BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig11834

Length=1021
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349188.1|  PREDICTED: probable glutamyl endopeptidase, ...    353   2e-109   Solanum tuberosum [potatoes]
emb|CBI36950.3|  unnamed protein product                                351   3e-109   Vitis vinifera
ref|XP_004229392.1|  PREDICTED: probable glutamyl endopeptidase, ...    352   5e-109   Solanum lycopersicum
ref|XP_010652242.1|  PREDICTED: probable glutamyl endopeptidase, ...    352   5e-109   Vitis vinifera
ref|XP_010652241.1|  PREDICTED: probable glutamyl endopeptidase, ...    351   6e-109   Vitis vinifera
ref|XP_009604951.1|  PREDICTED: probable glutamyl endopeptidase, ...    350   3e-108   Nicotiana tomentosiformis
ref|XP_012082895.1|  PREDICTED: probable glutamyl endopeptidase, ...    349   5e-108   
ref|XP_009604950.1|  PREDICTED: probable glutamyl endopeptidase, ...    349   6e-108   Nicotiana tomentosiformis
gb|KJB49822.1|  hypothetical protein B456_008G139300                    346   5e-107   Gossypium raimondii
gb|KJB49821.1|  hypothetical protein B456_008G139300                    346   5e-107   Gossypium raimondii
gb|KJB49820.1|  hypothetical protein B456_008G139300                    346   6e-107   Gossypium raimondii
ref|XP_004494424.1|  PREDICTED: probable glutamyl endopeptidase, ...    346   7e-107   Cicer arietinum [garbanzo]
ref|XP_009774673.1|  PREDICTED: probable glutamyl endopeptidase, ...    345   1e-106   Nicotiana sylvestris
ref|XP_009774672.1|  PREDICTED: probable glutamyl endopeptidase, ...    345   1e-106   Nicotiana sylvestris
ref|XP_011041183.1|  PREDICTED: probable glutamyl endopeptidase, ...    344   3e-106   Populus euphratica
ref|XP_004494425.1|  PREDICTED: probable glutamyl endopeptidase, ...    342   1e-105   Cicer arietinum [garbanzo]
ref|XP_010069839.1|  PREDICTED: probable glutamyl endopeptidase, ...    343   1e-105   Eucalyptus grandis [rose gum]
gb|KCW58331.1|  hypothetical protein EUGRSUZ_H01015                     342   1e-105   Eucalyptus grandis [rose gum]
gb|KCW58332.1|  hypothetical protein EUGRSUZ_H01015                     342   1e-105   Eucalyptus grandis [rose gum]
ref|XP_007051106.1|  Prolyl oligopeptidase family protein               342   2e-105   
ref|XP_007200322.1|  hypothetical protein PRUPE_ppa000899mg             342   3e-105   Prunus persica
gb|KHG24720.1|  putative glutamyl endopeptidase, chloroplastic -l...    339   5e-105   Gossypium arboreum [tree cotton]
gb|KEH24433.1|  glutamyl endopeptidase, putative                        338   1e-104   Medicago truncatula
ref|XP_008235148.1|  PREDICTED: probable glutamyl endopeptidase, ...    339   3e-104   Prunus mume [ume]
gb|KEH24432.1|  glutamyl endopeptidase, putative                        339   3e-104   Medicago truncatula
gb|KEH24431.1|  glutamyl endopeptidase, putative                        338   3e-104   Medicago truncatula
ref|XP_003625970.1|  Acylamino-acid-releasing enzyme                    338   4e-104   Medicago truncatula
gb|KEH24430.1|  glutamyl endopeptidase, putative                        338   4e-104   Medicago truncatula
ref|XP_008235149.1|  PREDICTED: probable glutamyl endopeptidase, ...    338   4e-104   Prunus mume [ume]
ref|XP_010259303.1|  PREDICTED: probable glutamyl endopeptidase, ...    338   6e-104   Nelumbo nucifera [Indian lotus]
gb|EYU46808.1|  hypothetical protein MIMGU_mgv1a000875mg                338   6e-104   Erythranthe guttata [common monkey flower]
ref|XP_010259302.1|  PREDICTED: probable glutamyl endopeptidase, ...    338   7e-104   Nelumbo nucifera [Indian lotus]
ref|XP_006375435.1|  hypothetical protein POPTR_0014s11570g             337   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_002320974.2|  hypothetical protein POPTR_0014s11570g             337   2e-103   
ref|XP_006375436.1|  hypothetical protein POPTR_0014s11570g             337   2e-103   
ref|XP_006444495.1|  hypothetical protein CICLE_v10018738mg             332   2e-103   
ref|XP_004135992.1|  PREDICTED: probable glutamyl endopeptidase, ...    334   2e-102   Cucumis sativus [cucumbers]
ref|XP_011042249.1|  PREDICTED: probable glutamyl endopeptidase, ...    333   2e-102   Populus euphratica
ref|XP_008369043.1|  PREDICTED: probable glutamyl endopeptidase, ...    334   2e-102   
ref|XP_008369041.1|  PREDICTED: probable glutamyl endopeptidase, ...    334   2e-102   
ref|XP_006444496.1|  hypothetical protein CICLE_v10018738mg             333   2e-102   Citrus clementina [clementine]
gb|KDO86997.1|  hypothetical protein CISIN_1g002164mg                   333   3e-102   Citrus sinensis [apfelsine]
gb|KDO86995.1|  hypothetical protein CISIN_1g002164mg                   333   3e-102   Citrus sinensis [apfelsine]
ref|XP_006492336.1|  PREDICTED: probable glutamyl endopeptidase, ...    333   3e-102   
ref|XP_008451481.1|  PREDICTED: probable glutamyl endopeptidase, ...    333   4e-102   Cucumis melo [Oriental melon]
emb|CDP17069.1|  unnamed protein product                                332   5e-102   Coffea canephora [robusta coffee]
ref|XP_011041192.1|  PREDICTED: probable glutamyl endopeptidase, ...    333   5e-102   Populus euphratica
ref|XP_002301512.2|  hypothetical protein POPTR_0002s19700g             332   7e-102   
ref|XP_004300449.2|  PREDICTED: probable glutamyl endopeptidase, ...    330   3e-101   Fragaria vesca subsp. vesca
gb|AAM20412.1|  unknown protein                                         322   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079552.1|  PREDICTED: probable glutamyl endopeptidase, ...    330   6e-101   Sesamum indicum [beniseed]
ref|XP_006293660.1|  hypothetical protein CARUB_v10022616mg             328   6e-101   
ref|XP_006397934.1|  hypothetical protein EUTSA_v10001294mg             329   2e-100   Eutrema salsugineum [saltwater cress]
ref|XP_009378724.1|  PREDICTED: probable glutamyl endopeptidase, ...    329   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_011465337.1|  PREDICTED: probable glutamyl endopeptidase, ...    328   2e-100   Fragaria vesca subsp. vesca
ref|XP_009378723.1|  PREDICTED: probable glutamyl endopeptidase, ...    328   3e-100   Pyrus x bretschneideri [bai li]
ref|XP_010544967.1|  PREDICTED: probable glutamyl endopeptidase, ...    328   4e-100   Tarenaya hassleriana [spider flower]
ref|XP_010544966.1|  PREDICTED: probable glutamyl endopeptidase, ...    328   4e-100   Tarenaya hassleriana [spider flower]
ref|XP_009414913.1|  PREDICTED: probable glutamyl endopeptidase, ...    326   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010518437.1|  PREDICTED: probable glutamyl endopeptidase, ...    326   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_002882118.1|  serine-type peptidase                              326   2e-99    
ref|XP_010518438.1|  PREDICTED: probable glutamyl endopeptidase, ...    326   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009142541.1|  PREDICTED: probable glutamyl endopeptidase, ...    325   4e-99    Brassica rapa
ref|XP_009142540.1|  PREDICTED: probable glutamyl endopeptidase, ...    325   4e-99    Brassica rapa
ref|XP_010507894.1|  PREDICTED: probable glutamyl endopeptidase, ...    325   4e-99    Camelina sativa [gold-of-pleasure]
emb|CDY27492.1|  BnaC04g51330D                                          324   7e-99    Brassica napus [oilseed rape]
gb|KCW58330.1|  hypothetical protein EUGRSUZ_H01014                     318   1e-98    Eucalyptus grandis [rose gum]
ref|XP_007163177.1|  hypothetical protein PHAVU_001G213000g             323   2e-98    Phaseolus vulgaris [French bean]
ref|XP_007163178.1|  hypothetical protein PHAVU_001G213000g             323   2e-98    Phaseolus vulgaris [French bean]
emb|CDX80100.1|  BnaA05g00560D                                          323   3e-98    
ref|XP_010087237.1|  putative glutamyl endopeptidase                    327   3e-98    
gb|AAL57645.1|  At2g47390/T8I13.23                                      322   5e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AAB63841.1|  unknown protein                                         322   5e-98    Arabidopsis thaliana [mouse-ear cress]
sp|Q8VZF3.2|CGEP_ARATH  RecName: Full=Probable glutamyl endopepti...    322   5e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850473.1|  probable glutamyl endopeptidase                       322   5e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386780.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    322   8e-98    
ref|XP_010506775.1|  PREDICTED: probable glutamyl endopeptidase, ...    321   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_008813383.1|  PREDICTED: probable glutamyl endopeptidase, ...    321   1e-97    Phoenix dactylifera
ref|XP_009414911.1|  PREDICTED: probable glutamyl endopeptidase, ...    321   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414908.1|  PREDICTED: probable glutamyl endopeptidase, ...    321   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938262.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    320   2e-97    Elaeis guineensis
gb|KCW58328.1|  hypothetical protein EUGRSUZ_H01014                     319   2e-97    Eucalyptus grandis [rose gum]
ref|XP_008813382.1|  PREDICTED: probable glutamyl endopeptidase, ...    321   2e-97    
ref|XP_008813381.1|  PREDICTED: probable glutamyl endopeptidase, ...    321   3e-97    
ref|XP_008813379.1|  PREDICTED: probable glutamyl endopeptidase, ...    321   3e-97    
gb|ERN02133.1|  hypothetical protein AMTR_s00045p00176400               319   3e-97    Amborella trichopoda
ref|XP_010069840.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    319   3e-97    
gb|KFK37479.1|  hypothetical protein AALP_AA4G262700                    320   6e-97    Arabis alpina [alpine rockcress]
ref|XP_008813380.1|  PREDICTED: probable glutamyl endopeptidase, ...    320   7e-97    
ref|XP_006840458.2|  PREDICTED: probable glutamyl endopeptidase, ...    319   7e-97    Amborella trichopoda
gb|EMT29865.1|  Dipeptidyl peptidase family member 6                    317   9e-97    
emb|CDY55377.1|  BnaC04g51960D                                          318   2e-96    Brassica napus [oilseed rape]
gb|EMS47754.1|  putative glutamyl endopeptidase, chloroplastic          316   2e-96    Triticum urartu
gb|EEE58916.1|  hypothetical protein OsJ_10563                          316   5e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049893.1|  Os03g0307100                                       316   8e-96    
ref|XP_010228712.1|  PREDICTED: probable glutamyl endopeptidase, ...    315   1e-95    Brachypodium distachyon [annual false brome]
ref|XP_003558080.1|  PREDICTED: probable glutamyl endopeptidase, ...    315   1e-95    Brachypodium distachyon [annual false brome]
ref|XP_010228711.1|  PREDICTED: probable glutamyl endopeptidase, ...    315   2e-95    Brachypodium distachyon [annual false brome]
ref|XP_010679382.1|  PREDICTED: probable glutamyl endopeptidase, ...    314   5e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN19214.1|  Putative glutamyl endopeptidase, chloroplastic          314   8e-95    Glycine soja [wild soybean]
ref|XP_002467980.1|  hypothetical protein SORBIDRAFT_01g037483          312   3e-94    Sorghum bicolor [broomcorn]
ref|XP_004984623.1|  PREDICTED: probable glutamyl endopeptidase, ...    311   7e-94    Setaria italica
ref|XP_004984622.1|  PREDICTED: probable glutamyl endopeptidase, ...    311   8e-94    
tpg|DAA45011.1|  TPA: hypothetical protein ZEAMMB73_493989              308   1e-93    
ref|XP_008654905.1|  PREDICTED: probable glutamyl endopeptidase, ...    310   2e-93    
ref|XP_008654909.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   2e-93    
ref|XP_008654901.1|  PREDICTED: probable glutamyl endopeptidase, ...    310   2e-93    
ref|XP_006649964.1|  PREDICTED: probable glutamyl endopeptidase, ...    307   4e-93    
gb|KHN43458.1|  Putative glutamyl endopeptidase, chloroplastic          308   4e-93    Glycine soja [wild soybean]
ref|XP_006604741.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   7e-93    Glycine max [soybeans]
ref|XP_006604740.1|  PREDICTED: probable glutamyl endopeptidase, ...    308   9e-93    Glycine max [soybeans]
dbj|BAK03859.1|  predicted protein                                      266   2e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB49818.1|  hypothetical protein B456_008G139300                    278   2e-82    Gossypium raimondii
ref|XP_002515283.1|  dipeptidyl-peptidase, putative                     277   2e-81    
ref|XP_004958766.1|  PREDICTED: probable glutamyl endopeptidase, ...    270   1e-78    Setaria italica
ref|XP_006431496.1|  hypothetical protein CICLE_v10000356mg             263   3e-77    
ref|XP_006442098.1|  hypothetical protein CICLE_v10018865mg             260   1e-76    
ref|XP_006442097.1|  hypothetical protein CICLE_v10018865mg             260   1e-76    
ref|XP_006442099.1|  hypothetical protein CICLE_v10018865mg             260   9e-76    
ref|XP_001754620.1|  predicted protein                                  256   6e-74    
dbj|BAC21362.1|  aminoacyl peptidase-like                               251   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060706.1|  Os07g0689400                                       251   3e-73    
gb|EEE67855.1|  hypothetical protein OsJ_25660                          253   1e-72    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82725.1|  hypothetical protein OsI_27416                          253   1e-72    Oryza sativa Indica Group [Indian rice]
gb|EMS61523.1|  putative glutamyl endopeptidase, chloroplastic          248   2e-71    Triticum urartu
ref|XP_001761707.1|  predicted protein                                  243   5e-69    
ref|XP_001772878.1|  predicted protein                                  231   4e-65    
ref|XP_009774674.1|  PREDICTED: probable glutamyl endopeptidase, ...    221   1e-61    Nicotiana sylvestris
ref|XP_002990171.1|  hypothetical protein SELMODRAFT_131182             215   2e-59    
ref|XP_002992516.1|  hypothetical protein SELMODRAFT_135368             210   1e-57    
gb|EPS59919.1|  hypothetical protein M569_14885                         197   1e-57    Genlisea aurea
gb|EMT02117.1|  Dipeptidyl peptidase family member 6                    186   3e-49    
gb|EEC75088.1|  hypothetical protein OsI_11240                          178   4e-46    Oryza sativa Indica Group [Indian rice]
ref|XP_005642798.1|  alpha/beta-hydrolase                               172   4e-44    Coccomyxa subellipsoidea C-169
gb|KDO41281.1|  hypothetical protein CISIN_1g004456mg                   167   5e-43    Citrus sinensis [apfelsine]
gb|KDO41280.1|  hypothetical protein CISIN_1g004456mg                   167   6e-43    Citrus sinensis [apfelsine]
gb|KDO41279.1|  hypothetical protein CISIN_1g004456mg                   167   7e-43    Citrus sinensis [apfelsine]
gb|KDO41276.1|  hypothetical protein CISIN_1g004456mg                   167   1e-42    Citrus sinensis [apfelsine]
gb|KDO41277.1|  hypothetical protein CISIN_1g004456mg                   167   1e-42    Citrus sinensis [apfelsine]
gb|KDO41278.1|  hypothetical protein CISIN_1g004456mg                   167   1e-42    Citrus sinensis [apfelsine]
gb|KDO41275.1|  hypothetical protein CISIN_1g004456mg                   167   2e-42    Citrus sinensis [apfelsine]
gb|KIY94927.1|  hypothetical protein MNEG_13035                         144   3e-35    Monoraphidium neglectum
ref|XP_007510843.1|  predicted protein                                  147   4e-35    Bathycoccus prasinos
ref|XP_010679383.1|  PREDICTED: probable glutamyl endopeptidase, ...    143   3e-34    
ref|XP_003057252.1|  predicted protein                                  144   3e-34    Micromonas pusilla CCMP1545
emb|CEF98925.1|  Peptidase S9, prolyl oligopeptidase, catalytic d...    140   8e-33    Ostreococcus tauri
ref|XP_001419477.1|  predicted protein                                  136   1e-31    Ostreococcus lucimarinus CCE9901
ref|WP_015265145.1|  prolyl oligopeptidase family protein               135   4e-31    Echinicola vietnamensis
ref|WP_035401763.1|  aminoacyl peptidase                                128   8e-29    
gb|KER10044.1|  aminoacyl peptidase                                     127   1e-28    Candidatus Thermochlorobacteriaceae bacterium GBChlB
ref|WP_045690483.1|  hypothetical protein                               125   1e-28    
ref|WP_033370232.1|  aminoacyl peptidase                                126   4e-28    
ref|XP_002954276.1|  hypothetical protein VOLCADRAFT_106292             126   4e-28    Volvox carteri f. nagariensis
ref|XP_011401392.1|  putative glutamyl endopeptidase, chloroplastic     124   1e-27    Auxenochlorella protothecoides
ref|WP_040613448.1|  peptidase S9 prolyl oligopeptidase                 124   1e-27    
gb|EAP89653.1|  hypothetical protein OA2633_10314                       124   1e-27    Oceanicaulis sp. HTCC2633
ref|XP_002500610.1|  predicted protein                                  124   2e-27    Micromonas commoda
ref|WP_011644979.1|  peptidase S9 prolyl oligopeptidase                 124   2e-27    Maricaulis maris
ref|WP_029944702.1|  hypothetical protein                               122   3e-27    
ref|WP_029952658.1|  MULTISPECIES: aminoacyl peptidase                  122   5e-27    
ref|WP_039718325.1|  peptidase S9 prolyl oligopeptidase                 121   1e-26    
ref|WP_018479746.1|  glutamyl peptidase                                 121   2e-26    Pontibacter roseus
ref|WP_017733953.1|  hypothetical protein                               121   2e-26    Nafulsella turpanensis
ref|WP_027069324.1|  aminoacyl peptidase                                120   2e-26    
ref|WP_007653415.1|  peptidase S9 prolyl oligopeptidase active si...    120   3e-26    Pontibacter sp. BAB1700
ref|WP_029945099.1|  hypothetical protein                               114   4e-26    
gb|KDD76957.1|  hypothetical protein H632_c56p2                         119   5e-26    Helicosporidium sp. ATCC 50920
ref|WP_007163371.1|  hypothetical protein                               118   1e-25    Erythrobacter sp. NAP1
ref|WP_044014202.1|  aminoacyl peptidase                                118   2e-25    Hymenobacter sp. APR13
ref|WP_020258490.1|  hypothetical protein                               117   3e-25    
ref|WP_022700787.1|  peptidase S9 prolyl oligopeptidase                 117   3e-25    Oceanicaulis alexandrii
ref|WP_029164535.1|  hypothetical protein                               116   9e-25    
ref|WP_044201691.1|  aminoacyl peptidase                                115   9e-25    
emb|CDG85386.1|  prolyl oligopeptidase family protein                   115   1e-24    Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628
ref|WP_038496716.1|  aminoacyl peptidase                                115   1e-24    Janthinobacterium agaricidamnosum
ref|WP_014101391.1|  glutamyl peptidase                                 114   2e-24    Chloracidobacterium thermophilum
ref|WP_009280632.1|  peptidase S9 prolyl oligopeptidase active si...    114   3e-24    Fibrisoma limi
ref|WP_020264176.1|  MULTISPECIES: hypothetical protein                 114   3e-24    
ref|WP_024891486.1|  aminoacyl peptidase                                114   3e-24    Luteimonas huabeiensis
ref|WP_038690478.1|  aminoacyl peptidase                                114   4e-24    Stenotrophomonas rhizophila
ref|WP_043629145.1|  aminoacyl peptidase                                114   4e-24    Chromobacterium piscinae
ref|WP_012925251.1|  peptidase S9 prolyl oligopeptidase active si...    114   4e-24    
ref|WP_045051973.1|  aminoacyl peptidase                                114   4e-24    Chromobacterium violaceum
gb|EJP78273.1|  hypothetical protein A1OC_00641                         113   4e-24    Stenotrophomonas maltophilia Ab55555
ref|WP_018621090.1|  glutamyl peptidase                                 113   6e-24    Spirosoma luteum
ref|WP_032966434.1|  aminoacyl peptidase                                113   7e-24    Stenotrophomonas maltophilia
ref|WP_034784341.1|  aminoacyl peptidase                                113   7e-24    
gb|EMF62653.1|  Dipeptidyl aminopeptidase                               113   7e-24    Stenotrophomonas maltophilia EPM1
ref|WP_012479169.1|  dipeptidyl aminopeptidase                          113   7e-24    Stenotrophomonas maltophilia
gb|KIS37473.1|  glutamyl endopeptidase, chloroplastic                   113   7e-24    Stenotrophomonas maltophilia WJ66
ref|WP_043035372.1|  aminoacyl peptidase                                113   7e-24    Stenotrophomonas maltophilia
ref|WP_026069661.1|  aminoacyl peptidase                                113   9e-24    Stenotrophomonas maltophilia
ref|WP_043397996.1|  aminoacyl peptidase                                113   9e-24    Stenotrophomonas maltophilia
ref|WP_032952310.1|  aminoacyl peptidase [                              113   9e-24    [Pseudomonas] geniculata
ref|WP_033370130.1|  aminoacyl peptidase                                112   1e-23    Hymenobacter norwichensis
ref|WP_019338085.1|  dipeptidyl aminopeptidase                          112   1e-23    Stenotrophomonas maltophilia
ref|WP_029496139.1|  aminoacyl peptidase                                112   1e-23    
ref|WP_026952618.1|  aminoacyl peptidase                                112   1e-23    Algoriphagus mannitolivorans
ref|WP_034753463.1|  aminoacyl peptidase                                112   1e-23    
ref|WP_019923325.1|  hypothetical protein                               112   2e-23    Duganella zoogloeoides
ref|WP_040345786.1|  aminoacyl peptidase                                108   2e-23    
ref|WP_035562151.1|  aminoacyl peptidase                                111   2e-23    Hymenobacter sp. IS2118
ref|WP_021203441.1|  dipeptidyl aminopeptidase                          111   3e-23    Stenotrophomonas maltophilia
ref|WP_014036004.1|  dipeptidyl aminopeptidase                          111   3e-23    Stenotrophomonas maltophilia
ref|WP_033834450.1|  aminoacyl peptidase                                111   3e-23    Stenotrophomonas maltophilia
gb|EZP47495.1|  Peptidase S9 prolyl oligopeptidase active site do...    111   3e-23    Stenotrophomonas sp. RIT309
ref|WP_017742555.1|  hypothetical protein                               111   3e-23    Scytonema hofmannii
ref|WP_025876539.1|  MULTISPECIES: aminoacyl peptidase                  111   3e-23    Stenotrophomonas
ref|WP_043614381.1|  aminoacyl peptidase                                111   4e-23    Chromobacterium violaceum
ref|WP_026897909.1|  aminoacyl peptidase                                110   4e-23    Pedobacter oryzae
ref|WP_020606187.1|  glutamyl peptidase                                 110   4e-23    Spirosoma spitsbergense
ref|WP_035787784.1|  aminoacyl peptidase                                110   4e-23    Janthinobacterium sp. CG3
ref|WP_024957292.1|  aminoacyl peptidase                                110   5e-23    Stenotrophomonas maltophilia
gb|AIL06870.1|  X-Pro dipeptidyl-peptidase family protein               110   6e-23    Stenotrophomonas maltophilia
ref|WP_019661088.1|  dipeptidyl aminopeptidase                          110   6e-23    Stenotrophomonas maltophilia
ref|WP_026334910.1|  aminoacyl peptidase                                110   8e-23    Oxalobacteraceae bacterium AB_14
ref|WP_033830372.1|  aminoacyl peptidase                                110   8e-23    Stenotrophomonas maltophilia
gb|ABZ10203.1|  hypothetical protein ALOHA_HF4000APKG10H12ctg3g18       109   1e-22    uncultured marine microorganism HF4000_APKG10H12
ref|WP_019101413.1|  hypothetical protein                               109   1e-22    Chromobacterium
ref|WP_044129974.1|  aminoacyl peptidase                                109   1e-22    Rudanella lutea
ref|WP_004144050.1|  dipeptidyl aminopeptidase                          109   1e-22    Stenotrophomonas maltophilia
ref|WP_032953936.1|  aminoacyl peptidase                                109   1e-22    Stenotrophomonas
gb|EMI51368.1|  hypothetical protein C405_01692                         109   1e-22    Stenotrophomonas maltophilia AU12-09
ref|WP_035074703.1|  aminoacyl peptidase                                109   1e-22    Anditalea andensis
ref|WP_042613666.1|  aminoacyl peptidase                                109   1e-22    Stenotrophomonas maltophilia
ref|WP_011135850.1|  hypothetical protein                               109   2e-22    Chromobacterium violaceum
ref|WP_043641829.1|  aminoacyl peptidase                                108   3e-22    Chromobacterium haemolyticum
ref|WP_014645961.1|  dipeptidyl aminopeptidase                          108   3e-22    Stenotrophomonas maltophilia
