGIYVANVPTANTGNAESVAEWSIMAAIALA  116

Query  645  RKQHEMDIAIKQKM-LGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            R    +   +   +  G P+G +L+GK   I+G+G IG  +A+RL+ F V
Sbjct  117  RGFPYIQNNVYNAVGWGCPVGISLIGKKALIIGFGGIGRAIAQRLKSFGV  166



>ref|WP_038649217.1| lactate dehydrogenase [Pantoea rwandensis]
 gb|AIR87498.1| lactate dehydrogenase [Pantoea rwandensis]
Length=315

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D  +     +++ LI+ A R+KL+ Q GVGLEGVD+ AA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCRVDARLIATADRLKLVQQAGVGLEGVDLEAAKKAGIMVANVPSDHSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I++++GL R+QHE+   + Q+ LG+PIG  L+GKT+ ++G G IG  LAKRL PF
Sbjct  102  VAELGIWMMIGLARRQHEIADCLAQQRLGQPIGLGLMGKTLGLVGLGGIGKALAKRLAPF  161



>ref|WP_018335712.1| hypothetical protein [Actinomycetospora chiangmaiensis]
Length=317

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 91/165 (55%), Gaps = 2/165 (1%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIP-AVIKDYDICVVKNLGLNSDLIS  476
            R+   G  FP         + + +  ++D    V +P A     D+       ++  LI 
Sbjct  2    RIGLVGGGFPEVRRCLTAALAELAIPELDGAELVDVPHAAPAPADVLAPLGSTVDGPLID  61

Query  477  RAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQH  656
             A   +L+ QFGVG+ GVD+ AA   G+ VA +P G +GNAT+ AE+A+ L+L LLR+  
Sbjct  62   -ACGARLVQQFGVGVSGVDLAAARERGVPVANVPGGGSGNATAVAEIALLLLLALLRRYE  120

Query  657  EMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            E    + +K +G P+G  L G+TV ++G G+IG+ +A RLR F V
Sbjct  121  EARAGVAEKAVGSPMGVMLRGRTVAVLGTGDIGVEVAVRLRAFGV  165



>ref|WP_034949039.1| lactate dehydrogenase [Erwinia oleae]
Length=315

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D+ +  +  +++ L+S A R+KLI Q G GLE VDI +A+A GI VA +PS ++GNA S
Sbjct  42   FDVLIPGSAEVSASLLSTADRLKLIQQPGAGLESVDIDSASALGIPVANVPSDSSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I+L++GL R   E+   I  +  G P+G  L GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWLMIGLARGAREIPQMIATRQTGLPVGIGLAGKTVGLVGLGGIGKALAKRLLPF  161

Query  786  DV  791
             V
Sbjct  162  GV  163



>ref|WP_040401337.1| hypothetical protein, partial [Amorphus coralli]
Length=282

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = +3

Query  429  DICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSC  608
            D+ +     ++  L+   + ++LI+QFG GLEGVD+ AA+A GI VA +P+  TGNA S 
Sbjct  2    DVLIPTMTRIDGALMDAVRGLRLIIQFGSGLEGVDVEAASARGIAVANVPTAGTGNAESV  61

Query  609  AEMAIYLILGLLRK-QHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            AE ++   + +LRK     D        G+PIG +LLGKT  ++G G IG  LA RL PF
Sbjct  62   AEWSVMAAIAVLRKLPLAFDEIRGGASWGKPIGRSLLGKTAGLVGMGGIGEALATRLAPF  121

Query  786  DV  791
             V
Sbjct  122  GV  123



>ref|WP_034912135.1| lactate dehydrogenase [Erwinia sp. 9145]
Length=315

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            +D+ +  +  +++ L+S A R+KLI Q G GLE VDI +A+A GI VA +PS ++GNA S
Sbjct  42   FDVLIPGSAEVSASLLSTADRLKLIQQPGAGLESVDIDSASALGIPVANVPSDSSGNADS  101

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
             AE+ I+L++ L R   E+   I  +  G P+G  L GKTV ++G G IG  LAKRL PF
Sbjct  102  VAELGIWLMISLARGAREIPQMIATRQTGLPVGIGLAGKTVGLVGLGGIGKALAKRLLPF  161

Query  786  DV  791
             V
Sbjct  162  GV  163



>ref|WP_009201581.1| glyoxylate reductase [Anaerobaculum hydrogeniformans]
 gb|EFD24319.1| 4-phosphoerythronate dehydrogenase [Anaerobaculum hydrogeniformans 
ATCC BAA-1850]
Length=318

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 86/164 (52%), Gaps = 3/164 (2%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            RVLF    F           +++     D    +  P  +   ++ V       +++++ 
Sbjct  2    RVLFSNKGFERLREIIETLFENHEVRYAD---ILEDPDSLGWAEVLVKGTEPFTAEMLAH  58

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
            A  MK++ Q+GVGLE +DI A T+ GI V  +PSG TGNA   AE+A+  +L L +  ++
Sbjct  59   AHNMKMLCQWGVGLESIDIEACTSRGIYVCNVPSGNTGNAEGVAEIALLHMLLLAKGYNK  118

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
                +++  L  P G T+  K V I+G GN+G+ LAKRL  FDV
Sbjct  119  SQENLRKGKLFSPRGLTIWRKRVCIVGLGNVGMTLAKRLSSFDV  162



>ref|WP_038572953.1| hypothetical protein, partial [Desulfurella acetivorans]
Length=275

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = +3

Query  429  DICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSC  608
            D+ +     ++++LI +A+ +KLI Q+G GL+GVDI AAT  GI VA +P+  TGNA S 
Sbjct  1    DVLIPAMSKIDANLIEKAQNLKLIHQWGAGLDGVDIVAATKKGIYVANVPTANTGNAESV  60

Query  609  AEMAIYLILGLLRKQHEMDIAIKQKM-LGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
            AE +I   + L R    +   +   +  G P+G +L+GK   I+G+G IG  +A+RL+ F
Sbjct  61   AEWSIMAAIALARGFPYIQNNVYNAVGWGCPVGISLIGKKALIIGFGGIGRAIAQRLKSF  120

Query  786  DV  791
             V
Sbjct  121  GV  122



>ref|WP_014806274.1| glyoxylate reductase [Anaerobaculum mobile]
 gb|AFM21035.1| lactate dehydrogenase-like oxidoreductase [Anaerobaculum mobile 
DSM 13181]
Length=322

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 92/167 (55%), Gaps = 9/167 (5%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIP---AVIKDYDICVVKNLGLNSDL  470
            RVLF   NF       RE ++        +I +  I    ++++  D+ V       +++
Sbjct  2    RVLFSNRNF----ERLREIIE--PLFMGHEIKYANISEDVSLLEWADVLVRGTEPFTAEM  55

Query  471  ISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  650
            +S A  +K++ Q+GVG+EG+DI A +A G+ V  +PS  TGNA   AE+AI  +L L + 
Sbjct  56   LSFAPNLKMVCQWGVGVEGIDIEACSAKGVFVCNVPSSNTGNAEGVAEVAILHMLLLAKG  115

Query  651  QHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             ++    +K+  +  P G TL  K V I+G GN+G+ LA RL+PF V
Sbjct  116  YNKSQENLKKGKVFSPRGLTLWRKRVCIVGLGNVGVTLASRLKPFGV  162



>ref|WP_018114836.1| hypothetical protein [Rhizobium sp. JGI 0001005-K05]
Length=313

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 92/164 (56%), Gaps = 5/164 (3%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            R++F G  FP   +Y +  +     I + D     +P+ I   D+ + +   + +  + R
Sbjct  2    RIVFSGHTFPDMPDYLKRSLAGEHEILLWDGELTTMPSKI---DVLIPRAQRIGAVEMDR  58

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
               +K I QFGVGL+GVD+ AA    I VA +P G  GNA S AE AI L+L LLR+ ++
Sbjct  59   GN-VKFIQQFGVGLDGVDLAAARCRRIPVANVP-GTGGNADSVAEHAILLLLMLLRQCNK  116