ref|WP_041258970.1|  aminoacyl peptidase                                108   4e-22    
emb|CCH00873.1|  peptidase S9 prolyl oligopeptidase active site d...    108   4e-22    Fibrella aestuarina BUZ 2
gb|KIE09620.1|  peptidase S9                                            105   4e-22    Tolypothrix bouteillei VB521301
ref|WP_017165787.1|  hypothetical protein                               104   5e-22    
ref|WP_043593618.1|  aminoacyl peptidase                                107   5e-22    Chromobacterium haemolyticum
ref|WP_042821301.1|  aminoacyl peptidase                                107   5e-22    
ref|WP_019595958.1|  glutamyl peptidase                                 107   6e-22    Rhodonellum
ref|WP_032129696.1|  aminoacyl peptidase                                107   6e-22    Stenotrophomonas maltophilia
ref|WP_040016621.1|  aminoacyl peptidase                                103   7e-22    
ref|WP_017355273.1|  dipeptidyl aminopeptidase                          107   7e-22    Stenotrophomonas maltophilia
ref|WP_036107173.1|  aminoacyl peptidase                                106   1e-21    
emb|CEM59493.1|  exported peptide hydrolase                             106   1e-21    Xanthomonas campestris pv. campestris
gb|EYR68524.1|  glutamyl peptidase                                      106   1e-21    
gb|AEL05845.1|  hypothetical protein XCR_0928                           106   1e-21    Xanthomonas campestris pv. raphani 756C
ref|WP_043921614.1|  aminoacyl peptidase                                106   1e-21    Xanthomonas campestris
ref|WP_042596862.1|  aminoacyl peptidase                                106   1e-21    Xanthomonas campestris
ref|WP_012439199.1|  peptide hydrolase                                  106   2e-21    Xanthomonas campestris
ref|WP_035322400.1|  aminoacyl peptidase                                106   2e-21    Dyella
ref|WP_035727191.1|  aminoacyl peptidase                                105   2e-21    
ref|WP_008628244.1|  hypothetical protein                               105   2e-21    Mariniradius saccharolyticus
ref|WP_008444659.1|  peptidase S9 prolyl oligopeptidase catalytic...    105   2e-21    Janthinobacterium sp. HH01
ref|WP_011270002.1|  hypothetical protein                               105   3e-21    Xanthomonas campestris
ref|WP_014678753.1|  WD40-like beta propeller repeat protein,prol...    105   3e-21    Solitalea canadensis
ref|WP_032956704.1|  aminoacyl peptidase                                105   3e-21    Stenotrophomonas maltophilia
ref|WP_011035989.1|  hypothetical protein                               105   3e-21    Xanthomonas campestris
ref|WP_043572150.1|  aminoacyl peptidase                                105   4e-21    Chromobacterium
ref|WP_017172982.1|  glutamyl peptidase                                 104   4e-21    
ref|WP_019991150.1|  hypothetical protein                               104   5e-21    
emb|CDN18092.1|  exported peptide hydrolase domain protein              103   5e-21    Xanthomonas campestris pv. viticola
gb|KGT53107.1|  aminoacyl peptidase                                     104   5e-21    
ref|WP_038614998.1|  aminoacyl peptidase                                104   5e-21    
ref|WP_039569474.1|  aminoacyl peptidase                                104   5e-21    
ref|WP_026955831.1|  aminoacyl peptidase                                104   5e-21    Algoriphagus vanfongensis
ref|WP_017172335.1|  glutamyl peptidase                                 104   5e-21    
ref|WP_045689650.1|  aminoacyl peptidase                                104   6e-21    
ref|WP_017167519.1|  glutamyl peptidase                                 104   6e-21    
ref|WP_017169515.1|  glutamyl peptidase                                 104   6e-21    
ref|WP_017158615.1|  glutamyl peptidase                                 104   6e-21    
ref|WP_017160286.1|  glutamyl peptidase                                 104   6e-21    
ref|WP_008265992.1|  dipeptidyl aminopeptidase                          104   6e-21    Stenotrophomonas sp. SKA14
gb|EIM77055.1|  peptidase S9 prolyl oligopeptidase active site do...    103   7e-21    Nitritalea halalkaliphila LW7
ref|WP_039440851.1|  aminoacyl peptidase                                103   9e-21    
ref|WP_010367568.1|  putative secreted protein                          103   9e-21    
ref|WP_026113306.1|  aminoacyl peptidase                                103   9e-21    
ref|WP_026112336.1|  aminoacyl peptidase                                103   9e-21    
dbj|BAL54632.1|  glutamyl peptidase                                     103   1e-20    uncultured Acidobacteria bacterium
ref|WP_045714060.1|  aminoacyl peptidase                                103   1e-20    Xanthomonas citri
ref|WP_040280806.1|  aminoacyl peptidase                                102   1e-20    
ref|WP_045123385.1|  aminoacyl peptidase                                103   1e-20    Xanthomonas citri
gb|AGI09540.1|  Dipeptidyl aminopeptidase                               103   1e-20    Xanthomonas citri subsp. citri Aw12879
ref|WP_040107731.1|  aminoacyl peptidase                                103   2e-20    
ref|WP_040237610.1|  aminoacyl peptidase                                103   2e-20    
ref|WP_011050546.1|  hypothetical protein                               103   2e-20    
ref|WP_040230180.1|  aminoacyl peptidase                                103   2e-20    
gb|AGH76347.1|  hypothetical protein XAC29_04105                        103   2e-20    
ref|WP_043088118.1|  aminoacyl peptidase                                101   2e-20    
gb|EKQ61538.1|  hypothetical protein WS7_08598                          102   2e-20    
ref|WP_033479439.1|  aminoacyl peptidase                                102   2e-20    
emb|CCF67823.1|  prolyl oligopeptidase family protein                   102   2e-20    
gb|KGK58640.1|  aminoacyl peptidase                                     102   2e-20    
emb|CCG36710.1|  prolyl oligopeptidase family protein                   102   2e-20    
ref|WP_033482487.1|  aminoacyl peptidase                                102   2e-20    
ref|WP_033480056.1|  aminoacyl peptidase                                102   2e-20    
ref|WP_039404178.1|  aminoacyl peptidase                                102   2e-20    
gb|EKQ66410.1|  hypothetical protein MOU_00315                          102   2e-20    
ref|WP_033481444.1|  MULTISPECIES: aminoacyl peptidase                  102   2e-20    
emb|CEI05241.1|  conserved exported hypothetical protein                102   2e-20    
ref|WP_009036124.1|  prolyl oligopeptidase family protein               102   3e-20    
ref|WP_039436940.1|  aminoacyl peptidase                                102   4e-20    
ref|WP_025607761.1|  aminoacyl peptidase                                101   4e-20    
ref|WP_023903032.1|  hypothetical protein                               101   5e-20    
ref|WP_007968738.1|  hypothetical protein                               101   5e-20    
ref|WP_014089408.1|  dipeptidyl aminopeptidase/acylaminoacyl-pept...    101   5e-20    
ref|WP_006450141.1|  glutamyl peptidase                                 101   5e-20    
ref|WP_031421137.1|  aminoacyl peptidase                                101   6e-20    
ref|WP_008573535.1|  glutamyl peptidase                                 101   6e-20    
dbj|GAE60313.1|  dipeptidyl aminopeptidase/acylaminoacyl-peptidase      101   6e-20    
ref|WP_039515871.1|  aminoacyl peptidase                                101   7e-20    
ref|WP_044000965.1|  aminoacyl peptidase                                100   7e-20    
gb|EWC51200.1|  hypothetical protein XAR_2184                           100   8e-20    
gb|EGD09851.1|  glutamyl peptidase                                      100   8e-20    
ref|WP_009184839.1|  Prolyl oligopeptidase family protein               100   8e-20    
ref|WP_039531539.1|  aminoacyl peptidase                                100   9e-20    
ref|WP_026064250.1|  aminoacyl peptidase                                100   9e-20    
gb|KGU48021.1|  aminoacyl peptidase                                     100   9e-20    
ref|WP_033480922.1|  MULTISPECIES: aminoacyl peptidase                  100   9e-20    
ref|WP_026007267.1|  aminoacyl peptidase                                100   9e-20    
ref|WP_036148309.1|  aminoacyl peptidase                                100   9e-20    
ref|WP_026948044.1|  aminoacyl peptidase                                100   1e-19    
ref|WP_014771634.1|  prolyl oligopeptidase family protein               100   1e-19    
ref|WP_042827901.1|  aminoacyl peptidase                                100   1e-19    
ref|WP_042805880.1|  aminoacyl peptidase                                100   1e-19    
ref|WP_039418000.1|  aminoacyl peptidase                                100   1e-19    
emb|CAJ22488.1|  putative secreted protein                              100   1e-19    
gb|EFF47220.1|  conserved hypothetical protein                          100   1e-19    
ref|WP_022558322.1|  putative peptidase                                 100   1e-19    
ref|WP_039524067.1|  aminoacyl peptidase                                100   1e-19    
ref|WP_039426111.1|  aminoacyl peptidase                                100   1e-19    
ref|WP_026008314.1|  hypothetical protein                             95.1    1e-19    
ref|WP_009197199.1|  Poly(3-hydroxybutyrate) depolymerase               100   2e-19    
ref|WP_024938317.1|  aminoacyl peptidase                                100   2e-19    
ref|WP_035302640.1|  aminoacyl peptidase                              99.8    2e-19    
ref|WP_029818695.1|  aminoacyl peptidase                              99.4    2e-19    
ref|WP_013665039.1|  hypothetical protein                             99.0    3e-19    
ref|WP_020595622.1|  glutamyl peptidase                               99.0    3e-19    
ref|WP_044227088.1|  aminoacyl peptidase                              98.6    4e-19    
ref|WP_024353256.1|  aminoacyl peptidase                              98.6    5e-19    
ref|WP_007648506.1|  hypothetical protein                             98.6    5e-19    
ref|WP_003170123.1|  peptidase, S9A/B/C family, catalytic domain ...  98.6    5e-19    
ref|WP_036135718.1|  aminoacyl peptidase                              98.6    5e-19    
ref|WP_010920521.1|  hypothetical protein                             98.6    5e-19    
ref|WP_038894267.1|  aminoacyl peptidase                              93.2    5e-19    
ref|WP_008197892.1|  putative secreted protein                        98.6    5e-19    
ref|WP_043095243.1|  hypothetical protein                             98.2    5e-19    
ref|WP_045028808.1|  aminoacyl peptidase                              98.2    6e-19    
ref|WP_013929979.1|  peptidase S9 prolyl oligopeptidase active si...  98.2    6e-19    
ref|WP_031340205.1|  aminoacyl peptidase                              97.8    7e-19    
ref|WP_031329863.1|  aminoacyl peptidase                              92.4    1e-18    
ref|WP_044151818.1|  aminoacyl peptidase                              97.1    2e-18    
ref|WP_009780757.1|  hypothetical protein                             96.7    2e-18    
ref|WP_040349911.1|  aminoacyl peptidase                              96.3    2e-18    
gb|EDX79763.1|  peptidase, S9A/B/C family, catalytic domain protein   96.3    2e-18    
ref|WP_014978909.1|  glutamyl peptidase                               95.9    3e-18    
gb|KIG17952.1|  Dipeptidyl aminopeptidases/acylaminoacyl-peptidase    95.9    3e-18    
ref|WP_028890983.1|  aminoacyl peptidase                              95.9    3e-18    
ref|WP_029661158.1|  aminoacyl peptidase                              95.9    3e-18    
ref|WP_035309413.1|  aminoacyl peptidase                              95.5    4e-18    
ref|WP_041659027.1|  aminoacyl peptidase                              95.5    4e-18    
ref|WP_014997997.1|  glutamyl peptidase                               95.5    4e-18    
ref|WP_036194337.1|  aminoacyl peptidase                              95.5    5e-18    
ref|WP_028295855.1|  aminoacyl peptidase                              95.5    5e-18    
ref|WP_017912482.1|  glutamyl peptidase                               95.5    5e-18    
ref|WP_039727415.1|  hypothetical protein                             95.1    5e-18    
gb|ADU12961.1|  aminoacyl peptidase                                   95.5    5e-18    
gb|EKD80955.1|  peptidase S9 prolyl oligopeptidase active site pr...  92.4    5e-18    
ref|WP_028526669.1|  aminoacyl peptidase                              94.7    8e-18    
ref|WP_039230204.1|  aminoacyl peptidase                              94.7    8e-18    
ref|WP_028788724.1|  peptidase S9                                     94.0    1e-17    
ref|WP_023461582.1|  aminoacyl peptidase                              93.2    2e-17    
ref|WP_020607102.1|  hypothetical protein                             93.2    2e-17    
ref|WP_018127907.1|  hypothetical protein                             93.2    2e-17    
ref|WP_045809689.1|  aminoacyl peptidase                              93.2    2e-17    
ref|WP_019466298.1|  hypothetical protein                             93.2    2e-17    
gb|KFA32366.1|  aminoacyl peptidase                                   87.8    3e-17    
ref|WP_035044916.1|  aminoacyl peptidase                              92.4    5e-17    
ref|WP_021476771.1|  glutamyl peptidase                               92.0    5e-17    
ref|WP_029282738.1|  peptidase S9                                     92.0    6e-17    
ref|WP_026108609.1|  aminoacyl peptidase                              91.7    7e-17    
ref|WP_005491700.1|  hypothetical protein                             91.7    9e-17    
gb|AFU70114.1|  dipeptidyl aminopeptidase/acylaminoacyl-peptidase...  91.3    9e-17    
ref|WP_035084383.1|  aminoacyl peptidase                              91.3    9e-17    
ref|WP_044255181.1|  aminoacyl peptidase                              91.3    1e-16    
ref|WP_039244479.1|  aminoacyl peptidase                              91.3    1e-16    
gb|ADV63172.1|  glutamyl peptidase                                    91.3    1e-16    
ref|WP_016868342.1|  hypothetical protein                             90.9    1e-16    
ref|WP_023076979.1|  glutamyl peptidase                               90.9    1e-16    
ref|WP_015121038.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...  90.9    1e-16    
ref|WP_026628138.1|  aminoacyl peptidase                              90.9    1e-16    
ref|XP_002979901.1|  hypothetical protein SELMODRAFT_419533           90.5    2e-16    
ref|WP_028374744.1|  aminoacyl peptidase                              90.5    2e-16    
ref|WP_034921484.1|  aminoacyl peptidase                              90.5    2e-16    
ref|WP_034775121.1|  aminoacyl peptidase                              90.1    2e-16    
ref|WP_015195936.1|  peptidase S9 prolyl oligopeptidase active si...  90.1    2e-16    
ref|WP_044399417.1|  aminoacyl peptidase                              90.1    3e-16    
ref|WP_019038477.1|  hypothetical protein                             89.7    3e-16    
ref|WP_013070685.1|  prolyl oligopeptidase                            89.7    3e-16    
ref|WP_026839309.1|  aminoacyl peptidase                              89.7    3e-16    
ref|WP_033011098.1|  aminoacyl peptidase                              84.3    4e-16    
gb|KGR65661.1|  aminoacyl peptidase                                   84.3    4e-16    
ref|WP_039449234.1|  aminoacyl peptidase                              84.3    5e-16    
ref|WP_016989226.1|  glutamyl peptidase                               89.0    5e-16    
ref|WP_010519922.1|  hypothetical protein                             89.0    5e-16    
ref|WP_013409281.1|  hypothetical protein                             89.0    5e-16    
ref|WP_010602229.1|  peptidase S9                                     89.0    6e-16    
ref|XP_008594514.1|  peptidase S9 prolyl oligopeptidase               88.6    7e-16    
gb|KGQ10411.1|  putative glutamyl endopeptidaseic                     88.6    8e-16    
ref|WP_007094759.1|  50S ribosomal protein L33                        88.6    8e-16    
ref|WP_025145192.1|  peptidase S9                                     88.2    1e-15    
ref|WP_040555677.1|  aminoacyl peptidase                              88.2    1e-15    
ref|WP_025254805.1|  aminoacyl peptidase                              88.2    1e-15    
gb|EMY82435.1|  dipeptidyl aminopeptidase/acylaminoacyl-peptidase...  87.8    1e-15    
ref|WP_034259045.1|  aminoacyl peptidase                              87.8    1e-15    
ref|WP_037319528.1|  aminoacyl peptidase                              87.8    1e-15    
dbj|GAD58538.1|  LOW QUALITY PROTEIN: dipeptidyl aminopeptidases/...  87.8    1e-15    
gb|EKV00789.1|  glutamyl peptidase                                    87.8    1e-15    
ref|WP_036020214.1|  peptidase S9                                     87.8    1e-15    
ref|WP_045972581.1|  aminoacyl peptidase                              87.4    2e-15    
ref|WP_026752002.1|  peptidase S9                                     87.4    2e-15    
ref|XP_003081027.1|  Dipeptidyl aminopeptidases/acylaminoacyl-pep...  87.4    2e-15    
ref|WP_013578758.1|  peptidase S9                                     87.4    2e-15    
ref|WP_041035660.1|  peptidase S9                                     87.0    2e-15    
ref|WP_029034950.1|  aminoacyl peptidase                              87.0    2e-15    
ref|WP_026915443.1|  aminoacyl peptidase                              87.0    2e-15    
ref|WP_024742959.1|  peptidase                                        87.0    2e-15    
ref|WP_015755577.1|  hypothetical protein                             87.0    2e-15    
ref|WP_037441839.1|  aminoacyl peptidase                              87.0    3e-15    
ref|WP_039007478.1|  peptidase                                        87.0    3e-15    
ref|WP_026763394.1|  peptidase S9                                     87.0    3e-15    
ref|WP_026976430.1|  aminoacyl peptidase                              87.0    3e-15    
ref|WP_037496671.1|  aminoacyl peptidase                              86.7    3e-15    
ref|WP_033366167.1|  peptidase S9                                     86.7    3e-15    
ref|WP_026325866.1|  aminoacyl peptidase                              86.7    3e-15    
ref|WP_039475116.1|  peptidase S9                                     86.3    4e-15    
ref|WP_022826900.1|  glutamyl peptidase                               86.3    4e-15    
gb|EDM76855.1|  peptidase S9, prolyl oligopeptidase active site d...  86.3    5e-15    
ref|WP_034733426.1|  aminoacyl peptidase                              86.3    5e-15    
ref|WP_042826867.1|  aminoacyl peptidase                              82.0    5e-15    
ref|XP_006667439.1|  peptidase S9 prolyl oligopeptidase               86.3    5e-15    
ref|WP_026706913.1|  aminoacyl peptidase                              85.9    5e-15    
ref|WP_026451707.1|  aminoacyl peptidase                              85.9    5e-15    
ref|WP_045116726.1|  hypothetical protein                             85.9    6e-15    
ref|WP_015806071.1|  hypothetical protein                             85.9    6e-15    
gb|KFF74718.1|  aminoacyl peptidase                                   85.9    6e-15    
ref|WP_020570470.1|  hypothetical protein                             85.5    7e-15    
emb|CCP41412.1|  hypothetical protein BN444_03136                     85.5    8e-15    
ref|WP_038233872.1|  peptidase                                        85.5    8e-15    
ref|WP_007419109.1|  dipeptidyl aminopeptidase                        85.5    8e-15    
ref|WP_020715592.1|  peptidase S9                                     85.1    9e-15    
gb|KIJ83390.1|  peptidase S9                                          85.1    9e-15    
gb|KDO45516.1|  hypothetical protein CISIN_1g0126302mg                81.6    1e-14    
ref|XP_005847852.1|  hypothetical protein CHLNCDRAFT_31155            85.1    1e-14    
ref|WP_041402974.1|  hypothetical protein                             84.7    1e-14    
ref|WP_003470610.1|  hypothetical protein                             84.7    1e-14    
ref|WP_038495225.1|  aminoacyl peptidase                              84.7    2e-14    
gb|ADG66759.1|  peptidase S9 prolyl oligopeptidase active site do...  84.7    2e-14    
ref|WP_045081693.1|  aminoacyl peptidase                              84.3    2e-14    
ref|WP_013534184.1|  hypothetical protein                             84.3    2e-14    
ref|WP_034707653.1|  aminoacyl peptidase                              84.3    2e-14    
ref|WP_019538970.1|  hypothetical protein                             84.3    2e-14    
gb|AIY40376.1|  Dipeptidyl aminopeptidase/acylaminoacyl-peptidase     84.3    2e-14    
ref|WP_024711878.1|  peptidase                                        84.3    2e-14    
ref|WP_032131229.1|  aminoacyl peptidase                              84.3    2e-14    
ref|WP_039453298.1|  peptidase                                        84.0    2e-14    
ref|WP_008239252.1|  prolyl oligopeptidase                            84.0    2e-14    
ref|WP_041183833.1|  peptidase                                        84.0    2e-14    
gb|AEQ98445.1|  prolyl oligopeptidase-like protein                    84.0    2e-14    
ref|WP_034727666.1|  aminoacyl peptidase                              84.0    2e-14    
ref|WP_026933879.1|  aminoacyl peptidase                              84.0    2e-14    
ref|WP_009581987.1|  hypothetical protein                             84.0    2e-14    
ref|WP_013078205.1|  peptidase S9                                     84.0    3e-14    
ref|WP_039436910.1|  peptidase                                        84.0    3e-14    
ref|WP_039440077.1|  peptidase                                        84.0    3e-14    
ref|WP_010370355.1|  peptidase                                        84.0    3e-14    
gb|KFA01536.1|  peptidase                                             84.0    3e-14    
gb|KGP58252.1|  peptidase                                             84.0    3e-14    
ref|WP_045726912.1|  peptidase                                        84.0    3e-14    
ref|WP_017113260.1|  glutamyl peptidase                               84.0    3e-14    
ref|WP_038658679.1|  aminoacyl peptidase                              83.6    3e-14    
ref|WP_029038563.1|  aminoacyl peptidase                              83.6    4e-14    
ref|WP_011260655.1|  peptidase                                        83.2    4e-14    
ref|WP_043085508.1|  aminoacyl peptidase                              79.0    4e-14    
gb|AAW77609.1|  Dipeptidyl aminopeptidases/acylaminoacyl-peptidases   83.2    4e-14    
ref|WP_039347148.1|  aminoacyl peptidase                              83.2    4e-14    
ref|WP_009607500.1|  exported peptide hydrolase                       83.2    5e-14    
ref|WP_013598252.1|  prolyl oligopeptidase                            82.8    5e-14    
dbj|GAE53155.1|  prolyl oligopeptidase-like protein                   82.8    5e-14    
ref|WP_017117720.1|  peptidase                                        82.8    5e-14    
ref|WP_045756711.1|  peptidase                                        82.8    6e-14    
ref|WP_045767086.1|  peptidase                                        82.8    6e-14    
ref|WP_045765268.1|  peptidase                                        82.8    6e-14    
ref|WP_039814032.1|  peptidase                                        82.8    6e-14    
ref|WP_006987956.1|  hypothetical protein                             82.8    6e-14    
ref|WP_043888844.1|  peptidase                                        82.4    6e-14    
ref|WP_045757670.1|  peptidase                                        82.8    6e-14    
emb|CBA15076.1|  hypothetical secreted protein                        82.8    6e-14    
ref|WP_014265139.1|  peptidase S9                                     82.8    6e-14    
ref|WP_045769679.1|  peptidase                                        82.8    6e-14    
ref|WP_045761705.1|  peptidase                                        82.8    7e-14    
ref|WP_008637476.1|  prolyl oligopeptidase family protein             82.4    8e-14    
ref|WP_018108058.1|  hypothetical protein                             82.4    8e-14    
ref|WP_034750848.1|  aminoacyl peptidase                              82.0    9e-14    
ref|WP_017116881.1|  peptidase                                        82.0    1e-13    



>ref|XP_006349188.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Solanum tuberosum]
Length=976

 Score =   353 bits (905),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 192/251 (76%), Positives = 217/251 (86%), Gaps = 3/251 (1%)
 Frame = +3

Query  276   ASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEIRDIV  446
             ASSR  HLVP+ A+  EDGG  + +NGA  +    +YDDD   A    YRLPP EIRDIV
Sbjct  72    ASSRFHHLVPVNALTAEDGGNGTGSNGAADATASVAYDDDVESASVTGYRLPPFEIRDIV  131

Query  447   DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  626
             DAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAGIRIDGKCN+RSRMSFYTGI 
Sbjct  132   DAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGIRIDGKCNTRSRMSFYTGIA  191

Query  627   IHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADV  806
             IHQL+EDG+LGPEK I GLPE AKINFVTWSNNG +LAFSVR++E++ SSSKL VWVA+V
Sbjct  192   IHQLMEDGSLGPEKEIQGLPEGAKINFVTWSNNGQHLAFSVRLDEDDGSSSKLRVWVANV  251

Query  807   ETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  986
             +TG ARPLF+S DVY+NA+FDNFVWVNDSTLLVCTIPLSRGDPP+KPLVPSGPK+QSNEQ
Sbjct  252   DTGKARPLFKSPDVYVNAVFDNFVWVNDSTLLVCTIPLSRGDPPRKPLVPSGPKIQSNEQ  311

Query  987   KSIIQVRTFQD  1019
             K++IQ RT+QD
Sbjct  312   KNVIQARTYQD  322



>emb|CBI36950.3| unnamed protein product [Vitis vinifera]
Length=913

 Score =   351 bits (901),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +3

Query  276   ASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAP  455
             +SSR  HLVP+ A   E   G  +     ++A+   +++ ALG+ YRLPPPEI+DIVDAP
Sbjct  2     SSSRFLHLVPINAAAAEGDTGVGSNGSVSSTAED--EENSALGSGYRLPPPEIKDIVDAP  59

Query  456   PVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQ  635
             P+PALSFSPQRDKILFLKRR+LPPL +LA+PE KLAGIRIDGKCN+RSRMSFYT IGIHQ
Sbjct  60    PLPALSFSPQRDKILFLKRRALPPLEELAKPEEKLAGIRIDGKCNTRSRMSFYTSIGIHQ  119

Query  636   LLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETG  815
             L+ DGTLGPEK +HG P+ AKINFV+WS NG +L+FS+RV+EEENSSSKL +WVADVETG
Sbjct  120   LMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVDEEENSSSKLRIWVADVETG  179

Query  816   TARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSI  995
              ARPLFQS D++LNA+FDNFVWV+DSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQK++
Sbjct  180   KARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKNV  239

Query  996   IQVRTFQD  1019
             +QVRTFQD
Sbjct  240   VQVRTFQD  247



>ref|XP_004229392.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Solanum 
lycopersicum]
Length=977

 Score =   352 bits (903),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 191/251 (76%), Positives = 216/251 (86%), Gaps = 3/251 (1%)
 Frame = +3

Query  276   ASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEIRDIV  446
             ASSR  HLVP+ A+  EDGG  + +NGA  +    +YDDD   A    YRLPP EIRDIV
Sbjct  73    ASSRFHHLVPVNALTAEDGGNGTGSNGAADATASVAYDDDVESASATGYRLPPFEIRDIV  132

Query  447   DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  626
             DAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAGIRIDGKCNSRSRMSFYTGI 
Sbjct  133   DAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGIRIDGKCNSRSRMSFYTGIA  192

Query  627   IHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADV  806
             IHQL+EDG+LGPEK I GLP+ AKINFV WSNNG +LAFSVR++E++ SSSKL VWVA+V
Sbjct  193   IHQLMEDGSLGPEKEIQGLPKGAKINFVMWSNNGQHLAFSVRLDEDDGSSSKLRVWVANV  252

Query  807   ETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  986
             +TG ARPLF+S DVY+NA+FDNFVWVNDSTLLVCTIPLSRGDPP+KPLVPSGPK+QSNEQ
Sbjct  253   DTGKARPLFESPDVYVNAVFDNFVWVNDSTLLVCTIPLSRGDPPRKPLVPSGPKIQSNEQ  312

Query  987   KSIIQVRTFQD  1019
             K++IQ RT+QD
Sbjct  313   KNVIQARTYQD  323



>ref|XP_010652242.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Vitis vinifera]
Length=962

 Score =   352 bits (902),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 184/251 (73%), Positives = 216/251 (86%), Gaps = 2/251 (1%)
 Frame = +3

Query  267   AMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIV  446
             A  +SSR  HLVP+ A   E   G  +     ++A+   +++ ALG+ YRLPPPEI+DIV
Sbjct  57    AAMSSSRFLHLVPINAAAAEGDTGVGSNGSVSSTAED--EENSALGSGYRLPPPEIKDIV  114

Query  447   DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  626
             DAPP+PALSFSPQRDKILFLKRR+LPPL +LA+PE KLAGIRIDGKCN+RSRMSFYT IG
Sbjct  115   DAPPLPALSFSPQRDKILFLKRRALPPLEELAKPEEKLAGIRIDGKCNTRSRMSFYTSIG  174

Query  627   IHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADV  806
             IHQL+ DGTLGPEK +HG P+ AKINFV+WS NG +L+FS+RV+EEENSSSKL +WVADV
Sbjct  175   IHQLMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVDEEENSSSKLRIWVADV  234

Query  807   ETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  986
             ETG ARPLFQS D++LNA+FDNFVWV+DSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ
Sbjct  235   ETGKARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  294

Query  987   KSIIQVRTFQD  1019
             K+++QVRTFQD
Sbjct  295   KNVVQVRTFQD  305



>ref|XP_010652241.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Vitis vinifera]
Length=963

 Score =   351 bits (901),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 184/251 (73%), Positives = 216/251 (86%), Gaps = 2/251 (1%)
 Frame = +3

Query  267   AMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIV  446
             A  +SSR  HLVP+ A   E   G  +     ++A+   +++ ALG+ YRLPPPEI+DIV
Sbjct  57    AAMSSSRFLHLVPINAAAAEGDTGVGSNGSVSSTAED--EENSALGSGYRLPPPEIKDIV  114

Query  447   DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  626
             DAPP+PALSFSPQRDKILFLKRR+LPPL +LA+PE KLAGIRIDGKCN+RSRMSFYT IG
Sbjct  115   DAPPLPALSFSPQRDKILFLKRRALPPLEELAKPEEKLAGIRIDGKCNTRSRMSFYTSIG  174

Query  627   IHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADV  806
             IHQL+ DGTLGPEK +HG P+ AKINFV+WS NG +L+FS+RV+EEENSSSKL +WVADV
Sbjct  175   IHQLMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVDEEENSSSKLRIWVADV  234

Query  807   ETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  986
             ETG ARPLFQS D++LNA+FDNFVWV+DSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ
Sbjct  235   ETGKARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  294

Query  987   KSIIQVRTFQD  1019
             K+++QVRTFQD
Sbjct  295   KNVVQVRTFQD  305



>ref|XP_009604951.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=964

 Score =   350 bits (897),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 221/255 (87%), Gaps = 4/255 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEI  434
             SAM ASSR  H+VP+ A+ +EDGG  S +NGA  +    +YDDD   A    YRLPP EI
Sbjct  57    SAM-ASSRFHHVVPVNALASEDGGNGSGSNGAANATASVAYDDDLESASDTGYRLPPSEI  115

Query  435   RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  614
             RDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAG+RIDGKCN+RSRMSFY
Sbjct  116   RDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGVRIDGKCNTRSRMSFY  175

Query  615   TGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVW  794
             TGIGIHQL+EDG+LGPEK I  LPE AKINF+TWSNNG +LAF+VR++E++ SSSKL VW
Sbjct  176   TGIGIHQLMEDGSLGPEKEIQYLPEGAKINFLTWSNNGQHLAFTVRLDEDDGSSSKLRVW  235

Query  795   VADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQ  974
             VA+V+TG ARPLF+S D+Y+NA+FDNFVWVNDSTLLVCTIPLSRGDPP+KPLVPSGPK+Q
Sbjct  236   VANVDTGKARPLFESPDIYVNAVFDNFVWVNDSTLLVCTIPLSRGDPPRKPLVPSGPKIQ  295

Query  975   SNEQKSIIQVRTFQD  1019
             SNEQK++IQ RT+QD
Sbjct  296   SNEQKNVIQSRTYQD  310



>ref|XP_012082895.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Jatropha curcas]
 ref|XP_012082896.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Jatropha curcas]
 gb|KDP28258.1| hypothetical protein JCGZ_14029 [Jatropha curcas]
Length=961

 Score =   349 bits (895),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 216/248 (87%), Gaps = 2/248 (1%)
 Frame = +3

Query  276   ASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAP  455
             A+SR  +LVP TA   EDGGG S  +   ++   + +DDEAL  +YRLPPPEI+DIVDAP
Sbjct  59    ANSRLGNLVPTTAFAAEDGGGGSNGSVNSSNN--TAEDDEALEGKYRLPPPEIKDIVDAP  116

Query  456   PVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQ  635
             P+PALSFSPQRDKILFLKRR+LPPL++L+RPE KLAG RIDGKCN+RSRMSFYTGIGIHQ
Sbjct  117   PLPALSFSPQRDKILFLKRRALPPLAELSRPEEKLAGTRIDGKCNTRSRMSFYTGIGIHQ  176

Query  636   LLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETG  815
             LL DGTLGPEK ++G P+ AKINFVTWS +G +L+FS+RV+EE++ SSKL VWVADVETG
Sbjct  177   LLPDGTLGPEKEVYGFPDGAKINFVTWSLDGSHLSFSIRVDEEDDGSSKLRVWVADVETG  236

Query  816   TARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSI  995
              ARPLFQS DVYLNA+FDNFVWVNDS+LLVCTIP SRGDPPKKPLVPSGPK+QSNE K++
Sbjct  237   KARPLFQSQDVYLNAVFDNFVWVNDSSLLVCTIPSSRGDPPKKPLVPSGPKIQSNEMKNV  296

Query  996   IQVRTFQD  1019
             IQVRTFQD
Sbjct  297   IQVRTFQD  304



>ref|XP_009604950.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=976

 Score =   349 bits (895),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 221/255 (87%), Gaps = 4/255 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEI  434
             SAM ASSR  H+VP+ A+ +EDGG  S +NGA  +    +YDDD   A    YRLPP EI
Sbjct  57    SAM-ASSRFHHVVPVNALASEDGGNGSGSNGAANATASVAYDDDLESASDTGYRLPPSEI  115