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +   I+  +LG PIG  L G++V + G G +   LAKRL+ FDV
Sbjct  117  VRENIRDGILGAPIGTALAGRSVCLYGLGAVAKSLAKRLKAFDV  160



>ref|WP_013570641.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Terriglobus saanensis]
 gb|ADV84911.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Terriglobus saanensis SP1PR4]
Length=316

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 92/164 (56%), Gaps = 2/164 (1%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            R+LFCG NFP A  Y R+++      ++       +   +   D+ + K L +    +  
Sbjct  2    RILFCGNNFPDAPEYLRKHLPPGCNDEIVVCSETDVLPQLGRADVVIPKMLRMGRREME-  60

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
            A + +LI Q+G GLEG+D+ +A   G+ VA +P+   GNA S AE A+ LIL LLR   +
Sbjct  61   AGQFRLIQQWGAGLEGIDLESAKQKGVYVANVPA-TGGNAESVAEHALLLILALLRDLPK  119

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             D  ++  +LG P+G  L G+TV + G G I + +AKRL  F+V
Sbjct  120  ADANVRAGVLGAPLGKMLAGRTVCLYGLGAIALPIAKRLHSFEV  163



>ref|WP_026988575.1| hypothetical protein [Fodinicurvata fenggangensis]
Length=326

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 82/165 (50%), Gaps = 2/165 (1%)
 Frame = +3

Query  297  TRVLFCGPNFPAAHNYTREYVKDYSF-IQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
             R++     F +A +Y R  + D     +V+ +    +       DI +      +  L+
Sbjct  4    VRIVVASSGFRSALDYFRTVLPDAGVEAEVEAVDPALLQQGNTRADIIIPAMARFDGALM  63

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
             R   ++LI Q+G GLEGVDI AA   GI VA +P+  +GNA S AE  +   + + R+ 
Sbjct  64   DRIAGLRLIHQWGAGLEGVDIPAAKQRGIAVANVPTAGSGNAESVAEWCVMAAIAISRRL  123

Query  654  HEMDIAIKQ-KMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
              +   I++    G P G  L+GKT   +G G IG  LA RLRPF
Sbjct  124  PVLQEGIREGSSWGGPSGHALMGKTAGFVGLGGIGQALAARLRPF  168



>ref|WP_041919487.1| hypothetical protein, partial [Gloeocapsa sp. PCC 7428]
Length=269

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 9/114 (8%)
 Frame = +3

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            +++ L+ R  +++L+ + GVG+E VDI AAT  GI VA +PS  TGNA S AE+AI  +L
Sbjct  9    VDAALMDRLPQLRLVQRSGVGVENVDIAAATQRGIYVANVPSPGTGNAESVAELAILHML  68

Query  636  GLLR--KQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             L R  +  E+D         +P G +L  KTV I G G IG  +A+RLR F+V
Sbjct  69   ALARNYRASELD-------WNQPEGQSLWKKTVGIYGLGGIGQAIARRLRAFEV  115



>ref|WP_022842734.1| lactate dehydrogenase [Acidobacteriaceae bacterium TAA166]
Length=316

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 90/164 (55%), Gaps = 2/164 (1%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            R+LFCG  FP A  Y RE +      ++       I + +   D+ + K   + S  +  
Sbjct  2    RILFCGNTFPNAPEYLREQLPAECNDEILTCSDSDILSKLSGVDVVIPKMQRIGSREME-  60

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
            A + +LI Q+G GLEG+D+ +A   GI V+ +P+   GNA S AE A+ LIL LLR   +
Sbjct  61   AGKFRLIQQWGAGLEGIDLESARRRGIYVSNVPA-TGGNAESVAEHAMLLILALLRDLPK  119

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
                ++  +LG P+G  L G+TV + G G I + LAKRL+ F V
Sbjct  120  AQSNVRSGVLGAPLGKMLAGRTVCLYGLGAIALPLAKRLQSFGV  163



>gb|AFZ33157.1| Glyoxylate reductase [Gloeocapsa sp. PCC 7428]
Length=321

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 9/114 (8%)
 Frame = +3

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            +++ L+ R  +++L+ + GVG+E VDI AAT  GI VA +PS  TGNA S AE+AI  +L
Sbjct  61   VDAALMDRLPQLRLVQRSGVGVENVDIAAATQRGIYVANVPSPGTGNAESVAELAILHML  120

Query  636  GLLR--KQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
             L R  +  E+D         +P G +L  KTV I G G IG  +A+RLR F+V
Sbjct  121  ALARNYRASELD-------WNQPEGQSLWKKTVGIYGLGGIGQAIARRLRAFEV  167



>ref|WP_037135542.1| 2-hydroxyacid dehydrogenase [Rhizobium sp. CF394]
Length=313

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 90/164 (55%), Gaps = 5/164 (3%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISR  479
            +++FCG  FP    Y  + +     I V D     +P  I   D+ + + L + +  + R
Sbjct  2    KIVFCGNTFPDMPAYLEQALDGGHDITVWDGNPETMPTNI---DVLIPRALQVGAVDMDR  58

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
             K ++ I QFGVGL+GVD  AA A GI VA +P G  GNA S AE A+ L+L LLR+   
Sbjct  59   GK-VRFIQQFGVGLDGVDAAAARARGIPVANVP-GTGGNADSVAEHAMLLLLMLLRQGVR  116

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
                + + +LG P G  L GKTV + G G +   ++KRL+ F+V
Sbjct  117  AQRNVLEGILGAPTGRALSGKTVCLYGLGAVAKAISKRLKAFEV  160



>ref|WP_017800580.1| lactate dehydrogenase [Erwinia toletana]
Length=315

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = +3

Query  378  QVDDIPFV----YIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAA  545
            Q+ D+ F+    +    +  +D+ +     +++ L+  A  +KLI Q G GLEGVDI +A
Sbjct  22   QLPDVEFIASAGHAAQSLAGFDVLIPGMARVDARLLQTADNLKLIQQAGAGLEGVDIHSA  81

Query  546  TAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKT  725
               GI VA +PS  +GNA S AE+ I++++GL RK  E+  +I Q+ LG+P G  L+GKT
Sbjct  82   GEQGIIVANVPSDHSGNADSVAELGIWMMIGLARKALELPDSIAQQRLGQPTGLGLMGKT  141

Query  726  VFIMGYGNIGIHLAKRLRPFDV  791
            V ++G G IG  LA+RL  F V
Sbjct  142  VGLVGVGGIGKALARRLTAFGV  163



>ref|WP_024821851.1| hypothetical protein [Aminobacterium mobile]
Length=330

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 85/166 (51%), Gaps = 19/166 (11%)
 Frame = +3

Query  303  VLFCGPNF--------PAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGL  458
            +LF G +F        PA   +  +   D      D +P+          D+ +++ + +
Sbjct  3    ILFAGKSFLRLWDLLLPAFQGHEMDVADDLDL--KDKLPWA---------DVLIIRPMSV  51

Query  459  NSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILG  638
              +L+S+A R+K++ Q+GVG+EG+DI A T  GI    IPS  TGNA   AE+A+  ++ 
Sbjct  52   TYELLSKAPRLKMVQQWGVGVEGLDIEACTKLGIFACNIPSRGTGNAEGVAEIALLHMML  111

Query  639  LLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            L R+       I +  +  P G TL GK   ++G GN+G  + +RL
Sbjct  112  LARRYARSQEKISEGKIFTPPGITLWGKRACVVGLGNLGHCVVERL  157



>ref|WP_033397128.1| lactate dehydrogenase [Desulfobacter curvatus]
Length=314

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = +3

Query  417  IKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGN  596
            +K  D+ +     +  +++  A R+KLI Q G GLE VDI AA    I+V  +P+  +GN
Sbjct  39   LKGIDVLIPTMSAVTEEILDSADRLKLIQQCGSGLESVDIEAAQKRDIRVCNVPTDISGN  98