Query  435   RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  614
             RDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAG+RIDGKCN+RSRMSFY
Sbjct  116   RDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGVRIDGKCNTRSRMSFY  175

Query  615   TGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVW  794
             TGIGIHQL+EDG+LGPEK I  LPE AKINF+TWSNNG +LAF+VR++E++ SSSKL VW
Sbjct  176   TGIGIHQLMEDGSLGPEKEIQYLPEGAKINFLTWSNNGQHLAFTVRLDEDDGSSSKLRVW  235

Query  795   VADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQ  974
             VA+V+TG ARPLF+S D+Y+NA+FDNFVWVNDSTLLVCTIPLSRGDPP+KPLVPSGPK+Q
Sbjct  236   VANVDTGKARPLFESPDIYVNAVFDNFVWVNDSTLLVCTIPLSRGDPPRKPLVPSGPKIQ  295

Query  975   SNEQKSIIQVRTFQD  1019
             SNEQK++IQ RT+QD
Sbjct  296   SNEQKNVIQSRTYQD  310



>gb|KJB49822.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=964

 Score =   346 bits (888),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 192/302 (64%), Positives = 227/302 (75%), Gaps = 1/302 (0%)
 Frame = +3

Query  114   KVVSFHHRFSLLASLCPLLPHSFkpifpsslpilssprkslpsirHLSGISAMPASSRSP  293
             ++   +HR S  +S C  L H F               + L +        AM AS R  
Sbjct  3     RLYKVYHRLSPFSSSCCCLLHPFSLGNARFPSSTLRSFRHLRTHSTNLFKPAMSAS-RFN  61

Query  294   HLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPPVPALS  473
              LVP+ +   EDG  A   +   +      DD+  +G +YR+PPPEIRDIVDAPP+PALS
Sbjct  62    RLVPVNSALAEDGSAAGNGSANASLTFAEDDDESVIGVKYRVPPPEIRDIVDAPPLPALS  121

Query  474   FSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGT  653
             FSP RDKILF+KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH L+ DG+
Sbjct  122   FSPLRDKILFMKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHSLMPDGS  181

Query  654   LGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGTARPLF  833
             LGPE  + GLP+ AKINFVTWSN+G +LAFSVR EEEE+SSSKL VWVADVETG ARPLF
Sbjct  182   LGPETEVRGLPDGAKINFVTWSNDGKHLAFSVRFEEEESSSSKLRVWVADVETGMARPLF  241

Query  834   QSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTF  1013
             QS D+YLNA+FDN+VWV++STLLVCTIPLSRGDPPKKPLVPSGPK+QSNEQK+I+QVRTF
Sbjct  242   QSPDIYLNAVFDNYVWVDNSTLLVCTIPLSRGDPPKKPLVPSGPKIQSNEQKTIVQVRTF  301

Query  1014  QD  1019
             QD
Sbjct  302   QD  303



>gb|KJB49821.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=961

 Score =   346 bits (888),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 228/304 (75%), Gaps = 1/304 (0%)
 Frame = +3

Query  108   IHKVVSFHHRFSLLASLCPLLPHSFkpifpsslpilssprkslpsirHLSGISAMPASSR  287
             + ++   +HR S  +S C  L H F               + L +        AM AS R
Sbjct  1     MMRLYKVYHRLSPFSSSCCCLLHPFSLGNARFPSSTLRSFRHLRTHSTNLFKPAMSAS-R  59

Query  288   SPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPPVPA  467
                LVP+ +   EDG  A   +   +      DD+  +G +YR+PPPEIRDIVDAPP+PA
Sbjct  60    FNRLVPVNSALAEDGSAAGNGSANASLTFAEDDDESVIGVKYRVPPPEIRDIVDAPPLPA  119

Query  468   LSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQLLED  647
             LSFSP RDKILF+KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH L+ D
Sbjct  120   LSFSPLRDKILFMKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHSLMPD  179

Query  648   GTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGTARP  827
             G+LGPE  + GLP+ AKINFVTWSN+G +LAFSVR EEEE+SSSKL VWVADVETG ARP
Sbjct  180   GSLGPETEVRGLPDGAKINFVTWSNDGKHLAFSVRFEEEESSSSKLRVWVADVETGMARP  239

Query  828   LFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVR  1007
             LFQS D+YLNA+FDN+VWV++STLLVCTIPLSRGDPPKKPLVPSGPK+QSNEQK+I+QVR
Sbjct  240   LFQSPDIYLNAVFDNYVWVDNSTLLVCTIPLSRGDPPKKPLVPSGPKIQSNEQKTIVQVR  299

Query  1008  TFQD  1019
             TFQD
Sbjct  300   TFQD  303



>gb|KJB49820.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=962

 Score =   346 bits (888),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 228/304 (75%), Gaps = 1/304 (0%)
 Frame = +3

Query  108   IHKVVSFHHRFSLLASLCPLLPHSFkpifpsslpilssprkslpsirHLSGISAMPASSR  287
             + ++   +HR S  +S C  L H F               + L +        AM AS R
Sbjct  1     MMRLYKVYHRLSPFSSSCCCLLHPFSLGNARFPSSTLRSFRHLRTHSTNLFKPAMSAS-R  59

Query  288   SPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPPVPA  467
                LVP+ +   EDG  A   +   +      DD+  +G +YR+PPPEIRDIVDAPP+PA
Sbjct  60    FNRLVPVNSALAEDGSAAGNGSANASLTFAEDDDESVIGVKYRVPPPEIRDIVDAPPLPA  119

Query  468   LSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQLLED  647
             LSFSP RDKILF+KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH L+ D
Sbjct  120   LSFSPLRDKILFMKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHSLMPD  179

Query  648   GTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGTARP  827
             G+LGPE  + GLP+ AKINFVTWSN+G +LAFSVR EEEE+SSSKL VWVADVETG ARP
Sbjct  180   GSLGPETEVRGLPDGAKINFVTWSNDGKHLAFSVRFEEEESSSSKLRVWVADVETGMARP  239

Query  828   LFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVR  1007
             LFQS D+YLNA+FDN+VWV++STLLVCTIPLSRGDPPKKPLVPSGPK+QSNEQK+I+QVR
Sbjct  240   LFQSPDIYLNAVFDNYVWVDNSTLLVCTIPLSRGDPPKKPLVPSGPKIQSNEQKTIVQVR  299

Query  1008  TFQD  1019
             TFQD
Sbjct  300   TFQD  303



>ref|XP_004494424.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=960

 Score =   346 bits (887),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 209/252 (83%), Gaps = 4/252 (2%)
 Frame = +3

Query  276   ASSRSPHLVPLTAV----gnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             ++SR  HL PL AV            S ++ + A +   Y+DD ALG  YR+PPPEIRDI
Sbjct  50    STSRFHHLAPLAAVPAENSAGGTSNGSVSSYSTADSSTDYEDDSALGVGYRVPPPEIRDI  109

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPPVPALSFSP RDKI+FLKRRSLPPL++LARPE KLAG+RIDG CNSRSRMSFYTG+
Sbjct  110   VDAPPVPALSFSPHRDKIIFLKRRSLPPLTELARPEEKLAGLRIDGYCNSRSRMSFYTGL  169

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQ+L DGTLGPE  IHG PE AKINFVTWS +  +L+FS+RV EE+N+SSKL VWVAD
Sbjct  170   GIHQILPDGTLGPEVEIHGFPEGAKINFVTWSPDARHLSFSIRVNEEDNNSSKLRVWVAD  229

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             VETG ARPLFQS DV+LNA+FDN+VWV++STLLVCTIPLSRG PPKKPLVP GPK+QSNE
Sbjct  230   VETGKARPLFQSPDVHLNAVFDNYVWVDNSTLLVCTIPLSRGAPPKKPLVPGGPKIQSNE  289

Query  984   QKSIIQVRTFQD  1019
             QK+I+QVRTFQD
Sbjct  290   QKNIVQVRTFQD  301



>ref|XP_009774673.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=964

 Score =   345 bits (886),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +3

Query  378   SYDDD--EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPE  551
             +YDDD   A    YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE
Sbjct  95    AYDDDLESASETGYRLPPREIRDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPE  154

Query  552   VKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGH  731
              KLAG+RIDGKCN+RSRMSFYTGIGIH L+EDG+LGPEK I GLPE A+INF+TWSNNG 
Sbjct  155   EKLAGVRIDGKCNTRSRMSFYTGIGIHHLMEDGSLGPEKEIQGLPEGARINFLTWSNNGQ  214

Query  732   YLAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCT  911
             +LAF+VR++E++ SSSKL VWVA+V+TG ARPLF+S D+Y+NA+FDNFVWVNDSTLLVCT
Sbjct  215   HLAFTVRLDEDDGSSSKLRVWVANVDTGKARPLFESPDIYVNAVFDNFVWVNDSTLLVCT  274

Query  912   IPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             IPLSRGDPP+KPLVPSGPK+QSNEQK++IQ RT+QD
Sbjct  275   IPLSRGDPPRKPLVPSGPKIQSNEQKNVIQSRTYQD  310



>ref|XP_009774672.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=975

 Score =   345 bits (886),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 196/216 (91%), Gaps = 2/216 (1%)
 Frame = +3

Query  378   SYDDD--EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPE  551
             +YDDD   A    YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE
Sbjct  95    AYDDDLESASETGYRLPPREIRDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPE  154

Query  552   VKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGH  731
              KLAG+RIDGKCN+RSRMSFYTGIGIH L+EDG+LGPEK I GLPE A+INF+TWSNNG 
Sbjct  155   EKLAGVRIDGKCNTRSRMSFYTGIGIHHLMEDGSLGPEKEIQGLPEGARINFLTWSNNGQ  214

Query  732   YLAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCT  911
             +LAF+VR++E++ SSSKL VWVA+V+TG ARPLF+S D+Y+NA+FDNFVWVNDSTLLVCT
Sbjct  215   HLAFTVRLDEDDGSSSKLRVWVANVDTGKARPLFESPDIYVNAVFDNFVWVNDSTLLVCT  274

Query  912   IPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             IPLSRGDPP+KPLVPSGPK+QSNEQK++IQ RT+QD
Sbjct  275   IPLSRGDPPRKPLVPSGPKIQSNEQKNVIQSRTYQD  310



>ref|XP_011041183.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Populus euphratica]
Length=958

 Score =   344 bits (882),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/247 (73%), Positives = 215/247 (87%), Gaps = 4/247 (2%)
 Frame = +3

Query  279   SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  458
             +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  59    TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  114

Query  459   VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  638
             +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDG CN++SRMSFYTGIGIHQL
Sbjct  115   LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGLRIDGNCNTKSRMSFYTGIGIHQL  174

Query  639   LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGT  818
             + DG LGPE+ IHG P+ AKINFVTWS +G +LAFS+R +EE+NSSSKL VWVA+VETG 
Sbjct  175   MPDGILGPEREIHGYPDGAKINFVTWSLDGRHLAFSIRFDEEDNSSSKLRVWVANVETGQ  234

Query  819   ARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSII  998
             ARPLFQS DVYLNA+FDNFVWV++STLLVCTIP SRGDPPKKP VPSGPK+QSNEQK+++
Sbjct  235   ARPLFQSPDVYLNAVFDNFVWVDNSTLLVCTIPSSRGDPPKKPSVPSGPKIQSNEQKNVV  294

Query  999   QVRTFQD  1019
             QVRTFQD
Sbjct  295   QVRTFQD  301



>ref|XP_004494425.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=957

 Score =   342 bits (878),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 183/249 (73%), Positives = 208/249 (84%), Gaps = 1/249 (0%)
 Frame = +3

Query  276   ASSRSPHLVPLTAV-gnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDA  452
             ++SR  HL PL AV      GG S  + +  S   S  D EALG  YR+PPPEIRDIVDA
Sbjct  50    STSRFHHLAPLAAVPAENSAGGTSNGSVSSYSTADSSTDYEALGVGYRVPPPEIRDIVDA  109

Query  453   PPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIH  632
             PPVPALSFSP RDKI+FLKRRSLPPL++LARPE KLAG+RIDG CNSRSRMSFYTG+GIH
Sbjct  110   PPVPALSFSPHRDKIIFLKRRSLPPLTELARPEEKLAGLRIDGYCNSRSRMSFYTGLGIH  169

Query  633   QLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVET  812
             Q+L DGTLGPE  IHG PE AKINFVTWS +  +L+FS+RV EE+N+SSKL VWVADVET
Sbjct  170   QILPDGTLGPEVEIHGFPEGAKINFVTWSPDARHLSFSIRVNEEDNNSSKLRVWVADVET  229

Query  813   GTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKS  992
             G ARPLFQS DV+LNA+FDN+VWV++STLLVCTIPLSRG PPKKPLVP GPK+QSNEQK+
Sbjct  230   GKARPLFQSPDVHLNAVFDNYVWVDNSTLLVCTIPLSRGAPPKKPLVPGGPKIQSNEQKN  289

Query  993   IIQVRTFQD  1019
             I+QVRTFQD
Sbjct  290   IVQVRTFQD  298



>ref|XP_010069839.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Eucalyptus 
grandis]
Length=968

 Score =   343 bits (879),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+  ALG  YRLPPPEIRDIVDAPP+PALSFSPQRDKILFL+RR+LPPL++LARPE KLA
Sbjct  100   DEGSALGGAYRLPPPEIRDIVDAPPLPALSFSPQRDKILFLRRRALPPLAELARPEEKLA  159

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDGKCN+RSRMSFYTGIGIHQLL DG LGPEK +HG P+ AKINFVTWSN+G +L+F
Sbjct  160   GIRIDGKCNTRSRMSFYTGIGIHQLLPDGKLGPEKEVHGFPDGAKINFVTWSNDGRHLSF  219

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             S+R +EE+NSSSKL +WVADVETG ARPLF+S D+ LNA+FDNFVW+++STL+VCTIPL 
Sbjct  220   SIRFDEEDNSSSKLQLWVADVETGKARPLFESPDIRLNAVFDNFVWIDNSTLVVCTIPLG  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PP+KPLVP GPK+QSNEQKS+IQVRTFQD
Sbjct  280   RGEPPRKPLVPGGPKIQSNEQKSVIQVRTFQD  311



>gb|KCW58331.1| hypothetical protein EUGRSUZ_H01015 [Eucalyptus grandis]
Length=967

 Score =   342 bits (878),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+  ALG  YRLPPPEIRDIVDAPP+PALSFSPQRDKILFL+RR+LPPL++LARPE KLA
Sbjct  99    DEGSALGGAYRLPPPEIRDIVDAPPLPALSFSPQRDKILFLRRRALPPLAELARPEEKLA  158

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDGKCN+RSRMSFYTGIGIHQLL DG LGPEK +HG P+ AKINFVTWSN+G +L+F
Sbjct  159   GIRIDGKCNTRSRMSFYTGIGIHQLLPDGKLGPEKEVHGFPDGAKINFVTWSNDGRHLSF  218

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             S+R +EE+NSSSKL +WVADVETG ARPLF+S D+ LNA+FDNFVW+++STL+VCTIPL 
Sbjct  219   SIRFDEEDNSSSKLQLWVADVETGKARPLFESPDIRLNAVFDNFVWIDNSTLVVCTIPLG  278

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PP+KPLVP GPK+QSNEQKS+IQVRTFQD
Sbjct  279   RGEPPRKPLVPGGPKIQSNEQKSVIQVRTFQD  310



>gb|KCW58332.1| hypothetical protein EUGRSUZ_H01015 [Eucalyptus grandis]
Length=971

 Score =   342 bits (878),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+  ALG  YRLPPPEIRDIVDAPP+PALSFSPQRDKILFL+RR+LPPL++LARPE KLA
Sbjct  99    DEGSALGGAYRLPPPEIRDIVDAPPLPALSFSPQRDKILFLRRRALPPLAELARPEEKLA  158

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDGKCN+RSRMSFYTGIGIHQLL DG LGPEK +HG P+ AKINFVTWSN+G +L+F
Sbjct  159   GIRIDGKCNTRSRMSFYTGIGIHQLLPDGKLGPEKEVHGFPDGAKINFVTWSNDGRHLSF  218

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             S+R +EE+NSSSKL +WVADVETG ARPLF+S D+ LNA+FDNFVW+++STL+VCTIPL 
Sbjct  219   SIRFDEEDNSSSKLQLWVADVETGKARPLFESPDIRLNAVFDNFVWIDNSTLVVCTIPLG  278

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PP+KPLVP GPK+QSNEQKS+IQVRTFQD
Sbjct  279   RGEPPRKPLVPGGPKIQSNEQKSVIQVRTFQD  310



>ref|XP_007051106.1| Prolyl oligopeptidase family protein [Theobroma cacao]
 gb|EOX95263.1| Prolyl oligopeptidase family protein [Theobroma cacao]
Length=974

 Score =   342 bits (878),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/216 (78%), Positives = 193/216 (89%), Gaps = 4/216 (2%)
 Frame = +3

Query  384   DDDE--ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVK  557
             +DDE  A+G +YRLPPPEIRDIVDAPP+PALSFSP RDKILFLKRRSLPPL++L RPE K
Sbjct  102   EDDENVAIGVKYRLPPPEIRDIVDAPPLPALSFSPLRDKILFLKRRSLPPLAELGRPEEK  161

Query  558   LAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYL  737
             LAGIRIDGKCN+RSRMSFYTGIGIHQL+ DG+LGPEK + G P+ AKINFVTWSN+G +L
Sbjct  162   LAGIRIDGKCNTRSRMSFYTGIGIHQLMPDGSLGPEKEVQGFPDGAKINFVTWSNDGQHL  221

Query  738   AFs--vrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCT  911
             AFS  V  E+  ++S KL VWVADVETG ARPLFQS D+YLNA+FDN++WV++STLLVCT
Sbjct  222   AFSVRVEEEDSSSNSGKLRVWVADVETGMARPLFQSPDIYLNAVFDNYIWVDNSTLLVCT  281

Query  912   IPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             IPLSRGDP KKPLVPSGPK+QSNEQK++IQVRTFQD
Sbjct  282   IPLSRGDPSKKPLVPSGPKIQSNEQKNVIQVRTFQD  317



>ref|XP_007200322.1| hypothetical protein PRUPE_ppa000899mg [Prunus persica]
 gb|EMJ01521.1| hypothetical protein PRUPE_ppa000899mg [Prunus persica]
Length=967

 Score =   342 bits (876),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 217/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSY---DDDEALGNQYRLPPPEI  434
             +A+ A+SR  +LVP+ AV +EDG G ++     ++A  +    ++D  LG +YRLPP EI
Sbjct  55    TAVMATSRLRNLVPVNAVASEDGSGGASNGSVASTAATTALEDEEDSTLGVRYRLPPQEI  114

Query  435   RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  614
             +DIVDAPP+PALSFSP RDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+R+RMSFY
Sbjct  115   KDIVDAPPLPALSFSPHRDKILFLKRRSLPPLAELARPEEKLAGVRIDGKCNTRTRMSFY  174

Query  615   TGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVW  794
             TGIGIHQLL DGTLGPE  +HG P+ AKINFVTWS +G +LAF++R +EEE++SSKL VW
Sbjct  175   TGIGIHQLLPDGTLGPEIEVHGFPDGAKINFVTWSPDGRHLAFTIRFDEEESTSSKLKVW  234

Query  795   VADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQ  974
             VA VETG ARPLF+S +++LNA+FDNFVWVNDS+LLVCTIPLSRGDPPKKP VP GPK+Q
Sbjct  235   VAQVETGIARPLFKSDEIFLNAVFDNFVWVNDSSLLVCTIPLSRGDPPKKPWVPFGPKIQ  294

Query  975   SNEQKSIIQVRTFQD  1019
             SNEQKSIIQVRTFQD
Sbjct  295   SNEQKSIIQVRTFQD  309



>gb|KHG24720.1| putative glutamyl endopeptidase, chloroplastic -like protein 
[Gossypium arboreum]
Length=896

 Score =   339 bits (870),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 192/307 (63%), Positives = 224/307 (73%), Gaps = 11/307 (4%)
 Frame = +3

Query  114   KVVSFHHRFSLLASLCPLLPHSFkpifpsslpilssprkslpsirHLSGISA---MPASS  284
             ++   HHR    +S C  L H F               +      HL   S     PA S
Sbjct  3     RLYKVHHRLPHFSSSCCCLLHPFSLGNARFPSSTLRSFR------HLRTDSTNLFKPAMS  56

Query  285   --RSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  458
               R   LVP+ +   EDG  A   +   +      DD+  +G +YR+PPPEIRDIVDAPP
Sbjct  57    AFRFNRLVPVNSSLAEDGSTAGNGSANASLTFAEDDDESVIGVKYRVPPPEIRDIVDAPP  116

Query  459   VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  638
             +PALSFSP RDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH L
Sbjct  117   LPALSFSPLRDKILFLKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHPL  176

Query  639   LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGT  818
             + DG+LGPE  + GLP+  KINFVTWSN+G +L FSVR EEEE+SSSKL VWVADVETG 
Sbjct  177   MPDGSLGPETEVSGLPDGVKINFVTWSNDGKHLTFSVRFEEEESSSSKLRVWVADVETGM  236

Query  819   ARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSII  998
             ARPLFQS D+YLNA+FDN+VWV++STLLVCTIPLSRGDPPKKPLVPSGPK+QSNEQK+I+
Sbjct  237   ARPLFQSPDIYLNAVFDNYVWVDNSTLLVCTIPLSRGDPPKKPLVPSGPKIQSNEQKTIV  296

Query  999   QVRTFQD  1019
             QVRTFQD
Sbjct  297   QVRTFQD  303



>gb|KEH24433.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=867

 Score =   338 bits (867),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  276   ASSRSPHLVPLTAVgnedgggasaangavasadPS----YDDDEALGNQYRLPPPEIRDI  443
             ++SR  H+VPL AV  EDG G +      +S+       Y+DD ALG  Y +PPPEIRDI
Sbjct  52    STSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEDDLALGVGYCVPPPEIRDI  111

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFYTG+
Sbjct  112   VDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFYTGL  171

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIH++L DGTLGPE  IHG PE AKINFVTWS +  +L+FS+RV EE++++SKL+VWVAD
Sbjct  172   GIHEILPDGTLGPEVEIHGFPEGAKINFVTWSPDARHLSFSIRVNEEDSNTSKLSVWVAD  231

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             VETG ARPLFQS DVYLNA+F+N+VWV++STLLVCTIP +RG PPKKPLVP GPK+QSNE
Sbjct  232   VETGKARPLFQSPDVYLNAVFENYVWVDNSTLLVCTIPSTRGAPPKKPLVPGGPKIQSNE  291

Query  984   QKSIIQVRTFQD  1019
             QK+IIQVRTFQD
Sbjct  292   QKNIIQVRTFQD  303



>ref|XP_008235148.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Prunus mume]
Length=966

 Score =   339 bits (869),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 216/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSY---DDDEALGNQYRLPPPEI  434
             +A+ A+SR  +LVP+ AV +EDG G ++     ++A  +    ++D  LG +YRLPP EI
Sbjct  55    TAVMATSRLRNLVPVNAVASEDGSGRASNGSVSSTAATTALEDEEDSTLGVRYRLPPQEI  114

Query  435   RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  614
             +DIVDAPP+PALSFSP RDKILFLKRRSLPPL+++ARPE KLAG+RIDGKCN+R+RMSFY
Sbjct  115   KDIVDAPPLPALSFSPHRDKILFLKRRSLPPLAEIARPEEKLAGVRIDGKCNTRTRMSFY  174

Query  615   TGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVW  794
             TGIGIHQLL DGTLGPE  +HG P+ AKINFVTWS +G  LAFS+R +EEE++SSKL VW
Sbjct  175   TGIGIHQLLPDGTLGPEIEVHGFPDGAKINFVTWSPDGRRLAFSIRFDEEESTSSKLKVW  234

Query  795   VADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQ  974
             VA VETG ARPLF+S +++LNA+FDNFVWVNDS+LLVCTIPLSRGDPPKKP VP GPK+Q
Sbjct  235   VAQVETGIARPLFKSDEIFLNAVFDNFVWVNDSSLLVCTIPLSRGDPPKKPWVPFGPKIQ  294

Query  975   SNEQKSIIQVRTFQD  1019
             SNEQKSIIQVRTFQD
Sbjct  295   SNEQKSIIQVRTFQD  309



>gb|KEH24432.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=962

 Score =   339 bits (869),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 212/255 (83%), Gaps = 4/255 (2%)
 Frame = +3

Query  267   AMPASSRSPHLVPLTAVgnedgggasaangavasadPS----YDDDEALGNQYRLPPPEI  434
             A  ++SR  H+VPL AV  EDG G +      +S+       Y+DD ALG  Y +PPPEI
Sbjct  49    ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEDDLALGVGYCVPPPEI  108

Query  435   RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  614
             RDIVDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFY
Sbjct  109   RDIVDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFY  168

Query  615   TGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVW  794
             TG+GIH++L DGTLGPE  IHG PE AKINFVTWS +  +L+FS+RV EE++++SKL+VW
Sbjct  169   TGLGIHEILPDGTLGPEVEIHGFPEGAKINFVTWSPDARHLSFSIRVNEEDSNTSKLSVW  228

Query  795   VADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQ  974
             VADVETG ARPLFQS DVYLNA+F+N+VWV++STLLVCTIP +RG PPKKPLVP GPK+Q
Sbjct  229   VADVETGKARPLFQSPDVYLNAVFENYVWVDNSTLLVCTIPSTRGAPPKKPLVPGGPKIQ  288

Query  975   SNEQKSIIQVRTFQD  1019
             SNEQK+IIQVRTFQD
Sbjct  289   SNEQKNIIQVRTFQD  303



>gb|KEH24431.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=959

 Score =   338 bits (868),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 212/252 (84%), Gaps = 1/252 (0%)
 Frame = +3

Query  267   AMPASSRSPHLVPLTAVgne-dgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             A  ++SR  H+VPL AV  E   GGA   + + +S   +Y D EALG  Y +PPPEIRDI
Sbjct  49    ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEALGVGYCVPPPEIRDI  108

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFYTG+
Sbjct  109   VDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFYTGL  168

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIH++L DGTLGPE  IHG PE AKINFVTWS +  +L+FS+RV EE++++SKL+VWVAD
Sbjct  169   GIHEILPDGTLGPEVEIHGFPEGAKINFVTWSPDARHLSFSIRVNEEDSNTSKLSVWVAD  228

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             VETG ARPLFQS DVYLNA+F+N+VWV++STLLVCTIP +RG PPKKPLVP GPK+QSNE
Sbjct  229   VETGKARPLFQSPDVYLNAVFENYVWVDNSTLLVCTIPSTRGAPPKKPLVPGGPKIQSNE  288

Query  984   QKSIIQVRTFQD  1019
             QK+IIQVRTFQD
Sbjct  289   QKNIIQVRTFQD  300



>ref|XP_003625970.1| Acylamino-acid-releasing enzyme [Medicago truncatula]
 gb|AES82188.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=962

 Score =   338 bits (868),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 212/255 (83%), Gaps = 4/255 (2%)
 Frame = +3

Query  267   AMPASSRSPHLVPLTAVgnedgggasaangavasadPS----YDDDEALGNQYRLPPPEI  434
             A  ++SR  H+VPL AV  EDG G +      +S+       Y+DD ALG  Y +PPPEI
Sbjct  49    ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEDDLALGVGYCVPPPEI  108

Query  435   RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  614
             RDIVDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFY
Sbjct  109   RDIVDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFY  168

Query  615   TGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVW  794
             TG+GIH++L DGTLGPE  IHG PE AKINFVTWS +  +L+FS+RV EE++++SKL+VW
Sbjct  169   TGLGIHEILPDGTLGPEVEIHGFPEGAKINFVTWSPDARHLSFSIRVNEEDSNTSKLSVW  228

Query  795   VADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQ  974
             VADVETG ARPLFQS DVYLNA+F+N+VWV++STLLVCTIP +RG PPKKPLVP GPK+Q
Sbjct  229   VADVETGKARPLFQSPDVYLNAVFENYVWVDNSTLLVCTIPSTRGAPPKKPLVPGGPKIQ  288

Query  975   SNEQKSIIQVRTFQD  1019
             SNEQK+IIQVRTFQD
Sbjct  289   SNEQKNIIQVRTFQD  303



>gb|KEH24430.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=959

 Score =   338 bits (868),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 212/252 (84%), Gaps = 1/252 (0%)
 Frame = +3

Query  267   AMPASSRSPHLVPLTAVgne-dgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             A  ++SR  H+VPL AV  E   GGA   + + +S   +Y D EALG  Y +PPPEIRDI
Sbjct  49    ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEALGVGYCVPPPEIRDI  108

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFYTG+
Sbjct  109   VDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFYTGL  168

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIH++L DGTLGPE  IHG PE AKINFVTWS +  +L+FS+RV EE++++SKL+VWVAD
Sbjct  169   GIHEILPDGTLGPEVEIHGFPEGAKINFVTWSPDARHLSFSIRVNEEDSNTSKLSVWVAD  228

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             VETG ARPLFQS DVYLNA+F+N+VWV++STLLVCTIP +RG PPKKPLVP GPK+QSNE
Sbjct  229   VETGKARPLFQSPDVYLNAVFENYVWVDNSTLLVCTIPSTRGAPPKKPLVPGGPKIQSNE  288

Query  984   QKSIIQVRTFQD  1019
             QK+IIQVRTFQD
Sbjct  289   QKNIIQVRTFQD  300



>ref|XP_008235149.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Prunus mume]
Length=966

 Score =   338 bits (868),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 216/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSY---DDDEALGNQYRLPPPEI  434
             +A+ A+SR  +LVP+ AV +EDG G ++     ++A  +    ++D  LG +YRLPP EI
Sbjct  55    TAVMATSRLRNLVPVNAVASEDGSGRASNGSVSSTAATTALEDEEDSTLGVRYRLPPQEI  114

Query  435   RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  614
             +DIVDAPP+PALSFSP RDKILFLKRRSLPPL+++ARPE KLAG+RIDGKCN+R+RMSFY
Sbjct  115   KDIVDAPPLPALSFSPHRDKILFLKRRSLPPLAEIARPEEKLAGVRIDGKCNTRTRMSFY  174

Query  615   TGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVW  794
             TGIGIHQLL DGTLGPE  +HG P+ AKINFVTWS +G  LAFS+R +EEE++SSKL VW
Sbjct  175   TGIGIHQLLPDGTLGPEIEVHGFPDGAKINFVTWSPDGRRLAFSIRFDEEESTSSKLKVW  234

Query  795   VADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQ  974
             VA VETG ARPLF+S +++LNA+FDNFVWVNDS+LLVCTIPLSRGDPPKKP VP GPK+Q
Sbjct  235   VAQVETGIARPLFKSDEIFLNAVFDNFVWVNDSSLLVCTIPLSRGDPPKKPWVPFGPKIQ  294

Query  975   SNEQKSIIQVRTFQD  1019
             SNEQKSIIQVRTFQD
Sbjct  295   SNEQKSIIQVRTFQD  309



>ref|XP_010259303.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010259304.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Nelumbo nucifera]
Length=963

 Score =   338 bits (867),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             +++ +LG+ YRLPP EI+DIVDAPP+PALSFSPQRDKILFLKRRSLPPL++LARPE KLA
Sbjct  96    EENASLGSGYRLPPTEIKDIVDAPPLPALSFSPQRDKILFLKRRSLPPLAELARPEEKLA  155

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDGKCNSRSRMSFYTGIGIHQLL+DG+LGPEK +HG P+ AKINFV+WS +G YL+F
Sbjct  156   GIRIDGKCNSRSRMSFYTGIGIHQLLQDGSLGPEKEVHGFPDGAKINFVSWSRDGRYLSF  215

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +EE++SSKL VWVADVETG A+PLFQS D++LNA+FDNFVWV+ STLLV TIPLS
Sbjct  216   -SIRIDEEDNSSKLRVWVADVETGIAKPLFQSPDIFLNAVFDNFVWVDGSTLLVFTIPLS  274

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPK+PLVPSGPK+QSNEQK+++QVRTFQD
Sbjct  275   RGDPPKRPLVPSGPKIQSNEQKNVVQVRTFQD  306



>gb|EYU46808.1| hypothetical protein MIMGU_mgv1a000875mg [Erythranthe guttata]
Length=953

 Score =   338 bits (866),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +3

Query  387   DDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAG  566
             +D +L N Y LPPPEIRDIVDAPP+P LSFSP RDKILFLKRRSLPPL+DLARPE KLAG
Sbjct  89    EDASLENGYCLPPPEIRDIVDAPPLPTLSFSPHRDKILFLKRRSLPPLADLARPEEKLAG  148

Query  567   IRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFs  746
             +RIDGKCNSRSRMS+YTGIG+HQL+ DGTLGPEK IH LP  AKINF+TWS++G +LAFS
Sbjct  149   VRIDGKCNSRSRMSYYTGIGVHQLMNDGTLGPEKEIHNLPTGAKINFITWSSDGTHLAFS  208

Query  747   vrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSR  926
             VR +EE+ SSS L VWVAD+ETG ARPLFQ+TD++LNA+F+NFVWVN+STLLVCTIPLSR
Sbjct  209   VRTDEEDGSSSMLRVWVADIETGKARPLFQATDIFLNAVFENFVWVNNSTLLVCTIPLSR  268

Query  927   GDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             GDPPKK LVPSGPK+QSNEQK IIQ RT+QD
Sbjct  269   GDPPKKTLVPSGPKIQSNEQKEIIQSRTYQD  299



>ref|XP_010259302.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=964

 Score =   338 bits (867),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 193/212 (91%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             +++ +LG+ YRLPP EI+DIVDAPP+PALSFSPQRDKILFLKRRSLPPL++LARPE KLA
Sbjct  96    EENASLGSGYRLPPTEIKDIVDAPPLPALSFSPQRDKILFLKRRSLPPLAELARPEEKLA  155

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDGKCNSRSRMSFYTGIGIHQLL+DG+LGPEK +HG P+ AKINFV+WS +G YL+F
Sbjct  156   GIRIDGKCNSRSRMSFYTGIGIHQLLQDGSLGPEKEVHGFPDGAKINFVSWSRDGRYLSF  215

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +EE++SSKL VWVADVETG A+PLFQS D++LNA+FDNFVWV+ STLLV TIPLS
Sbjct  216   -SIRIDEEDNSSKLRVWVADVETGIAKPLFQSPDIFLNAVFDNFVWVDGSTLLVFTIPLS  274

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPK+PLVPSGPK+QSNEQK+++QVRTFQD
Sbjct  275   RGDPPKRPLVPSGPKIQSNEQKNVVQVRTFQD  306



>ref|XP_006375435.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|ERP53232.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=957

 Score =   337 bits (865),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 213/247 (86%), Gaps = 4/247 (2%)
 Frame = +3

Query  279   SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  458
             +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  58    TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  113

Query  459   VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  638
             +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIHQL
Sbjct  114   LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGMRIDGKCNTRSRMSFYTGIGIHQL  173

Query  639   LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGT  818
             + DG LGPE+ IHG P+ AKINFVTWS +G +LAFS+R +EE+NSSSKL VWVA+VETG 
Sbjct  174   MPDGILGPEREIHGYPDGAKINFVTWSLDGRHLAFSIRFDEEDNSSSKLRVWVANVETGQ  233

Query  819   ARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSII  998
             ARPLFQS +VYLNA+FD  VWV++STLLVC IP SRGD PKKPLVPSGPK+QSNEQK++I
Sbjct  234   ARPLFQSPNVYLNAVFDTVVWVDNSTLLVCAIPSSRGDLPKKPLVPSGPKIQSNEQKNVI  293

Query  999   QVRTFQD  1019
             QVRTFQD
Sbjct  294   QVRTFQD  300



>ref|XP_002320974.2| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|EEE99289.2| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=967

 Score =   337 bits (864),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 213/247 (86%), Gaps = 4/247 (2%)
 Frame = +3

Query  279   SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  458
             +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  58    TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  113

Query  459   VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  638
             +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIHQL
Sbjct  114   LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGMRIDGKCNTRSRMSFYTGIGIHQL  173

Query  639   LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGT  818
             + DG LGPE+ IHG P+ AKINFVTWS +G +LAFS+R +EE+NSSSKL VWVA+VETG 
Sbjct  174   MPDGILGPEREIHGYPDGAKINFVTWSLDGRHLAFSIRFDEEDNSSSKLRVWVANVETGQ  233

Query  819   ARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSII  998
             ARPLFQS +VYLNA+FD  VWV++STLLVC IP SRGD PKKPLVPSGPK+QSNEQK++I
Sbjct  234   ARPLFQSPNVYLNAVFDTVVWVDNSTLLVCAIPSSRGDLPKKPLVPSGPKIQSNEQKNVI  293

Query  999   QVRTFQD  1019
             QVRTFQD
Sbjct  294   QVRTFQD  300



>ref|XP_006375436.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|ERP53233.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=968

 Score =   337 bits (864),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 213/247 (86%), Gaps = 4/247 (2%)
 Frame = +3

Query  279   SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  458
             +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  58    TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  113

Query  459   VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  638
             +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIHQL
Sbjct  114   LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGMRIDGKCNTRSRMSFYTGIGIHQL  173

Query  639   LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGT  818
             + DG LGPE+ IHG P+ AKINFVTWS +G +LAFS+R +EE+NSSSKL VWVA+VETG 
Sbjct  174   MPDGILGPEREIHGYPDGAKINFVTWSLDGRHLAFSIRFDEEDNSSSKLRVWVANVETGQ  233

Query  819   ARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSII  998
             ARPLFQS +VYLNA+FD  VWV++STLLVC IP SRGD PKKPLVPSGPK+QSNEQK++I
Sbjct  234   ARPLFQSPNVYLNAVFDTVVWVDNSTLLVCAIPSSRGDLPKKPLVPSGPKIQSNEQKNVI  293

Query  999   QVRTFQD  1019
             QVRTFQD
Sbjct  294   QVRTFQD  300



>ref|XP_006444495.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 gb|ESR57735.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
Length=771

 Score =   332 bits (852),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50    TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106   VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQL  DG LG E  I G P+ AK+NFVTWS +G +LAFS+R++ E++SSSKL VWVAD
Sbjct  166   GIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVAD  225

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             V+TG ARPLFQS D+YLNAIFDNFVWVN+STLLVCTIPL RGDPPKKPLVP GPK+QSNE
Sbjct  226   VDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNE  285

Query  984   QKSIIQVRTFQD  1019
             ++ IIQVRTFQD
Sbjct  286   KRDIIQVRTFQD  297



>ref|XP_004135992.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Cucumis 
sativus]
 gb|KGN45015.1| hypothetical protein Csa_7G407680 [Cucumis sativus]
Length=970

 Score =   334 bits (857),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+D  LG  YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPL++LA+PE KLA
Sbjct  100   DEDSVLGVGYRLPPAEIRDIVDAPPLPLLSFSPYRDKILFLKRRSLPPLAELAKPEEKLA  159

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDG+CN RSR+SFYTGIGIHQL+ D +LGPEK + GLP  AKINFVTWS +G +LAF
Sbjct  160   GIRIDGQCNCRSRISFYTGIGIHQLMPDDSLGPEKEVRGLPNGAKINFVTWSPDGRHLAF  219

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             +VRV+E++ SSSKL VWVADVETG ARPLFQ+TD+Y+NA+FDNFVWVNDSTLLVCTIP S
Sbjct  220   TVRVDEDDGSSSKLRVWVADVETGEARPLFQNTDIYVNAVFDNFVWVNDSTLLVCTIPFS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPKVQSNEQK+IIQ RT+QD
Sbjct  280   RGDPPKKPLVPPGPKVQSNEQKNIIQARTYQD  311