Query  597  ATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            A S AE+ IY+++GL R    M   + ++ +GEP G +L GKT  I+G G IG  L +RL
Sbjct  99   ADSVAELGIYMMIGLSRNIPVMAKNMAKRKMGEPQGISLQGKTAGIIGLGGIGKALIRRL  158

Query  777  RPFDV  791
            R FD+
Sbjct  159  RTFDM  163



>ref|WP_041446076.1| hypothetical protein, partial [Thermovirga lienii]
Length=309

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = +3

Query  402  YIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            Y+P+     ++ V+  + ++  L+++A  +K I Q+GVG+E +D+TA    G+KV  +P+
Sbjct  39   YLPST----EVMVIGPMKVDEALLNKAPNLKFIHQWGVGVEKIDLTACAERGVKVCNVPA  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIH  761
              TGNA    E+AI  +L L R+ +     +++K L  P G  L  KTV ++G GN+G  
Sbjct  95   KGTGNAEGVGELAIMHMLLLARRWNRTQENLRKKRLYAPRGVALWKKTVTVIGLGNVGQC  154

Query  762  LAKRLRPF  785
            + +R++ F
Sbjct  155  VIQRVKGF  162



>gb|AER67036.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermovirga lienii DSM 17291]
Length=321

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = +3

Query  402  YIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            Y+P+     ++ V+  + ++  L+++A  +K I Q+GVG+E +D+TA    G+KV  +P+
Sbjct  39   YLPST----EVMVIGPMKVDEALLNKAPNLKFIHQWGVGVEKIDLTACAERGVKVCNVPA  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIH  761
              TGNA    E+AI  +L L R+ +     +++K L  P G  L  KTV ++G GN+G  
Sbjct  95   KGTGNAEGVGELAIMHMLLLARRWNRTQENLRKKRLYAPRGVALWKKTVTVIGLGNVGQC  154

Query  762  LAKRLRPF  785
            + +R++ F
Sbjct  155  VIQRVKGF  162



>ref|WP_004073201.1| lactate dehydrogenase [Desulfobacter postgatei]
 gb|EIM63848.1| lactate dehydrogenase-like oxidoreductase [Desulfobacter postgatei 
2ac9]
Length=314

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 0/125 (0%)
 Frame = +3

Query  417  IKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGN  596
            +K  D+ +     +   ++  A R+KLI Q G GLE VDI AA    I+V  +P+  +GN
Sbjct  39   LKGIDVLIPTMSPVTEKILDSADRLKLIQQCGSGLEAVDIEAAEKRNIRVCNVPTDISGN  98

Query  597  ATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRL  776
            A S AE+ IY+++GL R    M   +  + +GEP G +L GKT  I+G G IG  L +RL
Sbjct  99   ADSVAELGIYMMIGLSRNVPVMANNMANRKMGEPQGISLQGKTAGIIGLGGIGKALIRRL  158

Query  777  RPFDV  791
            + FD+
Sbjct  159  KTFDM  163



>ref|WP_012940091.1| 3-phosphoglycerate dehydrogenase [Archaeoglobus profundus]
 ref|YP_003400428.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM 
5631]
 gb|ADB57755.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM 
5631]
Length=525

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 95/170 (56%), Gaps = 14/170 (8%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVD---DIPFVYIPAVIKDYDICVVKN-LGLNSD  467
            +VL   P    A ++ ++     + ++VD   DI    +  VI+DYD  +V++   +  D
Sbjct  2    KVLVADPIAEEAIDFMKK-----NGLEVDVKTDISHEELLEVIQDYDALIVRSRTRVTRD  56

Query  468  LISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLR  647
            +I RAK++K+I + GVG++ +D+  AT  GI V   P    GN+ S AE  I LIL + R
Sbjct  57   VIDRAKKLKIIGRAGVGVDNIDVDYATEKGIVVVNAPG---GNSVSAAEHTIGLILSIAR  113

Query  648  KQHEMDIAIKQKMLGEP--IGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            K  + D ++K+        +G  L GKT+ I+G G IG  +AKR+R F++
Sbjct  114  KIPQADRSVKEGKWERKKFVGIELRGKTLGIVGLGRIGYEVAKRMRCFEM  163



>ref|WP_022726624.1| lactate dehydrogenase [Fodinicurvata sediminis]
Length=326

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 81/165 (49%), Gaps = 2/165 (1%)
 Frame = +3

Query  297  TRVLFCGPNFPAAHNYTREYVKDYSF-IQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLI  473
             R++     F +A +Y R  +       +V+ +    +       D+ +      +  L+
Sbjct  4    VRIVVASSGFRSALDYFRTVLPKVGVEAEVEAVDPALLQQGTTRADVIIPAMAHFDGALM  63

Query  474  SRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQ  653
                 ++LI Q+G GLEGVDI AA+  GI VA +P+  +GNA S AE  +   + + R  
Sbjct  64   DCISGLRLIHQWGAGLEGVDIPAASQRGIAVANVPTAGSGNAESVAEWCVMAAIAISRCL  123

Query  654  HEMDIAIKQ-KMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPF  785
              +   I++    G P G  L+GKT  ++G G IG  LA RL+PF
Sbjct  124  PLLQEGIRECTTWGGPSGHALMGKTAGLVGLGGIGQALAARLQPF  168



>ref|WP_029716541.1| hypothetical protein [Atribacteria bacterium SCGC AAA255-G05]
Length=309

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 75/126 (60%), Gaps = 3/126 (2%)
 Frame = +3

Query  414  VIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATG  593
            VIKD D  +V    +N  ++  AK++K++ +FGVG + +DI AA  HG+KVA  P     
Sbjct  49   VIKDIDGYIVGLEKINEKVLEAAKKLKVVCKFGVGTDNIDIKAAEKHGVKVANCPG---S  105

Query  594  NATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKR  773
            N+ + AE+A+ L++ L R+  +++  +KQ      IG  + GK + I+G GNIG  L K 
Sbjct  106  NSNAVAELALGLMISLARRIPQLNFEVKQDKWPYHIGAEISGKVLGIVGLGNIGRSLVKL  165

Query  774  LRPFDV  791
            +R  ++
Sbjct  166  VRGLNM  171



>ref|WP_017824164.1| 3-phosphoglycerate dehydrogenase [Brachybacterium muris]
 gb|EYT47933.1| 3-phosphoglycerate dehydrogenase [Brachybacterium muris UCD-AY4]
Length=535

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 83/149 (56%), Gaps = 12/149 (8%)
 Frame = +3

Query  363  DYSFIQVDDIPFVYIPAVIKDYDICVVKNLGL-NSDLISRAKRMKLIMQFGVGLEGVDIT  539
            D     VD      + A + + D  +V++  L ++++ + A +++++ + GVGL+ VD+ 
Sbjct  23   DVEVRSVDGTDRPALLAAVAEADALLVRSATLVDAEVYAAAPKLRVVARAGVGLDNVDVP  82

Query  540  AATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQ-----KMLGEPIG  704
            AATA G+ V   P   T N  S AE+A+ LIL  LR     D ++KQ     K L    G
Sbjct  83   AATAAGVMVINAP---TSNIVSAAELAVTLILASLRNLGRADASMKQGKWERKAL---TG  136

Query  705  DTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
              LLGKTV ++G+G IG  +A+RL PF V
Sbjct  137  TELLGKTVGVVGFGRIGQLVAERLAPFGV  165



>ref|WP_038369993.1| 3-phosphoglycerate dehydrogenase [Brachybacterium phenoliresistens]
 gb|EWS83070.1| 3-phosphoglycerate dehydrogenase [Brachybacterium phenoliresistens]
Length=534

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 79/133 (59%), Gaps = 12/133 (9%)
 Frame = +3

Query  411  AVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGA  587
            A + + D  +V++   +++++ + A+ + ++ + GVGL+ VD+ AATA+G  V   P   
Sbjct  39   AAVAEADALLVRSATSVDAEVFAAARNLSVVARAGVGLDNVDVPAATANGTMVINAP---  95

Query  588  TGNATSCAEMAIYLILGLLRKQHEMDIAIK-----QKMLGEPIGDTLLGKTVFIMGYGNI  752
            T N  S AE+A+ LIL  LR     D ++K     +K L    G  LLGKTV ++G+G I
Sbjct  96   TSNIVSAAELAVSLILASLRNISRADASVKSGKWERKQL---TGVELLGKTVGVVGFGRI  152

Query  753  GIHLAKRLRPFDV  791
            G  +A+RLRPF V
Sbjct  153  GQLVAERLRPFGV  165



>ref|WP_044400573.1| 2-hydroxyacid dehydrogenase [Lacinutrix sp. Hel_I_90]
Length=312

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%), Gaps = 6/132 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            + ++I DYD  ++++   ++ D I  AK +K I + G GLE +D   A   GI +   P 
Sbjct  35   VQSIIHDYDGFIIRSRFSIDVDFIDAAKTLKFIGRVGAGLENIDCAYAEQKGITLIAAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQ-KMLGEP-IGDTLLGKTVFIMGYGNIG  755
            G   N  +  E ++ L+L L  K ++ D  ++Q K L E   G  L GKTV ++GYGN+G
Sbjct  95   G---NRNAVGEHSLALLLSLFNKLNKADREVRQGKWLREANRGQELDGKTVGLIGYGNMG  151

Query  756  IHLAKRLRPFDV  791
               AK+LR FDV
Sbjct  152  KAFAKKLRGFDV  163



>gb|KJU82091.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase [Candidatus 
Magnetobacterium bavaricum]
Length=304

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 3/128 (2%)
 Frame = +3

Query  405  IPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSG  584
            I   I D D  +     L S+++  A R+K+I + GVG++ VDI  AT  GIKV   P G
Sbjct  43   IAGFISDADYLIAGTEPLTSNVLESAGRLKIISRCGVGIDNVDIDTATRLGIKVFNTPFG  102

Query  585  ATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHL  764
             T    + AE+ + LI+ LLRK   M+  +K  +  + +G+ L GK V I+G+G IG  +
Sbjct  103  PT---MAVAELTVGLIIDLLRKITLMNGELKSGIWKKQMGNLLNGKNVGIIGFGKIGREV  159

Query  765  AKRLRPFD  788
            A  L+ FD
Sbjct  160  AALLQGFD  167



>emb|CCK81373.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding, catalytic 
region, fragment [Desulfobacula toluolica Tol2]
Length=143

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = +3

Query  429  DICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSC  608
            D+ +     +  + +  A +++LI Q G GLE VDI AA   GI VA +P+  +GNA S 
Sbjct  43   DVLIPTMSRVTEETLKTADKLQLIQQCGAGLELVDINAARKRGIFVANVPTDVSGNADSV  102

Query  609  AEMAIYLILGLLRKQHEMDIAIKQKMLGEPIG  704
            AE+AIYL++GL R    M  ++K +++G P+G
Sbjct  103  AELAIYLMIGLSRNTEMMKDSLKNRIMGGPMG  134



>ref|WP_006877083.1| phosphoglycerate dehydrogenase [Anaerotruncus colihominis]
 gb|EDS08925.1| 4-phosphoerythronate dehydrogenase [Anaerotruncus colihominis 
DSM 17241]
Length=319

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 80/142 (56%), Gaps = 11/142 (8%)
 Frame = +3

Query  366  YSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAA  545
            YSF ++     V+ P +    D  ++     N  +   A ++K++ +FGVG++ +D+ AA
Sbjct  39   YSFEEL----AVWAPEI----DGAIIGMDQWNEQVFQIAPKLKILARFGVGVDNIDLEAA  90

Query  546  TAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKT  725
              HG++V    + A  NA + AE+A+ +IL  LR   E++  +        +G  LLGKT
Sbjct  91   KRHGVQVV---NAAGMNANAVAELAVAMILNCLRGIPELNRKLTDGQWSRAVGRDLLGKT  147

Query  726  VFIMGYGNIGIHLAKRLRPFDV  791
            V ++G+G+IG  +AK+L  F+V
Sbjct  148  VGLLGFGDIGGRVAKKLSGFEV  169



>ref|WP_007127461.1| phosphoglycerate dehydrogenase [Paenibacillus lactis]
 gb|EHB68159.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Paenibacillus 
lactis 154]
Length=322

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 3/111 (3%)
 Frame = +3

Query  459  NSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILG  638
            N D+   A ++K I +FGVG++ +D+ AA  +GI+V  +P G   NA + AE+A+ L++ 
Sbjct  63   NEDVFKLAPQLKGIARFGVGVDNIDLEAARKYGIQVTNVPRG---NANAVAELAVGLMIA  119

Query  639  LLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            + R    +D + K       +G  L G TV ++G+GNI    AK+LR FDV
Sbjct  120  VRRSIPLLDQSTKNGGWDRFVGSELAGGTVGLLGFGNIAQLTAKKLRGFDV  170



>ref|WP_012269747.1| MULTISPECIES: 2-hydroxyacid dehydrogenase [Thermoanaerobacter]
 gb|ABY95698.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Thermoanaerobacter 
pseudethanolicus ATCC 33223]
 gb|ADV80626.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
Length=320

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 85/164 (52%), Gaps = 14/164 (9%)
 Frame = +3

Query  333  AHNYTREYVKDYSFIQVDDIPFVYIPA-----------VIKDYDICVVKNLGLNSDLISR  479
            A ++     + ++ ++ +D   V IPA           ++KD D  +V N  +  D+I+ 
Sbjct  10   ARSFGESSDEPFNILKGNDCEVVKIPADRPLSAEELIPLVKDADALIVGNDKVTEDVINA  69

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
             K++K+I ++GVG + VD+ AA   GI V   P+    N  S A++ I L+L L R    
Sbjct  70   GKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPN---ANNNSVADLVIGLMLVLARNLLA  126

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +D  +K       +G  + GKT+ I+G G IG  +AKR + FD+
Sbjct  127  VDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAKRAKGFDM  170



>ref|WP_012994332.1| 2-hydroxyacid dehydrogenase [Thermoanaerobacter italicus]
 gb|ADD01489.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter italicus Ab9]
Length=320

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 85/164 (52%), Gaps = 14/164 (9%)
 Frame = +3

Query  333  AHNYTREYVKDYSFIQVDDIPFVYIPA-----------VIKDYDICVVKNLGLNSDLISR  479
            A ++     + ++ ++ +D   V IPA           ++KD D  +V N  +  D+I+ 
Sbjct  10   ARSFGESSDEPFNILKGNDCEVVKIPADRPLSAEELIPLVKDADALIVGNDKVTEDVINA  69

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
             K++K+I ++GVG + VD+ AA   GI V   P+    N  S A++ I L+L L R    
Sbjct  70   GKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPN---ANNNSVADLVIGLMLVLARNLLA  126

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +D  +K       +G  + GKT+ I+G G IG  +AKR + FD+
Sbjct  127  VDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAKRAKGFDM  170



>ref|WP_020812372.1| 3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens]
 gb|EPR15656.1| 3-phosphoglycerate dehydrogenase [Agrobacterium radiobacter DSM 
30147]
 gb|KDR89374.1| phosphoglycerate dehydrogenase [Agrobacterium tumefaciens GW4]
Length=317

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 3/132 (2%)
 Frame = +3

Query  396  FVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARI  575
            F  + A + D D  +      N  +   A R+K I +FGVG++ +DI AA  HGI V   
Sbjct  41   FDELSARLGDVDAVIAGVDTWNDRVFDLAPRLKAIARFGVGVDNIDIDAAHRHGIAVTNA  100

Query  576  PSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIG  755
            P G   NA + AE+ + LIL  +R+   +  A++       +G  L+G+ V ++G+GNI 
Sbjct  101  PGG---NANAVAELTLGLILSAMRRIPYLHDALRGGAWDRFVGQELIGRRVGLLGFGNIA  157

Query  756  IHLAKRLRPFDV  791
              +A++L  FDV
Sbjct  158  RKIARKLSGFDV  169



>ref|WP_015775903.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium]
 ref|YP_003155284.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM 
4810]
 gb|ACU85694.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM 
4810]
Length=535