>ref|XP_011042249.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Populus 
euphratica]
 ref|XP_011042250.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Populus 
euphratica]
Length=936

 Score =   333 bits (855),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 177/256 (69%), Positives = 215/256 (84%), Gaps = 5/256 (2%)
 Frame = +3

Query  252   LSGISAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPE  431
                IS MP   R  +LVP+ ++  E+ G  S A+ +  S   + ++++AL  +Y+LPPPE
Sbjct  42    FKSISTMPC--RLGNLVPVNSIAAENVGSRSNASVSSTS---TTEEEDALACKYQLPPPE  96

Query  432   IRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSF  611
             I+DIVDAPP+PALS SPQ+DKILFLKRRSLPPL++LARPE KLAG+RIDG CN++SRMSF
Sbjct  97    IKDIVDAPPLPALSLSPQKDKILFLKRRSLPPLAELARPEEKLAGLRIDGNCNTKSRMSF  156

Query  612   YTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTV  791
             YTGIGIHQL+ DG LGPE+ IHG P+ AKINFVTWS +G +LAFS+R +EE+NSSSKL V
Sbjct  157   YTGIGIHQLMPDGILGPEREIHGYPDGAKINFVTWSLDGRHLAFSIRFDEEDNSSSKLRV  216

Query  792   WVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKV  971
             WVA+VETG ARPLFQS DVYLNA+FDNFVWV++STLLVCTIP SRGDPPKKP VPSGPK+
Sbjct  217   WVANVETGQARPLFQSPDVYLNAVFDNFVWVDNSTLLVCTIPSSRGDPPKKPSVPSGPKI  276

Query  972   QSNEQKSIIQVRTFQD  1019
             QSNEQK+++QVRTFQD
Sbjct  277   QSNEQKNVVQVRTFQD  292



>ref|XP_008369043.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Malus domestica]
 ref|XP_008369044.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Malus domestica]
 ref|XP_008363721.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Malus domestica]
 ref|XP_008363722.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Malus domestica]
Length=971

 Score =   334 bits (857),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 240/313 (77%), Gaps = 15/313 (5%)
 Frame = +3

Query  108   IHKVVSFHHRFSLLASLCPLLPHS--FkpifpsslpilssprkslpsirHLSGI---SAM  272
             +HKV   +HR SLL SL P  PHS  FKP+  +S+   +  R        +S I   +A 
Sbjct  8     LHKV---YHRLSLL-SLTP--PHSLPFKPLHFTSVLSPAHLRTRRSPYDAVSSIRTSAAA  61

Query  273   PASSRSPHLVPLTAVgnedggg--asaangavasadPSYDDDE--ALGNQYRLPPPEIRD  440
              A+SR  +LVP+ AV +ED     A+  + +  +A  S DD+E   LG +YRLPP EI+D
Sbjct  62    MATSRLRNLVPVNAVASEDSNSGGATNGSVSSTAAATSLDDEEDATLGVRYRLPPQEIKD  121

Query  441   IVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTG  620
             IVDAPP+PALSFSP RDKILFLKRR+LPPL++LARPE KLAG+RIDGKCN+R+RMSFYTG
Sbjct  122   IVDAPPLPALSFSPHRDKILFLKRRALPPLAELARPEEKLAGVRIDGKCNTRTRMSFYTG  181

Query  621   IGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVA  800
             IGIHQLL DGTLGPE  + G P+ AKINFVTWS +G +LAF++R +E E+++SKL VWVA
Sbjct  182   IGIHQLLPDGTLGPEIEVRGFPDGAKINFVTWSPDGRHLAFTIRFDEGESTTSKLKVWVA  241

Query  801   DVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSN  980
              VETG A+PLF S +++LNA+FDNFVWVNDS+LLVCTIP SRGD PKKPLVP GPK+QSN
Sbjct  242   QVETGIAKPLFXSEEIFLNAVFDNFVWVNDSSLLVCTIPQSRGDXPKKPLVPFGPKIQSN  301

Query  981   EQKSIIQVRTFQD  1019
             EQKSIIQVRTFQD
Sbjct  302   EQKSIIQVRTFQD  314



>ref|XP_008369041.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Malus domestica]
Length=972

 Score =   334 bits (857),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 240/313 (77%), Gaps = 15/313 (5%)
 Frame = +3

Query  108   IHKVVSFHHRFSLLASLCPLLPHS--FkpifpsslpilssprkslpsirHLSGI---SAM  272
             +HKV   +HR SLL SL P  PHS  FKP+  +S+   +  R        +S I   +A 
Sbjct  8     LHKV---YHRLSLL-SLTP--PHSLPFKPLHFTSVLSPAHLRTRRSPYDAVSSIRTSAAA  61

Query  273   PASSRSPHLVPLTAVgnedggg--asaangavasadPSYDDDE--ALGNQYRLPPPEIRD  440
              A+SR  +LVP+ AV +ED     A+  + +  +A  S DD+E   LG +YRLPP EI+D
Sbjct  62    MATSRLRNLVPVNAVASEDSNSGGATNGSVSSTAAATSLDDEEDATLGVRYRLPPQEIKD  121

Query  441   IVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTG  620
             IVDAPP+PALSFSP RDKILFLKRR+LPPL++LARPE KLAG+RIDGKCN+R+RMSFYTG
Sbjct  122   IVDAPPLPALSFSPHRDKILFLKRRALPPLAELARPEEKLAGVRIDGKCNTRTRMSFYTG  181

Query  621   IGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVA  800
             IGIHQLL DGTLGPE  + G P+ AKINFVTWS +G +LAF++R +E E+++SKL VWVA
Sbjct  182   IGIHQLLPDGTLGPEIEVRGFPDGAKINFVTWSPDGRHLAFTIRFDEGESTTSKLKVWVA  241

Query  801   DVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSN  980
              VETG A+PLF S +++LNA+FDNFVWVNDS+LLVCTIP SRGD PKKPLVP GPK+QSN
Sbjct  242   QVETGIAKPLFXSEEIFLNAVFDNFVWVNDSSLLVCTIPQSRGDXPKKPLVPFGPKIQSN  301

Query  981   EQKSIIQVRTFQD  1019
             EQKSIIQVRTFQD
Sbjct  302   EQKSIIQVRTFQD  314



>ref|XP_006444496.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 ref|XP_006492337.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR57736.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 gb|KDO86996.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=953

 Score =   333 bits (855),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50    TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106   VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQL  DG LG E  I G P+ AK+NFVTWS +G +LAFS+R++ E++SSSKL VWVAD
Sbjct  166   GIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVAD  225

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             V+TG ARPLFQS D+YLNAIFDNFVWVN+STLLVCTIPL RGDPPKKPLVP GPK+QSNE
Sbjct  226   VDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNE  285

Query  984   QKSIIQVRTFQD  1019
             ++ IIQVRTFQD
Sbjct  286   KRDIIQVRTFQD  297



>gb|KDO86997.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=954

 Score =   333 bits (855),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50    TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106   VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQL  DG LG E  I G P+ AK+NFVTWS +G +LAFS+R++ E++SSSKL VWVAD
Sbjct  166   GIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVAD  225

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             V+TG ARPLFQS D+YLNAIFDNFVWVN+STLLVCTIPL RGDPPKKPLVP GPK+QSNE
Sbjct  226   VDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNE  285

Query  984   QKSIIQVRTFQD  1019
             ++ IIQVRTFQD
Sbjct  286   KRDIIQVRTFQD  297



>gb|KDO86995.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=958

 Score =   333 bits (855),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50    TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106   VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQL  DG LG E  I G P+ AK+NFVTWS +G +LAFS+R++ E++SSSKL VWVAD
Sbjct  166   GIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVAD  225

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             V+TG ARPLFQS D+YLNAIFDNFVWVN+STLLVCTIPL RGDPPKKPLVP GPK+QSNE
Sbjct  226   VDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNE  285

Query  984   QKSIIQVRTFQD  1019
             ++ IIQVRTFQD
Sbjct  286   KRDIIQVRTFQD  297



>ref|XP_006492336.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=969

 Score =   333 bits (855),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50    TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106   VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQL  DG LG E  I G P+ AK+NFVTWS +G +LAFS+R++ E++SSSKL VWVAD
Sbjct  166   GIHQLFPDGKLGQEIEIQGFPDGAKLNFVTWSQDGKHLAFSIRIDAEDSSSSKLRVWVAD  225

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             V+TG ARPLFQS D+YLNAIFDNFVWVN+STLLVCTIPL RGDPPKKPLVP GPK+QSNE
Sbjct  226   VDTGKARPLFQSPDIYLNAIFDNFVWVNNSTLLVCTIPLLRGDPPKKPLVPLGPKMQSNE  285

Query  984   QKSIIQVRTFQD  1019
             ++ IIQVRTFQD
Sbjct  286   KRDIIQVRTFQD  297



>ref|XP_008451481.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Cucumis 
melo]
Length=967

 Score =   333 bits (855),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+D  LG  YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LA+PE KLA
Sbjct  99    DEDSVLGVGYRLPPAEIRDIVDAPPLPILSFSPYRDKILFLKRRSLPPLSELAKPEEKLA  158

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDG+CN RSR+SFYTGIGIHQL+ D +LGPE  +HGLP+ AKINFVTWS +G +LAF
Sbjct  159   GIRIDGQCNCRSRISFYTGIGIHQLMPDDSLGPELEVHGLPDGAKINFVTWSPDGRHLAF  218

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             +VR++EE  SS KL VWVADVETG ARPLFQ+TD+Y+NA+F+NFVWVNDSTLLVCTIP S
Sbjct  219   TVRIDEEGGSSGKLRVWVADVETGKARPLFQNTDIYVNAVFNNFVWVNDSTLLVCTIPSS  278

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPKVQSNEQK+IIQ RT+QD
Sbjct  279   RGDPPKKPLVPRGPKVQSNEQKNIIQARTYQD  310



>emb|CDP17069.1| unnamed protein product [Coffea canephora]
Length=916

 Score =   332 bits (851),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 182/251 (73%), Positives = 211/251 (84%), Gaps = 8/251 (3%)
 Frame = +3

Query  270   MPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALG-NQYRLPPPEIRDIV  446
             MP SSR  +LVP+ AV  EDG  ++A++       P+  +++ LG N Y+ PPPEIRDIV
Sbjct  1     MP-SSRIHNLVPVNAVAVEDGAASNASDP------PASPENQDLGANGYQFPPPEIRDIV  53

Query  447   DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  626
             DAPP+PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCNSRSRMSFYTGIG
Sbjct  54    DAPPLPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGVRIDGKCNSRSRMSFYTGIG  113

Query  627   IHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADV  806
             IH L  DGTLGPEK I GLP  AKINFVTWS +G +L+FSVR +E+++S SKL VWVADV
Sbjct  114   IHLLNADGTLGPEKEITGLPHGAKINFVTWSKDGRHLSFSVRADEDDDSRSKLKVWVADV  173

Query  807   ETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  986
             ETG AR LF S DVY+NA+FDNFVWVN+STLLVCTIPLSRG+PPKK LVPSGPK+QSNEQ
Sbjct  174   ETGKARLLFHSPDVYVNAVFDNFVWVNNSTLLVCTIPLSRGEPPKKRLVPSGPKIQSNEQ  233

Query  987   KSIIQVRTFQD  1019
             K++IQ RTFQD
Sbjct  234   KNVIQTRTFQD  244



>ref|XP_011041192.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Populus euphratica]
Length=954

 Score =   333 bits (853),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 178/247 (72%), Positives = 212/247 (86%), Gaps = 8/247 (3%)
 Frame = +3

Query  279   SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  458
             +SR P+LVPL ++  E+ GG S  + + AS      +DE    +Y+LPPPEI++IVDAPP
Sbjct  59    TSRFPNLVPLNSIAAENVGGRSNDSVSSAST-----EDEG---KYQLPPPEIKNIVDAPP  110

Query  459   VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  638
             +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDG CN++SRMSFYTGIGIHQL
Sbjct  111   LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGLRIDGNCNTKSRMSFYTGIGIHQL  170

Query  639   LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGT  818
             + DG LGPE+ IHG P+ AKINFVTWS +G +LAFS+R +EE+NSSSKL VWVA+VETG 
Sbjct  171   MPDGILGPEREIHGYPDGAKINFVTWSLDGRHLAFSIRFDEEDNSSSKLRVWVANVETGQ  230

Query  819   ARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSII  998
             ARPLFQS DVYLNA+FDNFVWV++STLLVCTIP SRGDPPKKP VPSGPK+QSNEQK+++
Sbjct  231   ARPLFQSPDVYLNAVFDNFVWVDNSTLLVCTIPSSRGDPPKKPSVPSGPKIQSNEQKNVV  290

Query  999   QVRTFQD  1019
             QVRTFQD
Sbjct  291   QVRTFQD  297



>ref|XP_002301512.2| hypothetical protein POPTR_0002s19700g [Populus trichocarpa]
 gb|EEE80785.2| hypothetical protein POPTR_0002s19700g [Populus trichocarpa]
Length=952

 Score =   332 bits (852),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             AL  +Y+LPPPEI+DIVDAPP+PALS SPQ+DKILFLKRRSLPPL++LARPE KLAG+RI
Sbjct  85    ALACKYQLPPPEIKDIVDAPPLPALSLSPQKDKILFLKRRSLPPLAELARPEEKLAGLRI  144

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
             DGKCN++SRMSFYTGIGIHQL+ DGTLGPEK +HG P+ AKINFVTWS +G +LAFS+RV
Sbjct  145   DGKCNTKSRMSFYTGIGIHQLMPDGTLGPEKEVHGYPDGAKINFVTWSLDGRHLAFSIRV  204

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDP  935
              EE+NSSSKL VWVA++ETG ARPLFQS DVYLNA+FDNFVWV++S+LLVCTIP SRGDP
Sbjct  205   FEEDNSSSKLRVWVANMETGQARPLFQSPDVYLNAVFDNFVWVDNSSLLVCTIPSSRGDP  264

Query  936   PKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             PKKP VPSGPK+QSNEQK+++QVRTFQD
Sbjct  265   PKKPSVPSGPKIQSNEQKNVVQVRTFQD  292



>ref|XP_004300449.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=955

 Score =   330 bits (847),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 205/252 (81%), Gaps = 4/252 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             +AM A+SR  ++VPL AV  E+ G  S ++    +   S++D+E     YRLPP EI+DI
Sbjct  51    AAMSATSRLSNIVPLNAVVAENAGNGSVSSATATT---SFEDEEDSTMGYRLPPKEIKDI  107

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPP+PALSFSP RDKILFLKRR+LPPLS+LARPE KLAG+RIDGKCN+R+RMSFYTGI
Sbjct  108   VDAPPLPALSFSPHRDKILFLKRRALPPLSELARPEEKLAGVRIDGKCNTRTRMSFYTGI  167

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQLL DGTLG E  +HG PE AKINFVTWS +G +LAF     ++E++SSKL VWVA 
Sbjct  168   GIHQLLPDGTLGSEVEVHGFPEGAKINFVTWSPDGRHLAF-TIRFDDESTSSKLKVWVAK  226

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             VE+G ARPL +  D  LNA+FDNFVWVN+S+LLVCTIPLSRGDPPKKPLVP GPK+QSNE
Sbjct  227   VESGVARPLLELHDYCLNAVFDNFVWVNESSLLVCTIPLSRGDPPKKPLVPFGPKIQSNE  286

Query  984   QKSIIQVRTFQD  1019
             QK+IIQVRTFQD
Sbjct  287   QKNIIQVRTFQD  298



>gb|AAM20412.1| unknown protein [Arabidopsis thaliana]
Length=599

 Score =   322 bits (824),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVETG ARPLF S D++LNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PPKKPLVPSGPK  SNE K+++QVRTFQD
Sbjct  280   RGEPPKKPLVPSGPKTLSNETKTVVQVRTFQD  311



>ref|XP_011079552.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Sesamum 
indicum]
Length=955

 Score =   330 bits (846),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = +3

Query  387   DDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAG  566
             +D + GN Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPL++LARPE KLAG
Sbjct  89    EDSSSGNGYCLPPREIRDIVDAPPLPTLSFSPNRDKILFLKRRSLPPLAELARPEEKLAG  148

Query  567   IRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFs  746
             +RIDGKCNSRSRMS+YTGIGI+Q+++DGTLGPEK + GLP  AKINFVTWSN+G +LAFS
Sbjct  149   VRIDGKCNSRSRMSYYTGIGIYQIMDDGTLGPEKELSGLPSGAKINFVTWSNDGSHLAFS  208

Query  747   vrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSR  926
             VR +EE+  SS L VWVAD+E G ARPLF++ D++LNA+FDNFVWVN+STLLVCTIPLSR
Sbjct  209   VRTDEEDGRSSMLKVWVADIEAGQARPLFEAPDIFLNAVFDNFVWVNNSTLLVCTIPLSR  268

Query  927   GDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             G PPKKPLVPSGPK+QSNEQK IIQ RT+QD
Sbjct  269   GGPPKKPLVPSGPKIQSNEQKDIIQTRTYQD  299



>ref|XP_006293660.1| hypothetical protein CARUB_v10022616mg [Capsella rubella]
 gb|EOA26558.1| hypothetical protein CARUB_v10022616mg [Capsella rubella]
Length=875

 Score =   328 bits (842),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 184/212 (87%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVAD+ETG ARPLFQS D+YLNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPVVWVADIETGVARPLFQSQDIYLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPSGPK  SNE+K+++QVRTFQD
Sbjct  280   RGDPPKKPLVPSGPKTLSNEKKNVVQVRTFQD  311



>ref|XP_006397934.1| hypothetical protein EUTSA_v10001294mg [Eutrema salsugineum]
 gb|ESQ39387.1| hypothetical protein EUTSA_v10001294mg [Eutrema salsugineum]
Length=956

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 184/212 (87%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DDD ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDDLALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVETG ARPLF+S D+YLNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPIVWVADVETGEARPLFKSQDIYLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPSGPK  SNE+K+++QVRTFQD
Sbjct  280   RGDPPKKPLVPSGPKTLSNEKKNVVQVRTFQD  311



>ref|XP_009378724.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=971

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             ++D  LG +YRLPP EI+DIVDAPP+PALSFSP+RDKILFLKRR+LPPL++LARPE KLA
Sbjct  103   EEDATLGVRYRLPPQEIKDIVDAPPLPALSFSPRRDKILFLKRRALPPLAELARPEEKLA  162

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDGKCN+R+RMSFYTGIGIHQ L DGTLGPE  + G P+ AKINFVTWS +G +LAF
Sbjct  163   GVRIDGKCNTRTRMSFYTGIGIHQFLPDGTLGPEIEVRGFPDGAKINFVTWSPDGRHLAF  222

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             ++R +E E+++SKL VWVA VETG A+PLF+S +++LNA+FDNFVWVNDS+LLVCTIP S
Sbjct  223   TIRFDEGESTTSKLKVWVAQVETGIAKPLFKSEEIFLNAVFDNFVWVNDSSLLVCTIPQS  282

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGD PKKPLVP GPK+QSNEQKSIIQVRTFQD
Sbjct  283   RGDLPKKPLVPFGPKIQSNEQKSIIQVRTFQD  314



>ref|XP_011465337.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=954

 Score =   328 bits (842),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 205/252 (81%), Gaps = 5/252 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  443
             +AM A+SR  ++VPL AV  E+ G  S ++    ++    D+D  +G  YRLPP EI+DI
Sbjct  51    AAMSATSRLSNIVPLNAVVAENAGNGSVSSATATTSFE--DEDSTMG--YRLPPKEIKDI  106

Query  444   VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  623
             VDAPP+PALSFSP RDKILFLKRR+LPPLS+LARPE KLAG+RIDGKCN+R+RMSFYTGI
Sbjct  107   VDAPPLPALSFSPHRDKILFLKRRALPPLSELARPEEKLAGVRIDGKCNTRTRMSFYTGI  166