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 71/117 (61%), Gaps = 11/117 (9%)
 Frame = +3

Query  456  LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLIL  635
            +++++ + A ++K++ + GVGL+ VD+ AATA G+ V   P   T N  S AE+AI LIL
Sbjct  55   VDAEVYAAASQLKVVARAGVGLDNVDVDAATAAGVMVINAP---TSNIVSAAELAITLIL  111

Query  636  GLLRKQHEMDIAIK-----QKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
              LR     D ++K     +K L    G  LL KTV ++G+G IG  +A+RLRPF V
Sbjct  112  SSLRNLGRADASVKAGRWERKQL---TGVELLEKTVGVVGFGRIGQLVAERLRPFGV  165



>ref|WP_002705675.1| phosphoglycerate dehydrogenase [Microscilla marina]
 gb|EAY24018.1| D-3-phosphoglycerate dehydrogenase [Microscilla marina ATCC 23134]
Length=316

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 71/136 (52%), Gaps = 6/136 (4%)
 Frame = +3

Query  387  DIPFVYIPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIK  563
            DI    I  ++  Y+  +V++   ++ DLI RA R+K+I + G GL+ +D++AA A GIK
Sbjct  31   DITRAEILTIVDKYEGLMVRSKTAIDEDLIGRASRLKVIARAGAGLDKIDLSAANARGIK  90

Query  564  VARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPI--GDTLLGKTVFIM  737
            V   P    GN  +  E  I ++L LL      D  +K          G  L+ K V ++
Sbjct  91   VLNAPE---GNRDAVGEQTIGMLLSLLHNVQRADWEVKNFAWKREANRGVELMDKVVGVI  147

Query  738  GYGNIGIHLAKRLRPF  785
            GYGN+G   AKRL  F
Sbjct  148  GYGNMGKAFAKRLSSF  163



>ref|WP_026414719.1| 3-phosphoglycerate dehydrogenase [Actinomadura oligospora]
Length=529

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +3

Query  363  DYSFIQVDDIPFVYIPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDIT  539
            DY    VD      +   I D D  +V++   +N+++   A R++++ + GVGL+ VD+ 
Sbjct  23   DYEVRHVDGADRAALLPAITDVDALIVRSATKVNAEVFEHATRLRVVARAGVGLDNVDVE  82

Query  540  AATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEP--IGDTL  713
            AAT  G+ V   P   T N  + AE AI L+L + R   +   A+KQ         G  L
Sbjct  83   AATKAGVMVVNAP---TSNIVTAAEHAIALLLAIARNVPQGHAALKQGEWKRSKYTGVEL  139

Query  714  LGKTVFIMGYGNIGIHLAKRLRPFDV  791
             GKTV ++G G IG+ +A+RL  FD+
Sbjct  140  QGKTVGVLGLGRIGVLVAQRLAAFDM  165



>ref|WP_015782796.1| 2-hydroxyacid dehydrogenase [Capnocytophaga ochracea]
 gb|ACU93290.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Capnocytophaga 
ochracea DSM 7271]
Length=316

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 73/131 (56%), Gaps = 6/131 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I DYD  ++++   ++   + +A R+K I + G GLE +D+  A + GI +   P 
Sbjct  35   IEAKIADYDGIIIRSRFTIDRTFLDKATRLKFIGRVGAGLENIDVAYAESKGITLIAAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIK--QKMLGEPIGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ ++L LL K  + +  IK  + +  E  G  L GKTV I+GYGN+G
Sbjct  95   G---NRNAVGEHALGMLLALLNKFKKANNEIKNGKWLREENRGWELDGKTVGIIGYGNMG  151

Query  756  IHLAKRLRPFD  788
               AK+LR FD
Sbjct  152  KSFAKKLRGFD  162



>ref|WP_002671550.1| 2-hydroxyacid dehydrogenase [Capnocytophaga ochracea]
 gb|EFS98349.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga ochracea F0287]
 gb|EJF45650.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga ochracea str. 
Holt 25]
Length=320

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 73/131 (56%), Gaps = 6/131 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I DYD  ++++   ++   + +A R+K I + G GLE +D+  A + GI +   P 
Sbjct  35   IEAKIADYDGIIIRSRFTIDRTFLDKATRLKFIGRVGAGLENIDVAYAESKGITLIAAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIK--QKMLGEPIGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ ++L LL K  + +  IK  + +  E  G  L GKTV I+GYGN+G
Sbjct  95   G---NKNAVGEHALGMLLALLNKFKKANNEIKNGKWLREENRGWELDGKTVGIIGYGNMG  151

Query  756  IHLAKRLRPFD  788
               AK+LR FD
Sbjct  152  KSFAKKLRGFD  162



>ref|WP_013048792.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Aminobacterium colombiense]
 gb|ADE57529.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Aminobacterium colombiense DSM 12261]
Length=324

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 74/152 (49%), Gaps = 11/152 (7%)
 Frame = +3

Query  324  FPAAHNYTREYVKDYSFIQVDDIPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIM  503
            FPA   ++ +   D    Q   +P+          D+ V++ + +   L+     +K++ 
Sbjct  18   FPAFKEHSLDVAGDGELEQ--KLPWA---------DVLVIRPMNITKSLLQHGTNLKMVQ  66

Query  504  QFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQK  683
            Q+G G+EG++I   T  GI    IPS  TGN    AEMAI  ++ L R+ H     + + 
Sbjct  67   QWGAGVEGLNIQDCTDLGIYACNIPSRGTGNGEGVAEMAILHMMLLGRRYHRSREKLLEG  126

Query  684  MLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLR  779
             +  P G  L GK   ++G GN+G  L +RL+
Sbjct  127  KVFTPPGTVLWGKKACVIGLGNLGHCLVERLK  158



>ref|WP_027884821.1| 2-hydroxyacid dehydrogenase [Mesonia mobilis]
Length=316

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +3

Query  417  IKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATG  593
            I  YD  ++++   L+   IS AK +K I + G GLE +D   A+A GI++   P    G
Sbjct  39   IDAYDGIIIRSRFKLDQAFISAAKNLKFIGRLGAGLENIDTEFASAQGIQLFSAPE---G  95

Query  594  NATSCAEMAIYLILGLLRKQHEMDIAIK--QKMLGEPIGDTLLGKTVFIMGYGNIGIHLA  767
            N  +  E A+ ++L L  K ++ D  ++  + +  E  G  L GKTV I+GYGN+G   A
Sbjct  96   NRNAVGEHALGMLLSLFNKLNKADQEVRNGKWLREENRGVELEGKTVGIIGYGNMGKSFA  155

Query  768  KRLRPFDV  791
            K+L+ FDV
Sbjct  156  KKLQGFDV  163



>ref|WP_009418381.1| 2-hydroxyacid dehydrogenase [Capnocytophaga sp. oral taxon 335]
 gb|EJF35500.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga sp. oral taxon 
335 str. F0486]
Length=316

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 73/131 (56%), Gaps = 6/131 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I DYD  ++++   ++   + +A R+K I + G GLE +D+  A + GI +   P 
Sbjct  35   IEAKIADYDGIIIRSRFTIDRTFLDKATRLKFIGRVGAGLENIDVAYAESKGITLIAAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIK--QKMLGEPIGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ ++L LL K  + +  IK  + +  E  G  L GKTV I+GYGN+G
Sbjct  95   G---NRNAVGEHALGMLLALLNKFKKANNEIKNGKWLREENRGWELDGKTVGIIGYGNMG  151

Query  756  IHLAKRLRPFD  788
               AK+LR FD
Sbjct  152  KSFAKKLRGFD  162



>ref|WP_022827611.1| 2-hydroxyacid dehydrogenase [Flavobacterium antarcticum]
Length=317

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (55%), Gaps = 6/132 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I +YD  V+++   ++   I +A  +K I + G GLE +D   A+A GI +   P 
Sbjct  36   IEAKISNYDGIVIRSRFNIDKQFIDKAVNLKFIARVGAGLESIDCDYASAKGIALIAAPE  95

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQ-KMLGEP-IGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ +IL L    +  +  +K  K L EP  G  L G+T+ I+GYGN+G
Sbjct  96   G---NRNAVGEHALGMILSLFNNLNRANAEVKSGKWLREPNRGHELDGRTIGIIGYGNMG  152

Query  756  IHLAKRLRPFDV  791
               AK+LR FDV
Sbjct  153  KAFAKKLRGFDV  164



>ref|WP_010974651.1| MULTISPECIES: phosphoglycerate dehydrogenase [Agrobacterium tumefaciens 
complex]
 ref|NP_396332.1| putative phosphoglycerate dehydrogenase [Agrobacterium fabrum 
str. C58]
 gb|AAK90773.1| putative phosphoglycerate dehydrogenase [Agrobacterium fabrum 
str. C58]
 gb|KEY51792.1| phosphoglycerate dehydrogenase [Agrobacterium tumefaciens]
 gb|KJX90036.1| phosphoglycerate dehydrogenase [Agrobacterium tumefaciens]
Length=317

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 3/132 (2%)
 Frame = +3

Query  396  FVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARI  575
            F  + A + D D  +      N  + + A R+K I +FGVG++ +DI AA  HGI V   
Sbjct  41   FDELSARLGDVDAVIAGVDTWNERVFNLAPRLKAIARFGVGVDNIDIDAAHRHGIAVTNA  100

Query  576  PSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIG  755
            P G   NA + AE+ + LIL  +R+   +  A++       +G  L+G+ V ++G+GNI 
Sbjct  101  PGG---NANAVAELTLGLILSAMRRIPYLHDALRGGAWDRFVGQELIGRRVGLLGFGNIA  157

Query  756  IHLAKRLRPFDV  791
              +A++L  FDV
Sbjct  158  RKIARKLCGFDV  169



>ref|WP_038240094.1| 2-hydroxyacid dehydrogenase [Zobellia uliginosa]
Length=320

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 74/136 (54%), Gaps = 6/136 (4%)
 Frame = +3

Query  393  PFVYIPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVA  569
            P   I A I +YD  ++++   ++S+ +++A ++K I + G GLE +D+  A A+ I +A
Sbjct  31   PKAEIEAKIHEYDGLIIRSRFSIDSEFLNKASKLKFIGRLGAGLENIDVRHAEANDIFLA  90

Query  570  RIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEP--IGDTLLGKTVFIMGY  743
              P G   N  +  E  + ++L L  K  + D  ++          G  L GKTV I+GY
Sbjct  91   AAPEG---NRNAVGEHTLGMLLSLFNKLQKADKEVRSGKWDREGNRGIELDGKTVGIIGY  147

Query  744  GNIGIHLAKRLRPFDV  791
            GN+G   AK+LR FDV
Sbjct  148  GNMGKAFAKKLRGFDV  163



>gb|EDP97261.1| phosphoglycerate dehydrogenase [Kordia algicida OT-1]
Length=299

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (57%), Gaps = 6/132 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I +YD  ++++   +++  +++A  +K I + G GLE +D   A   GIK+   P 
Sbjct  22   IEAKIHEYDGFIIRSRFKIDAKFLAKATNLKFIGRVGAGLENIDCEFAETKGIKLISAPE  81

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQ-KMLGEP-IGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ +IL L  K ++ D  +++ K L E   G  L G+TV I+GYGN+G
Sbjct  82   G---NRNAVGEHALGMILSLFNKLNKADREVREGKWLREANRGVELDGQTVGIIGYGNMG  138

Query  756  IHLAKRLRPFDV  791
               AK+LR FDV
Sbjct  139  KAFAKKLRGFDV  150



>ref|WP_012966581.1| 3-phosphoglycerate dehydrogenase [Ferroglobus placidus]
 ref|YP_003436517.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 
10642]
 gb|ADC66242.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 
10642]
Length=527

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 78/138 (57%), Gaps = 6/138 (4%)
 Frame = +3

Query  387  DIPFVYIPAVIKDYDICVVKNL-GLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIK  563
            DI    +  VIKDYD  +V++   +  ++I R +++K+I + GVG++ +D+ AAT  GI 
Sbjct  29   DISEEELKEVIKDYDALIVRSKPKVTREIIERGEKLKIIGRAGVGVDNIDVDAATERGII  88

Query  564  VARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPI--GDTLLGKTVFIM  737
            V   P    GN  S AE+ + LI+   RK  + D ++K+         G  L GKT+ I+
Sbjct  89   VVNAPG---GNTISTAELTMGLIISAARKIPQADRSVKEGKWERKKFEGLELRGKTLGII  145

Query  738  GYGNIGIHLAKRLRPFDV  791
            G G IG  +AKR + F++
Sbjct  146  GLGRIGFEVAKRAKSFEM  163



>ref|WP_028404925.1| phosphoglycerate dehydrogenase [Bacillus sp. J13]
Length=322

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 87/169 (51%), Gaps = 8/169 (5%)
 Frame = +3

Query  300  RVLFCGPNFPAAHNYTREYVKDYSFIQVDD-----IPFVYIPAVIKDYDICVVKNLGLNS  464
            +VL    N+       ++ + DY    +++     + F  +  V+   D  +      N 
Sbjct  5    KVLVTATNYSKLCANAKQLLLDYGCEIIENTFGRPLTFEELKEVVGSVDGVIAGVDTWNE  64

Query  465  DLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  644
            ++   A +++ I +FGVG++ +D+ AA  +GI+V  +P G   NA + AE+A+ L++ + 
Sbjct  65   EVFRLAPQLQGIARFGVGVDNIDLAAARKYGIQVTNVPRG---NANAVAELAVGLMIAVR  121

Query  645  RKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            R   ++D + K       +G  L G TV ++G+GNI    AK+L+ FDV
Sbjct  122  RSIPQLDQSTKNGGWDRFVGSELAGGTVGLLGFGNIAQLTAKKLQGFDV  170



>ref|WP_013149652.1| 2-hydroxyacid dehydrogenase [Thermoanaerobacter mathranii]
 gb|ADH60002.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii 
subsp. mathranii str. A3]
Length=320

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +3

Query  333  AHNYTREYVKDYSFIQVDDIPFVYIPA-----------VIKDYDICVVKNLGLNSDLISR  479
            A ++     + ++ ++ +D   V IP            ++KD D  +V N  +  D+I+ 
Sbjct  10   ARSFGESSDEPFNILKGNDCEVVKIPVDRPLSAEELIPLVKDADALIVGNDKVTEDVINA  69

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
             K++K+I ++GVG + VD+ AA   GI V   P+    N  S A++ I L+L L R    
Sbjct  70   GKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPN---ANNNSVADLVIGLMLVLARNLLA  126

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +D  +K       +G  + GKT+ I+G G IG  +AKR + FD+
Sbjct  127  VDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAKRAKGFDM  170



>ref|WP_009411355.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga sp. oral taxon 
324]
 gb|EKY12432.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga sp. oral taxon 
324 str. F0483]
Length=316

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 73/131 (56%), Gaps = 6/131 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I DYD  ++++   ++   + +A R++ I + G GLE +D+  A + GI +   P 
Sbjct  35   IEAKIADYDGFIIRSRFTIDRTFLDKATRLRFIGRVGAGLENIDVAYAESKGITLIAAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIK--QKMLGEPIGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ ++L LL K  + +  IK  + +  E  G  L GKTV I+GYGN+G
Sbjct  95   G---NKNAVGEHALGMLLALLNKFKKANNEIKNGKWLREENRGWELDGKTVGIIGYGNMG  151

Query  756  IHLAKRLRPFD  788
               AK+LR FD
Sbjct  152  KSFAKKLRGFD  162



>ref|WP_019153484.1| hypothetical protein [Bacillus massiliosenegalensis]
Length=326

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 72/134 (54%), Gaps = 3/134 (2%)
 Frame = +3