Query  624   GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVAD  803
             GIHQLL DGTLG E  +HG PE AKINFVTWS +G +LAF     ++E++SSKL VWVA 
Sbjct  167   GIHQLLPDGTLGSEVEVHGFPEGAKINFVTWSPDGRHLAF-TIRFDDESTSSKLKVWVAK  225

Query  804   VETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNE  983
             VE+G ARPL +  D  LNA+FDNFVWVN+S+LLVCTIPLSRGDPPKKPLVP GPK+QSNE
Sbjct  226   VESGVARPLLELHDYCLNAVFDNFVWVNESSLLVCTIPLSRGDPPKKPLVPFGPKIQSNE  285

Query  984   QKSIIQVRTFQD  1019
             QK+IIQVRTFQD
Sbjct  286   QKNIIQVRTFQD  297



>ref|XP_009378723.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=972

 Score =   328 bits (842),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             ++D  LG +YRLPP EI+DIVDAPP+PALSFSP+RDKILFLKRR+LPPL++LARPE KLA
Sbjct  103   EEDATLGVRYRLPPQEIKDIVDAPPLPALSFSPRRDKILFLKRRALPPLAELARPEEKLA  162

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDGKCN+R+RMSFYTGIGIHQ L DGTLGPE  + G P+ AKINFVTWS +G +LAF
Sbjct  163   GVRIDGKCNTRTRMSFYTGIGIHQFLPDGTLGPEIEVRGFPDGAKINFVTWSPDGRHLAF  222

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             ++R +E E+++SKL VWVA VETG A+PLF+S +++LNA+FDNFVWVNDS+LLVCTIP S
Sbjct  223   TIRFDEGESTTSKLKVWVAQVETGIAKPLFKSEEIFLNAVFDNFVWVNDSSLLVCTIPQS  282

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGD PKKPLVP GPK+QSNEQKSIIQVRTFQD
Sbjct  283   RGDLPKKPLVPFGPKIQSNEQKSIIQVRTFQD  314



>ref|XP_010544967.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=960

 Score =   328 bits (840),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 185/212 (87%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DDD A+GN+YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  103   DDDLAIGNEYRLPPSEIRDIVDAPPLPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  162

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDG+CN+RSRMS+YTGIGIHQL+ DGTLGPEK I G+P+  KINFVTWSN+  +LAF
Sbjct  163   GIRIDGQCNTRSRMSYYTGIGIHQLMADGTLGPEKEISGIPDGGKINFVTWSNDAKHLAF  222

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E   SSK  VWVA+VETG ARPLF S D+YLNAIF++FVW+++STLLV TIP S
Sbjct  223   -SVRVDENGISSKPRVWVANVETGEARPLFNSQDIYLNAIFESFVWIDNSTLLVSTIPSS  281

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPS PK+QSNE+K+I+QVRTFQD
Sbjct  282   RGDPPKKPLVPSSPKIQSNEKKNIVQVRTFQD  313



>ref|XP_010544966.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=961

 Score =   328 bits (840),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 185/212 (87%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DDD A+GN+YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  103   DDDLAIGNEYRLPPSEIRDIVDAPPLPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  162

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDG+CN+RSRMS+YTGIGIHQL+ DGTLGPEK I G+P+  KINFVTWSN+  +LAF
Sbjct  163   GIRIDGQCNTRSRMSYYTGIGIHQLMADGTLGPEKEISGIPDGGKINFVTWSNDAKHLAF  222

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E   SSK  VWVA+VETG ARPLF S D+YLNAIF++FVW+++STLLV TIP S
Sbjct  223   -SVRVDENGISSKPRVWVANVETGEARPLFNSQDIYLNAIFESFVWIDNSTLLVSTIPSS  281

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPS PK+QSNE+K+I+QVRTFQD
Sbjct  282   RGDPPKKPLVPSSPKIQSNEKKNIVQVRTFQD  313



>ref|XP_009414913.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X5 [Musa acuminata subsp. malaccensis]
Length=960

 Score =   326 bits (836),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 190/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDEALG-NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             +D+E+L    YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LARPE KL
Sbjct  97    EDEESLSLGGYRLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRSLPPLSELARPEEKL  156

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AGIRIDG  N+RSRMSFYTGIGIH L +DG LGPE+ +HG P+ AKINFV+WS +G +L+
Sbjct  157   AGIRIDGNYNARSRMSFYTGIGIHSLTDDGKLGPEQEVHGFPDGAKINFVSWSRDGRHLS  216

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS+RV+EEEN+SSKL VWVADVE+G ARPLFQS D++LNA+FDNFVWVNDS LLVCTIP+
Sbjct  217   FSIRVDEEENNSSKLRVWVADVESGKARPLFQSPDIFLNAVFDNFVWVNDSMLLVCTIPI  276

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRG PPKKPLVPSGPKVQSNEQK+++QVRTFQD
Sbjct  277   SRGAPPKKPLVPSGPKVQSNEQKNVVQVRTFQD  309



>ref|XP_010518437.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Camelina sativa]
Length=960

 Score =   326 bits (836),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 184/212 (87%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  100   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  159

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  160   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  219

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVAD+ETG ARPLF S D++LNAIF++FVW+++STLLV TIP S
Sbjct  220   -SIRVDENGNSSKPVVWVADIETGVARPLFNSQDIHLNAIFESFVWIDNSTLLVSTIPSS  278

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPSGPK  SNE+K+++QVRTFQD
Sbjct  279   RGDPPKKPLVPSGPKTLSNEKKNVVQVRTFQD  310



>ref|XP_002882118.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58377.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]
Length=962

 Score =   326 bits (836),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 183/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGHCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVETG ARPLF+S D+YLNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPVVWVADVETGLARPLFKSQDIYLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPSGPK  SNE K+++QVRTFQD
Sbjct  280   RGDPPKKPLVPSGPKTLSNETKTVVQVRTFQD  311



>ref|XP_010518438.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Camelina sativa]
Length=960

 Score =   326 bits (836),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 184/212 (87%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  100   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  159

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  160   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  219

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVAD+ETG ARPLF S D++LNAIF++FVW+++STLLV TIP S
Sbjct  220   -SIRVDEHGNSSKPVVWVADIETGVARPLFNSQDIHLNAIFESFVWIDNSTLLVSTIPSS  278

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPSGPK  SNE+K+++QVRTFQD
Sbjct  279   RGDPPKKPLVPSGPKTLSNEKKNVVQVRTFQD  310



>ref|XP_009142541.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Brassica rapa]
Length=945

 Score =   325 bits (833),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE+KLA
Sbjct  88    DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPELKLA  147

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  148   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  207

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E+ +SSK  VWVADVETG ARPLF+S D+YLNAIF++FVW+ DSTLLV TIP S
Sbjct  208   -SIRVDEDGNSSKPVVWVADVETGEARPLFKSEDIYLNAIFESFVWIGDSTLLVSTIPSS  266

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPK  SNE+  ++QVRTFQD
Sbjct  267   RGDPPKKPLVPPGPKTLSNEKSDVVQVRTFQD  298



>ref|XP_009142540.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Brassica rapa]
Length=946

 Score =   325 bits (833),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE+KLA
Sbjct  88    DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPELKLA  147

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  148   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  207

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E+ +SSK  VWVADVETG ARPLF+S D+YLNAIF++FVW+ DSTLLV TIP S
Sbjct  208   -SIRVDEDGNSSKPVVWVADVETGEARPLFKSEDIYLNAIFESFVWIGDSTLLVSTIPSS  266

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPK  SNE+  ++QVRTFQD
Sbjct  267   RGDPPKKPLVPPGPKTLSNEKSDVVQVRTFQD  298



>ref|XP_010507894.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Camelina 
sativa]
Length=959

 Score =   325 bits (833),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 185/212 (87%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  99    DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  158

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  159   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  218

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVAD++TG ARPLF+S D++LNAIF++FVW+++STLLV TIP S
Sbjct  219   -SIRVDENGNSSKPVVWVADIDTGVARPLFKSQDIHLNAIFESFVWIDNSTLLVSTIPSS  277

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPSGPK  SNE+K+++QVRTFQD
Sbjct  278   RGDPPKKPLVPSGPKTLSNEKKNVVQVRTFQD  309



>emb|CDY27492.1| BnaC04g51330D [Brassica napus]
Length=953

 Score =   324 bits (831),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 185/213 (87%), Gaps = 2/213 (1%)
 Frame = +3

Query  384   DDDE-ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             DDDE ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KL
Sbjct  91    DDDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEKKL  150

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWS++G +LA
Sbjct  151   AGVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSSDGKHLA  210

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             F     +E  +SSK  VWVADV+TG ARPLF+S DVYLNAIF++FVW++DSTLLV TIP 
Sbjct  211   F-SIRVDENGNSSKPIVWVADVDTGEARPLFKSQDVYLNAIFESFVWIDDSTLLVSTIPS  269

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRGDPPKKPLVPSGPK  SNE+++++QVRTFQD
Sbjct  270   SRGDPPKKPLVPSGPKTLSNEKQNVVQVRTFQD  302



>gb|KCW58330.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
Length=682

 Score =   318 bits (814),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+  ALG  YRLPPPEIRDIVDAPP P LS SPQ DKILFLKRR+LPPL++LARPE KLA
Sbjct  34    DEGSALGGTYRLPPPEIRDIVDAPPCPVLSLSPQGDKILFLKRRALPPLAELARPEEKLA  93

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID KC++RSR+S+YTG+GIHQL  D  LGPEK +HG P+ AKINFVTWSN+G +L+F
Sbjct  94    GIRIDVKCSTRSRISYYTGMGIHQLSPDDNLGPEKEVHGFPDGAKINFVTWSNDGRHLSF  153

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
              +R++EE+NSSSKL +WVADVETG ARPLF+S D+ LNA+FD FVW+++STL+VCTIPL 
Sbjct  154   CIRLDEEDNSSSKLQLWVADVETGKARPLFKSPDICLNAVFDKFVWIDNSTLVVCTIPLG  213

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPKVQSNEQK++IQV TFQD
Sbjct  214   RGDPPKKPLVPGGPKVQSNEQKNVIQVETFQD  245



>ref|XP_007163177.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
 gb|ESW35171.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
Length=951

 Score =   323 bits (828),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = +3

Query  381   YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             Y+D+  LG +YR+PPPEI  IVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  80    YEDESTLGTKYRVPPPEISKIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEKKL  139

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDGKCN+RSRMSFYTGIGIHQ+L DGTLGPE  +HG P+ AKINFV+WS +G +L+
Sbjct  140   AGVRIDGKCNTRSRMSFYTGIGIHQILPDGTLGPEIEVHGFPDGAKINFVSWSPDGCHLS  199

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS+RV EE+N SSKLTVW+ADV+TG AR LFQS +V+LNA+FDN+VWVN+ +LLVCTIP 
Sbjct  200   FSIRVNEEDNDSSKLTVWIADVKTGKARQLFQSPNVHLNAVFDNYVWVNNFSLLVCTIPS  259

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRG PP KPLVP+GPK+QSNE+K+IIQVRTFQD
Sbjct  260   SRGAPPNKPLVPAGPKIQSNEEKNIIQVRTFQD  292



>ref|XP_007163178.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
 gb|ESW35172.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
Length=953

 Score =   323 bits (828),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 190/213 (89%), Gaps = 0/213 (0%)
 Frame = +3

Query  381   YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             Y+D+  LG +YR+PPPEI  IVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  80    YEDESTLGTKYRVPPPEISKIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEKKL  139

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDGKCN+RSRMSFYTGIGIHQ+L DGTLGPE  +HG P+ AKINFV+WS +G +L+
Sbjct  140   AGVRIDGKCNTRSRMSFYTGIGIHQILPDGTLGPEIEVHGFPDGAKINFVSWSPDGCHLS  199

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS+RV EE+N SSKLTVW+ADV+TG AR LFQS +V+LNA+FDN+VWVN+ +LLVCTIP 
Sbjct  200   FSIRVNEEDNDSSKLTVWIADVKTGKARQLFQSPNVHLNAVFDNYVWVNNFSLLVCTIPS  259

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRG PP KPLVP+GPK+QSNE+K+IIQVRTFQD
Sbjct  260   SRGAPPNKPLVPAGPKIQSNEEKNIIQVRTFQD  292



>emb|CDX80100.1| BnaA05g00560D [Brassica napus]
Length=946

 Score =   323 bits (827),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE+KLA
Sbjct  88    DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPELKLA  147

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  148   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  207

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E+ +SSK  VWVADVETG ARPLF+S D+YLNAIF++FVW+ DSTLLV TIP S
Sbjct  208   -SIRIDEDGNSSKPVVWVADVETGEARPLFKSQDIYLNAIFESFVWIGDSTLLVSTIPSS  266

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPK  SNE+  ++Q+RTFQD
Sbjct  267   RGDPPKKPLVPPGPKTLSNEKSDVVQLRTFQD  298



>ref|XP_010087237.1| putative glutamyl endopeptidase [Morus notabilis]
 gb|EXB28587.1| putative glutamyl endopeptidase [Morus notabilis]
Length=1305

 Score =   327 bits (838),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 193/213 (91%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDE-ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             D+DE   G  YRLPPPEI+DIVDAPP+PALSFSP RDKILFLKRRSLPPL++LARPE KL
Sbjct  90    DEDELTAGVGYRLPPPEIKDIVDAPPLPALSFSPFRDKILFLKRRSLPPLAELARPEEKL  149

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AGIRIDGKCN+RSRMSFYTG+ IHQL+ DGTLGPE+ +HG P+ AKINFVTWS +G +L+
Sbjct  150   AGIRIDGKCNARSRMSFYTGVAIHQLMPDGTLGPEREVHGFPDGAKINFVTWSPDGRHLS  209

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FSVRV+EE+NSSSKL VWVADVETG ARPLF++ D+YLNA+FDN+VW+++STLLV TIPL
Sbjct  210   FSVRVDEEDNSSSKLRVWVADVETGKARPLFENPDIYLNAVFDNYVWLDNSTLLVSTIPL  269

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SR DPPKKP+VP GPK+QSNEQK+IIQVRTFQD
Sbjct  270   SRRDPPKKPIVPFGPKIQSNEQKNIIQVRTFQD  302



>gb|AAL57645.1| At2g47390/T8I13.23 [Arabidopsis thaliana]
 gb|AAO11566.1| At2g47390/T8I13.23 [Arabidopsis thaliana]
Length=960

 Score =   322 bits (826),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVETG ARPLF S D++LNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PPKKPLVPSGPK  SNE K+++QVRTFQD
Sbjct  280   RGEPPKKPLVPSGPKTLSNETKTVVQVRTFQD  311



>gb|AAB63841.1| unknown protein [Arabidopsis thaliana]
Length=955

 Score =   322 bits (826),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVETG ARPLF S D++LNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PPKKPLVPSGPK  SNE K+++QVRTFQD
Sbjct  280   RGEPPKKPLVPSGPKTLSNETKTVVQVRTFQD  311



>sp|Q8VZF3.2|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
Length=960

 Score =   322 bits (826),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVETG ARPLF S D++LNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PPKKPLVPSGPK  SNE K+++QVRTFQD
Sbjct  280   RGEPPKKPLVPSGPKTLSNETKTVVQVRTFQD  311



>ref|NP_850473.1| probable glutamyl endopeptidase [Arabidopsis thaliana]
 gb|AEC10835.1| probable glutamyl endopeptidase [Arabidopsis thaliana]
Length=961

 Score =   322 bits (826),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101   DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  161   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  220

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVETG ARPLF S D++LNAIF++FVW+++STLLV TIP S
Sbjct  221   -SIRVDENGNSSKPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSS  279

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PPKKPLVPSGPK  SNE K+++QVRTFQD
Sbjct  280   RGEPPKKPLVPSGPKTLSNETKTVVQVRTFQD  311



>ref|XP_008386780.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Malus domestica]
Length=969

 Score =   322 bits (825),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 210/256 (82%), Gaps = 4/256 (2%)
 Frame = +3

Query  264   SAMPASSRSPHLVPLTAVgnedggg--asaangavasadPSYDDDE--ALGNQYRLPPPE  431
             +A+ A+SR  +LVP   V +ED  G  AS  + +  +A  + DD+E   L  +YRLP  E
Sbjct  55    TAVMATSRLRNLVPANTVASEDASGGGASKGSVSSXAATTALDDEEDATLAVRYRLPXQE  114

Query  432   IRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSF  611
             I+DIVDAPP+PALSFSP RDKILFLKRR+LPPL++LARPE KLAG+RIDGKCN+R+RMSF
Sbjct  115   IKDIVDAPPLPALSFSPHRDKILFLKRRALPPLTELARPEEKLAGVRIDGKCNTRTRMSF  174

Query  612   YTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTV  791
             Y+G+GIHQLL DGTLGPE  + G  + AKINFVTWS +G +LAF++R +E E+S+SKL V
Sbjct  175   YSGVGIHQLLPDGTLGPEIEVRGFXDGAKINFVTWSPDGRHLAFTIRFDEGESSTSKLRV  234

Query  792   WVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKV  971
             WVA VETG ARPLF+S +++LNAIFDNFVWVNDS+LLVCTIP SRGDPPKKPLVP GPK+
Sbjct  235   WVAQVETGIARPLFKSEEIFLNAIFDNFVWVNDSSLLVCTIPQSRGDPPKKPLVPFGPKI  294

Query  972   QSNEQKSIIQVRTFQD  1019
             QSNEQK+ IQVRTFQD
Sbjct  295   QSNEQKNTIQVRTFQD  310



>ref|XP_010506775.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Camelina 
sativa]
Length=959

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 183/212 (86%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPP EIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  99    DDELALGTGYRLPPSEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  158

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  159   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  218

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVAD+ETG A PLF+S D++LNAIF++FVW+++STLLV TIP S
Sbjct  219   -SIRVDENGNSSKPVVWVADIETGVASPLFKSQDIHLNAIFESFVWIDNSTLLVSTIPSS  277

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVPSGPK  SNE+K+++QVRTFQD
Sbjct  278   RGDPPKKPLVPSGPKTLSNEKKNVVQVRTFQD  309



>ref|XP_008813383.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X5 [Phoenix dactylifera]
Length=972

 Score =   321 bits (823),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +3

Query  375   PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  554
             P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90    PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  555   KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHY  734
             KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG LGPE+ +HG P+ AKINFV+WS +G +
Sbjct  150   KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPEREVHGFPDGAKINFVSWSRDGQH  209

Query  735   LAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             L+F+VRV+EE+ SSSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVWVN STLLVC I
Sbjct  210   LSFTVRVDEEDGSSSKLRVWVADVESGKARPLFESPNIYLNAIFDSFVWVNASTLLVCII  269

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P+SRG PPKKPLVPSGPK+QSNEQ++++QVRT+QD
Sbjct  270   PISRGSPPKKPLVPSGPKIQSNEQQNVVQVRTYQD  304



>ref|XP_009414911.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Musa acuminata subsp. malaccensis]
 ref|XP_009414912.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=961

 Score =   321 bits (822),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 186/217 (86%), Gaps = 5/217 (2%)
 Frame = +3

Query  384   DDDEALG-NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             +D+E+L    YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LARPE KL
Sbjct  97    EDEESLSLGGYRLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRSLPPLSELARPEEKL  156

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AGIRIDG  N+RSRMSFYTGIGIH L +DG LGPE+ +HG P+ AKINFV+WS +G +L+
Sbjct  157   AGIRIDGNYNARSRMSFYTGIGIHSLTDDGKLGPEQEVHGFPDGAKINFVSWSRDGRHLS  216

Query  741   Fs----vrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVC  908
             FS        +EEN+SSKL VWVADVE+G ARPLFQS D++LNA+FDNFVWVNDS LLVC
Sbjct  217   FSIRVDEVNLQEENNSSKLRVWVADVESGKARPLFQSPDIFLNAVFDNFVWVNDSMLLVC  276