Query  390  IPFVYIPAVIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVA  569
            + F  +  VI D D  V      + ++   A ++K+I +FGVG++ +D+  A  +GIKV 
Sbjct  41   MAFDELKEVISDIDAVVAGVDTWDEEIFKIAPKLKIISRFGVGVDNIDLEKANEYGIKVT  100

Query  570  RIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGN  749
              P     N+ + AE+ + LIL  LR    +  + ++      +G  L GK V ++G+GN
Sbjct  101  NAPRL---NSNAVAELTVNLILNSLRNTPNLHASTQEGKWERFVGFELKGKQVGLLGFGN  157

Query  750  IGIHLAKRLRPFDV  791
            I   +AK+L+ FDV
Sbjct  158  IAQSVAKKLQGFDV  171



>ref|WP_028991991.1| 2-hydroxyacid dehydrogenase [Thermoanaerobacter thermocopriae]
Length=320

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +3

Query  333  AHNYTREYVKDYSFIQVDDIPFVYIPA-----------VIKDYDICVVKNLGLNSDLISR  479
            A ++     + ++ ++ +D   V IP            ++KD D  +V N  +  D+I+ 
Sbjct  10   ARSFGESSDEPFNILKGNDCEVVKIPVDRPLSAEELIPLVKDADALIVGNDKVTEDVINA  69

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
             K++K+I ++GVG + VD+ AA   GI V   P+    N  S A++ I L+L L R    
Sbjct  70   GKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPN---ANNNSVADLVIGLMLVLARNLLA  126

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +D  +K       +G  + GKT+ I+G G IG  +AKR + FD+
Sbjct  127  VDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAKRAKGFDM  170



>ref|WP_040559680.1| 2-hydroxyacid dehydrogenase [Kordia algicida]
Length=312

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (57%), Gaps = 6/132 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I +YD  ++++   +++  +++A  +K I + G GLE +D   A   GIK+   P 
Sbjct  35   IEAKIHEYDGFIIRSRFKIDAKFLAKATNLKFIGRVGAGLENIDCEFAETKGIKLISAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQ-KMLGEP-IGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ +IL L  K ++ D  +++ K L E   G  L G+TV I+GYGN+G
Sbjct  95   G---NRNAVGEHALGMILSLFNKLNKADREVREGKWLREANRGVELDGQTVGIIGYGNMG  151

Query  756  IHLAKRLRPFDV  791
               AK+LR FDV
Sbjct  152  KAFAKKLRGFDV  163



>ref|WP_003868999.1| 2-hydroxyacid dehydrogenase [Thermoanaerobacter ethanolicus]
 gb|EGD53082.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus 
JW 200]
Length=320

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +3

Query  333  AHNYTREYVKDYSFIQVDDIPFVYIPA-----------VIKDYDICVVKNLGLNSDLISR  479
            A ++     + ++ ++ +D   V IP            ++KD D  +V N  +  D+I+ 
Sbjct  10   ARSFGESSDEPFNILKGNDCEVVKIPVDRPLSAEELIPLVKDADALIVGNDKVTEDVINA  69

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
             K++K+I ++GVG + VD+ AA   GI V   P+    N  S A++ I L+L L R    
Sbjct  70   GKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPN---ANNNSVADLVIGLMLVLARNLLA  126

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +D  +K       +G  + GKT+ I+G G IG  +AKR + FD+
Sbjct  127  VDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAKRAKGFDM  170



>ref|WP_009415814.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga sp. oral taxon 
332]
 gb|EKY10304.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga sp. oral taxon 
332 str. F0381]
Length=313

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 75/131 (57%), Gaps = 6/131 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I DYD  ++++   ++   +++A ++K I + G GLE +D+  A + GI++   P 
Sbjct  35   IEAKIADYDGIIIRSRFPIDKAFLNKATQLKFIGRVGAGLENIDVAYAESKGIELIAAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIK--QKMLGEPIGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ ++L LL K  + +  IK  + +  E  G  L GKTV I+GYGN+G
Sbjct  95   G---NRNAVGEHALGMLLSLLNKFKKANNEIKSGKWLREENRGWELDGKTVGIIGYGNMG  151

Query  756  IHLAKRLRPFD  788
               AK+LR FD
Sbjct  152  KSFAKKLRGFD  162



>ref|XP_008347855.1| PREDICTED: uncharacterized protein LOC103410984 [Malus domestica]
Length=151

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            M I+IK   +G+P+G+TLLGKTVFI+GYGNIGI LAKRLRPF V
Sbjct  1    MQISIKLGXVGDPVGETLLGKTVFILGYGNIGIELAKRLRPFGV  44



>ref|WP_003868264.1| MULTISPECIES: 2-hydroxyacid dehydrogenase [Thermoanaerobacter]
 ref|YP_001661786.1| NAD-binding D-isomer specific 2-hydroxyacid dehydrogenase [Thermoanaerobacter 
sp. X514]
 ref|YP_003903122.1| phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gb|ABY91450.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Thermoanaerobacter 
sp. X514]
 gb|EEU61855.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Thermoanaerobacter 
ethanolicus CCSD1]
 gb|EFK85444.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gb|ADN53831.1| Phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gb|EMT39368.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding [Thermoanaerobacter 
thermohydrosulfuricus WC1]
Length=320

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 14/164 (9%)
 Frame = +3

Query  333  AHNYTREYVKDYSFIQVDDIPFVYIPA-----------VIKDYDICVVKNLGLNSDLISR  479
            A ++     + ++ ++ +D   V IP            ++KD D  +V N  +  D+I+ 
Sbjct  10   ARSFGESSDEPFNILKGNDCEVVKIPVDRPLSAEELIPLVKDADALIVGNDKVTEDVINA  69

Query  480  AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHE  659
             K++K+I ++GVG + VD+ AA   GI V   P+    N  S A++ I L+L L R    
Sbjct  70   GKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPN---ANNNSVADLVIGLMLVLARNLLA  126

Query  660  MDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
            +D  +K       +G  + GKT+ I+G G IG  +AKR + FD+
Sbjct  127  VDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAKRAKGFDM  170



>ref|WP_034132100.1| hypothetical protein [Peptococcaceae bacterium BICA1-8]
 gb|KJS83702.1| hypothetical protein JM58_12245 [Peptococcaceae bacterium BICA1-8]
Length=325

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 73/125 (58%), Gaps = 8/125 (6%)
 Frame = +3

Query  417  IKDYDICVVKNLG-----LNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I+  ++ +  N+G     +NS ++S+A+R+K+I  FGV  + +D+  AT   I VA +P+
Sbjct  37   IEKIEVLITSNMGFPCNAINSFILSKAERLKIIQNFGVSTDVIDVDEATKRNIPVAILPA  96

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIH  761
                N+ S AE+ I+L+  L ++  + + AI    LGEP+ + + GK   ++G G IG  
Sbjct  97   ---TNSVSVAELGIHLLFCLAKQVRKSEKAILANNLGEPLCEEVYGKKACVIGLGRIGTA  153

Query  762  LAKRL  776
            L+ R+
Sbjct  154  LSLRI  158



>ref|WP_004097881.1| hydroxyacid dehydrogenase [Acetonema longum]
 gb|EGO62698.1| phosphoglycerate dehydrogenase [Acetonema longum DSM 6540]
Length=317

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 4/127 (3%)
 Frame = +3

Query  414  VIKDYDICVVKNLGLNSDLISR-AKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGAT  590
            +I+D D  V     + + +I + A R+K++ + GVG   +D+TAA  HG++V   P    
Sbjct  44   LIQDVDGMVAGMDEVTAAVIDKGAPRLKIVAKHGVGYNNIDLTAAKEHGVQVTITPGA--  101

Query  591  GNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAK  770
             N  S AE+A  L+L + RK + MD +++        G  L GKT+ I+G GNIG  +AK
Sbjct  102  -NTVSVAELAFALMLAVARKINLMDKSVRAGSWNRVTGGELSGKTLGIVGLGNIGGEVAK  160

Query  771  RLRPFDV  791
            R   FD+
Sbjct  161  RAAAFDM  167



>ref|WP_021640963.1| putative glyoxylate reductase [[Clostridium] symbiosum]
 gb|ERI74649.1| putative glyoxylate reductase [ [[Clostridium] symbiosum ATCC 
14940]
Length=319

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 75/126 (60%), Gaps = 3/126 (2%)
 Frame = +3

Query  414  VIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATG  593
             IKD D  +     ++++ I+RA+++K+I ++GVG + VD+ AA   GI+V   P GA G
Sbjct  48   AIKDADALIAGLEDIDAETINRAEKLKVISRYGVGYDKVDLAAARQKGIQVTITP-GANG  106

Query  594  NATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKR  773
            +  S A++A+ L+L + R    MD +IK +    P G  +  KT+ I+G G IG  + +R
Sbjct  107  D--SVADLAVALMLDVARSVTIMDGSIKARSQKRPQGLEMFEKTLGIIGAGRIGQGVGRR  164

Query  774  LRPFDV  791
             R F++
Sbjct  165  CRGFNM  170



>ref|WP_015752989.1| 2-hydroxyacid dehydrogenase [Robiginitalea biformata]
 gb|EAR16232.1| putative D-3-phosphoglycerate dehydrogenase [Robiginitalea biformata 
HTCC2501]
Length=315

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = +3

Query  426  YDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATGNATS  605
            + I +   L ++ +L+ RAK ++ I + G GLE +D  AA   GI +A  P    GN  +
Sbjct  44   HGIIIRSRLPVDRELLDRAKNLEFIGRVGAGLENIDTRAAGERGIFLAAAPE---GNRNA  100

Query  606  CAEMAIYLILGLLRKQHEMDIAIKQKMLGEPI--GDTLLGKTVFIMGYGNIGIHLAKRLR  779
              E A+ ++L L+ K H  D  +++         G  L GKTV I+GYGN G   A++LR
Sbjct  101  VGEHALGMLLSLMNKLHTADAEVREGRWRREANRGVELDGKTVGIIGYGNTGQAFARKLR  160

Query  780  PFDV  791
             FDV
Sbjct  161  GFDV  164



>ref|WP_011246686.1| 3-phosphoglycerate dehydrogenase [Bacillus clausii]
 dbj|BAD64378.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gb|KFE60416.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii]
Length=533

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +3

Query  417  IKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATG  593
            ++ YD  ++++   +  +L+SR  R+K++ + GVG++ VDI AAT HG+ V   P    G
Sbjct  47   LEQYDALLIRSATTVTEELLSRMPRLKIVARAGVGVDNVDIQAATKHGVVVINAPD---G  103

Query  594  NATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPI--GDTLLGKTVFIMGYGNIGIHLA  767
            N  S AE    ++  LLR   + + ++K          G  L GKT+ I+G+G IG  LA
Sbjct  104  NTISTAEHTFAMMCALLRNIPQANASVKSGKWDRKAYQGTELRGKTLGIVGFGRIGTQLA  163

Query  768  KRLRPFDV  791
            KR + F++
Sbjct  164  KRAKAFEM  171



>ref|WP_003504829.1| MULTISPECIES: hypothetical protein [Clostridiales]
 gb|EGA91776.1| hypothetical protein HMPREF9474_04384 [ [[Clostridium] symbiosum 
WAL-14163]
 gb|EGB17587.1| 4-phosphoerythronate dehydrogenase [ [[Clostridium] symbiosum 
WAL-14673]
 gb|EHF03620.1| hypothetical protein HMPREF1020_04384 [Clostridium sp. 7_3_54FAA]
Length=319

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 75/126 (60%), Gaps = 3/126 (2%)
 Frame = +3

Query  414  VIKDYDICVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGATG  593
             IKD D  +     ++++ I+RA+++K+I ++GVG + VD+ AA   GI+V   P GA G
Sbjct  48   AIKDADALIAGLEDIDAETINRAEKLKVISRYGVGYDKVDLAAARQKGIQVTITP-GANG  106

Query  594  NATSCAEMAIYLILGLLRKQHEMDIAIKQKMLGEPIGDTLLGKTVFIMGYGNIGIHLAKR  773
            +  S A++A+ L+L + R    MD +IK +    P G  +  KT+ I+G G IG  + +R
Sbjct  107  D--SVADLAVALMLDVARNVTIMDGSIKARSQKRPQGLEMFEKTLGIIGAGRIGQGVGRR  164

Query  774  LRPFDV  791
             R F++
Sbjct  165  CRGFNM  170



>ref|WP_002678833.1| 2-hydroxyacid dehydrogenase [Capnocytophaga sputigena]
 gb|EEB66196.1| 4-phosphoerythronate dehydrogenase [Capnocytophaga sputigena 
ATCC 33612]
Length=320

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 72/131 (55%), Gaps = 6/131 (5%)
 Frame = +3

Query  405  IPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPS  581
            I A I DYD  ++++   ++   + +A R+K I + G GLE +D   A + GI +   P 
Sbjct  35   IEAKIADYDGIIIRSRFPIDKTFLDKATRLKFIGRVGAGLENIDCNYAESKGITLIAAPE  94

Query  582  GATGNATSCAEMAIYLILGLLRKQHEMDIAIK--QKMLGEPIGDTLLGKTVFIMGYGNIG  755
            G   N  +  E A+ ++L LL K  + +  IK  + +  E  G  L GKTV I+GYGN+G
Sbjct  95   G---NRNAVGEHALGMLLALLNKFKKANNEIKNGKWLREENRGWELDGKTVGIIGYGNMG  151

Query  756  IHLAKRLRPFD  788
               AK+LR FD
Sbjct  152  KSFAKKLRGFD  162



>ref|WP_044231804.1| dihydrofolate reductase [Porphyromonas sp. COT-290 OH3588]
 gb|KGO01312.1| dihydrofolate reductase [Porphyromonas sp. COT-290 OH3588]
Length=319

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 70/133 (53%), Gaps = 14/133 (11%)
 Frame = +3

Query  414  VIKDYDI-CVVKNLGLNSDLISRAKRMKLIMQFGVGLEGVDITAATAHGIKVARIPSGAT  590
            +I+D DI C      +  +L++R K++KL+  + VG   +DI  A  HGI V   P    
Sbjct  41   LIEDCDILCSTITHAVTGELMARGKKLKLVANYAVGYNNIDINYARVHGIAVTNTPRSVV  100

Query  591  GNATSCAEMAIYLILGLLRKQHEMDIAIKQKMLG--------EPIGDTLLGKTVFIMGYG  746
                  AE+A+ L+L   R+  E+D  I++  +G        E +G  L GKT+ I+GYG
Sbjct  101  A---PTAELAMALLLSCTRRTAELDRRIRE--VGGKLRLPRLEMLGTNLYGKTIGIVGYG  155

Query  747  NIGIHLAKRLRPF  785
            NIG  +AKR   F
Sbjct  156  NIGAAVAKRCLAF  168



>ref|WP_010552280.1| 3-phosphoglycerate dehydrogenase [Brachybacterium paraconglomeratum]
Length=535

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 12/149 (8%)
 Frame = +3

Query  363  DYSFIQVDDIPFVYIPAVIKDYDICVVKN-LGLNSDLISRAKRMKLIMQFGVGLEGVDIT  539
            D     VD      + A + + D  +V++   +++++ + A +++++ + GVGL+ VD+ 
Sbjct  23   DVEVRSVDGTDRTALLAAVAEADALLVRSATQVDAEVYAAAPKLRVVARAGVGLDNVDVP  82

Query  540  AATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKQHEMDIAIK-----QKMLGEPIG  704
             AT  G+ V   P   T N  S AE+AI LIL  LR     D ++K     +K L    G
Sbjct  83   GATTAGVMVINAP---TSNIVSAAELAIALILASLRNLGRADSSVKAGRWERKQL---TG  136

Query  705  DTLLGKTVFIMGYGNIGIHLAKRLRPFDV  791
              LL KTV ++G+G IG  +A+RLRPF V
Sbjct  137  VELLEKTVGVVGFGRIGQLVAERLRPFGV  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1614230233668