Query  909   TIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             TIP+SRG PPKKPLVPSGPKVQSNEQK+++QVRTFQD
Sbjct  277   TIPISRGAPPKKPLVPSGPKVQSNEQKNVVQVRTFQD  313



>ref|XP_009414908.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009414909.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=964

 Score =   321 bits (822),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 186/217 (86%), Gaps = 5/217 (2%)
 Frame = +3

Query  384   DDDEALG-NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             +D+E+L    YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LARPE KL
Sbjct  97    EDEESLSLGGYRLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRSLPPLSELARPEEKL  156

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AGIRIDG  N+RSRMSFYTGIGIH L +DG LGPE+ +HG P+ AKINFV+WS +G +L+
Sbjct  157   AGIRIDGNYNARSRMSFYTGIGIHSLTDDGKLGPEQEVHGFPDGAKINFVSWSRDGRHLS  216

Query  741   Fs----vrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVC  908
             FS        +EEN+SSKL VWVADVE+G ARPLFQS D++LNA+FDNFVWVNDS LLVC
Sbjct  217   FSIRVDEVNLQEENNSSKLRVWVADVESGKARPLFQSPDIFLNAVFDNFVWVNDSMLLVC  276

Query  909   TIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             TIP+SRG PPKKPLVPSGPKVQSNEQK+++QVRTFQD
Sbjct  277   TIPISRGAPPKKPLVPSGPKVQSNEQKNVVQVRTFQD  313



>ref|XP_010938262.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Elaeis guineensis]
Length=951

 Score =   320 bits (821),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +3

Query  375   PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  554
             P  D++ +LG  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  86    PEEDEELSLGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  145

Query  555   KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHY  734
             KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG LGPEK + G P+ AKINFV+WS +G +
Sbjct  146   KLAGVRIDGNSNARSRMSFYTGIGIHELMDDGKLGPEKEVQGFPDGAKINFVSWSQDGQH  205

Query  735   LAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             L+FSVRV+EE+  SSKL VWVADVE+G ARPLFQS ++YLNAIF++FVWVN STLLVC +
Sbjct  206   LSFSVRVDEEDGVSSKLRVWVADVESGKARPLFQSPNIYLNAIFESFVWVNASTLLVCIL  265

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P+SRG PPKKPLVPSGPK+QSNE++++IQVRTFQD
Sbjct  266   PISRGSPPKKPLVPSGPKIQSNEKQNVIQVRTFQD  300



>gb|KCW58328.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
 gb|KCW58329.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
Length=874

 Score =   319 bits (817),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+  ALG  YRLPPPEIRDIVDAPP P LS SPQ DKILFLKRR+LPPL++LARPE KLA
Sbjct  34    DEGSALGGTYRLPPPEIRDIVDAPPCPVLSLSPQGDKILFLKRRALPPLAELARPEEKLA  93

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID KC++RSR+S+YTG+GIHQL  D  LGPEK +HG P+ AKINFVTWSN+G +L+F
Sbjct  94    GIRIDVKCSTRSRISYYTGMGIHQLSPDDNLGPEKEVHGFPDGAKINFVTWSNDGRHLSF  153

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
              +R++EE+NSSSKL +WVADVETG ARPLF+S D+ LNA+FD FVW+++STL+VCTIPL 
Sbjct  154   CIRLDEEDNSSSKLQLWVADVETGKARPLFKSPDICLNAVFDKFVWIDNSTLVVCTIPLG  213

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPKVQSNEQK++IQV TFQD
Sbjct  214   RGDPPKKPLVPGGPKVQSNEQKNVIQVETFQD  245



>ref|XP_008813382.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Phoenix dactylifera]
Length=981

 Score =   321 bits (822),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +3

Query  375   PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  554
             P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90    PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  555   KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHY  734
             KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG LGPE+ +HG P+ AKINFV+WS +G +
Sbjct  150   KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPEREVHGFPDGAKINFVSWSRDGQH  209

Query  735   LAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             L+F+VRV+EE+ SSSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVWVN STLLVC I
Sbjct  210   LSFTVRVDEEDGSSSKLRVWVADVESGKARPLFESPNIYLNAIFDSFVWVNASTLLVCII  269

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P+SRG PPKKPLVPSGPK+QSNEQ++++QVRT+QD
Sbjct  270   PISRGSPPKKPLVPSGPKIQSNEQQNVVQVRTYQD  304



>ref|XP_008813381.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Phoenix dactylifera]
Length=989

 Score =   321 bits (822),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +3

Query  375   PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  554
             P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90    PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  555   KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHY  734
             KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG LGPE+ +HG P+ AKINFV+WS +G +
Sbjct  150   KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPEREVHGFPDGAKINFVSWSRDGQH  209

Query  735   LAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             L+F+VRV+EE+ SSSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVWVN STLLVC I
Sbjct  210   LSFTVRVDEEDGSSSKLRVWVADVESGKARPLFESPNIYLNAIFDSFVWVNASTLLVCII  269

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P+SRG PPKKPLVPSGPK+QSNEQ++++QVRT+QD
Sbjct  270   PISRGSPPKKPLVPSGPKIQSNEQQNVVQVRTYQD  304



>ref|XP_008813379.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=998

 Score =   321 bits (822),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +3

Query  375   PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  554
             P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90    PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  555   KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHY  734
             KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG LGPE+ +HG P+ AKINFV+WS +G +
Sbjct  150   KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPEREVHGFPDGAKINFVSWSRDGQH  209

Query  735   LAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             L+F+VRV+EE+ SSSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVWVN STLLVC I
Sbjct  210   LSFTVRVDEEDGSSSKLRVWVADVESGKARPLFESPNIYLNAIFDSFVWVNASTLLVCII  269

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P+SRG PPKKPLVPSGPK+QSNEQ++++QVRT+QD
Sbjct  270   PISRGSPPKKPLVPSGPKIQSNEQQNVVQVRTYQD  304



>gb|ERN02133.1| hypothetical protein AMTR_s00045p00176400 [Amborella trichopoda]
Length=899

 Score =   319 bits (817),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 184/215 (86%), Gaps = 3/215 (1%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D + +L   Y+LPPP+IR IVD+PP+PALSFSP+RDK+LFLKRR+LPPL+DLARPE KLA
Sbjct  31    DGESSLDGGYQLPPPDIRCIVDSPPLPALSFSPKRDKMLFLKRRALPPLADLARPEEKLA  90

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDG CN+RSRMSF+TGIGIH L++DGTLGPEK +HG P+ AK+NFV+WS +G +L+F
Sbjct  91    GIRIDGNCNTRSRMSFHTGIGIHSLMDDGTLGPEKAVHGFPDGAKLNFVSWSRDGQHLSF  150

Query  744   s---vrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             +      +  +N SSKL VWVADVETG ARPLFQS D++LNAIFDNFVWVNDSTLLVCTI
Sbjct  151   TIRCDEGDNGDNGSSKLDVWVADVETGKARPLFQSPDIHLNAIFDNFVWVNDSTLLVCTI  210

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P SRG  PKKPLVP GPK+QSNEQK ++QVRT+QD
Sbjct  211   PRSRGATPKKPLVPPGPKIQSNEQKDVVQVRTYQD  245



>ref|XP_010069840.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Eucalyptus grandis]
Length=916

 Score =   319 bits (818),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D+  ALG  YRLPPPEIRDIVDAPP P LS SPQ DKILFLKRR+LPPL++LARPE KLA
Sbjct  34    DEGSALGGTYRLPPPEIRDIVDAPPCPVLSLSPQGDKILFLKRRALPPLAELARPEEKLA  93

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID KC++RSR+S+YTG+GIHQL  D  LGPEK +HG P+ AKINFVTWSN+G +L+F
Sbjct  94    GIRIDVKCSTRSRISYYTGMGIHQLSPDDNLGPEKEVHGFPDGAKINFVTWSNDGRHLSF  153

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
              +R++EE+NSSSKL +WVADVETG ARPLF+S D+ LNA+FD FVW+++STL+VCTIPL 
Sbjct  154   CIRLDEEDNSSSKLQLWVADVETGKARPLFKSPDICLNAVFDKFVWIDNSTLVVCTIPLG  213

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPPKKPLVP GPKVQSNEQK++IQV TFQD
Sbjct  214   RGDPPKKPLVPGGPKVQSNEQKNVIQVETFQD  245



>gb|KFK37479.1| hypothetical protein AALP_AA4G262700 [Arabis alpina]
Length=964

 Score =   320 bits (819),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 181/212 (85%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  103   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  162

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIH LL DGTL PEK I G+P+  KINFVTWSN+G +LAF
Sbjct  163   GVRIDGYCNTRSRMSFYTGLGIHLLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAF  222

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E  +SSK  VWVADVE+G ARPLF+S D+YLNAIF++FVW+++STLLV TIP S
Sbjct  223   -SIRVDENGNSSKPIVWVADVESGEARPLFKSQDIYLNAIFESFVWIDNSTLLVSTIPSS  281

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGD PKKPLVPSGPK  SNE K+++QVRTFQD
Sbjct  282   RGDAPKKPLVPSGPKTLSNESKNVVQVRTFQD  313



>ref|XP_008813380.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=994

 Score =   320 bits (819),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +3

Query  375   PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  554
             PS   +E  G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  86    PSSRPEEDEGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  145

Query  555   KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHY  734
             KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG LGPE+ +HG P+ AKINFV+WS +G +
Sbjct  146   KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPEREVHGFPDGAKINFVSWSRDGQH  205

Query  735   LAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             L+F+VRV+EE+ SSSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVWVN STLLVC I
Sbjct  206   LSFTVRVDEEDGSSSKLRVWVADVESGKARPLFESPNIYLNAIFDSFVWVNASTLLVCII  265

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P+SRG PPKKPLVPSGPK+QSNEQ++++QVRT+QD
Sbjct  266   PISRGSPPKKPLVPSGPKIQSNEQQNVVQVRTYQD  300



>ref|XP_006840458.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Amborella 
trichopoda]
Length=957

 Score =   319 bits (818),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 184/215 (86%), Gaps = 3/215 (1%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             D + +L   Y+LPPP+IR IVD+PP+PALSFSP+RDK+LFLKRR+LPPL+DLARPE KLA
Sbjct  89    DGESSLDGGYQLPPPDIRCIVDSPPLPALSFSPKRDKMLFLKRRALPPLADLARPEEKLA  148

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRIDG CN+RSRMSF+TGIGIH L++DGTLGPEK +HG P+ AK+NFV+WS +G +L+F
Sbjct  149   GIRIDGNCNTRSRMSFHTGIGIHSLMDDGTLGPEKAVHGFPDGAKLNFVSWSRDGQHLSF  208

Query  744   s---vrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             +      +  +N SSKL VWVADVETG ARPLFQS D++LNAIFDNFVWVNDSTLLVCTI
Sbjct  209   TIRCDEGDNGDNGSSKLDVWVADVETGKARPLFQSPDIHLNAIFDNFVWVNDSTLLVCTI  268

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P SRG  PKKPLVP GPK+QSNEQK ++QVRT+QD
Sbjct  269   PRSRGATPKKPLVPPGPKIQSNEQKDVVQVRTYQD  303



>gb|EMT29865.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=854

 Score =   317 bits (812),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 189/212 (89%), Gaps = 2/212 (1%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DDD +LG  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLA
Sbjct  81    DDDLSLG--YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLA  138

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG  N+RSRMS YTGIGIH+L++DGTLGPEK++HG PE AKINFVTWS++G  L+F
Sbjct  139   GVRIDGHSNTRSRMSSYTGIGIHKLMDDGTLGPEKVVHGYPEGAKINFVTWSHDGRNLSF  198

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             SVRVEEE+N  SKL VW+ADVE+G ARPLF+S D+YLNAIFD+FVWV++STLLVCTIP+S
Sbjct  199   SVRVEEEDNKISKLRVWIADVESGEARPLFKSPDIYLNAIFDSFVWVDNSTLLVCTIPVS  258

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG  P+KP VPSGPK+QSNE K+++QVRTFQD
Sbjct  259   RGALPQKPSVPSGPKIQSNETKNVVQVRTFQD  290



>emb|CDY55377.1| BnaC04g51960D [Brassica napus]
Length=939

 Score =   318 bits (814),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/212 (74%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  81    DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  140

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PEK I G+P   KIN+VTWSN+G ++AF
Sbjct  141   GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGIPHGGKINYVTWSNDGKHMAF  200

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
                  +E+ +SSK  VWVADVETG ARPLF+S D+YLNAIF++FVW+ DSTLLV TIP +
Sbjct  201   -SIRIDEDGNSSKPIVWVADVETGEARPLFKSEDIYLNAIFESFVWIGDSTLLVSTIPSA  259

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG+PPKKPLVP GPK  SNE+  ++QVRTFQD
Sbjct  260   RGEPPKKPLVPPGPKTLSNEKSDVVQVRTFQD  291



>gb|EMS47754.1| putative glutamyl endopeptidase, chloroplastic [Triticum urartu]
Length=867

 Score =   316 bits (810),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 188/212 (89%), Gaps = 2/212 (1%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DDD +LG  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLA
Sbjct  79    DDDLSLG--YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLA  136

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG  N+RSRMS YTGIGIH+L++DGTLGPEK +HG PE AKINFVTWS++G  L+F
Sbjct  137   GVRIDGHSNTRSRMSSYTGIGIHKLMDDGTLGPEKEVHGYPEGAKINFVTWSHDGRNLSF  196

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             SVRVEEE+N  SKL VW+ADVE+G ARPLF+S D+YLNAIFD+FVWV++STLLVCTIP+S
Sbjct  197   SVRVEEEDNKISKLRVWIADVESGEARPLFKSPDIYLNAIFDSFVWVDNSTLLVCTIPVS  256

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG  P+KP VPSGPK+QSNE K+++QVRTFQD
Sbjct  257   RGALPQKPSVPSGPKIQSNETKNVVQVRTFQD  288



>gb|EEE58916.1| hypothetical protein OsJ_10563 [Oryza sativa Japonica Group]
Length=920

 Score =   316 bits (810),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  77    YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGYSN  136

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             +RSRMSFYTGIGIH+L++DGTLGPEK++HG PE A+INFVTWS +G +L+FSVRV+EE+N
Sbjct  137   TRSRMSFYTGIGIHKLMDDGTLGPEKVVHGYPEGARINFVTWSQDGRHLSFSVRVDEEDN  196

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
             +S KL +W+ADVE+G ARPLF+S ++YLNAIFD+FVWVN+STLLVCTIPLSRG PP+KP 
Sbjct  197   TSGKLRLWIADVESGEARPLFKSPEIYLNAIFDSFVWVNNSTLLVCTIPLSRGAPPQKPS  256

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VPSGPK+QSNE  +++QVRTFQD
Sbjct  257   VPSGPKIQSNETSNVVQVRTFQD  279



>ref|NP_001049893.1| Os03g0307100 [Oryza sativa Japonica Group]
 sp|Q10MJ1.1|CGEP_ORYSJ RecName: Full=Probable glutamyl endopeptidase, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF95536.1| prolyl oligopeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11807.1| Os03g0307100 [Oryza sativa Japonica Group]
Length=938

 Score =   316 bits (809),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             DD  +    YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLA
Sbjct  82    DDLSSAMMGYRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLA  141

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             G+RIDG  N+RSRMSFYTGIGIH+L++DGTLGPEK++HG PE A+INFVTWS +G +L+F
Sbjct  142   GVRIDGYSNTRSRMSFYTGIGIHKLMDDGTLGPEKVVHGYPEGARINFVTWSQDGRHLSF  201

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             SVRV+EE+N+S KL +W+ADVE+G ARPLF+S ++YLNAIFD+FVWVN+STLLVCTIPLS
Sbjct  202   SVRVDEEDNTSGKLRLWIADVESGEARPLFKSPEIYLNAIFDSFVWVNNSTLLVCTIPLS  261

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG PP+KP VPSGPK+QSNE  +++QVRTFQD
Sbjct  262   RGAPPQKPSVPSGPKIQSNETSNVVQVRTFQD  293



>ref|XP_010228712.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Brachypodium distachyon]
 ref|XP_010228713.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Brachypodium distachyon]
Length=931

 Score =   315 bits (808),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 190/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             DDD + G   YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  74    DDDLSSGEMGYRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKL  133

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDG  N+RSRMSFYTGIGIH+L+++GTLGPEK +HG PE A+INFVTWS++G +L+
Sbjct  134   AGVRIDGHSNTRSRMSFYTGIGIHKLMDNGTLGPEKEVHGYPEGARINFVTWSHDGRHLS  193

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FSVRV+EE+N SSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVW+N+STLLVCTIP+
Sbjct  194   FSVRVDEEDNKSSKLRVWVADVESGAARPLFKSPEIYLNAIFDSFVWINNSTLLVCTIPV  253

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             S G PP+KP VPSGPK+QSNE K+++QVRTFQD
Sbjct  254   SCGAPPQKPSVPSGPKIQSNETKNVVQVRTFQD  286



>ref|XP_003558080.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Brachypodium distachyon]
Length=927

 Score =   315 bits (807),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 190/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             DDD + G   YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  74    DDDLSSGEMGYRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKL  133

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDG  N+RSRMSFYTGIGIH+L+++GTLGPEK +HG PE A+INFVTWS++G +L+
Sbjct  134   AGVRIDGHSNTRSRMSFYTGIGIHKLMDNGTLGPEKEVHGYPEGARINFVTWSHDGRHLS  193

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FSVRV+EE+N SSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVW+N+STLLVCTIP+
Sbjct  194   FSVRVDEEDNKSSKLRVWVADVESGAARPLFKSPEIYLNAIFDSFVWINNSTLLVCTIPV  253

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             S G PP+KP VPSGPK+QSNE K+++QVRTFQD
Sbjct  254   SCGAPPQKPSVPSGPKIQSNETKNVVQVRTFQD  286



>ref|XP_010228711.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Brachypodium distachyon]
Length=943

 Score =   315 bits (807),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 190/213 (89%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             DDD + G   YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  74    DDDLSSGEMGYRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKL  133

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDG  N+RSRMSFYTGIGIH+L+++GTLGPEK +HG PE A+INFVTWS++G +L+
Sbjct  134   AGVRIDGHSNTRSRMSFYTGIGIHKLMDNGTLGPEKEVHGYPEGARINFVTWSHDGRHLS  193

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FSVRV+EE+N SSKL VWVADVE+G ARPLF+S ++YLNAIFD+FVW+N+STLLVCTIP+
Sbjct  194   FSVRVDEEDNKSSKLRVWVADVESGAARPLFKSPEIYLNAIFDSFVWINNSTLLVCTIPV  253

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             S G PP+KP VPSGPK+QSNE K+++QVRTFQD
Sbjct  254   SCGAPPQKPSVPSGPKIQSNETKNVVQVRTFQD  286



>ref|XP_010679382.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=965

 Score =   314 bits (805),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = +3

Query  381   YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             Y+DD A    Y+LPP EIRDIVDAPP+PALS SPQRDK+LFLKRRSLPPL D+A+PE KL
Sbjct  99    YEDDLAASAGYQLPPSEIRDIVDAPPLPALSISPQRDKVLFLKRRSLPPLIDIAKPEEKL  158

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
              GIR+D K N+RSRMSFYTGIGIHQL  DGTLGPEK + GLP  A+INFV+W+ +G +LA
Sbjct  159   GGIRVDVKSNTRSRMSFYTGIGIHQLTSDGTLGPEKEVLGLPAGARINFVSWATDGRHLA  218

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             F+VRV+E++  +SKL +WVA+VETG A+PLF S D+Y+NA+FDNFVWV+ STLLVCTIP 
Sbjct  219   FTVRVDEDDGGNSKLQIWVANVETGQAKPLFLSADIYVNAVFDNFVWVDASTLLVCTIPS  278

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRGDPPKKPLVP GPK+QSNEQK+ IQ+RTFQD
Sbjct  279   SRGDPPKKPLVPPGPKIQSNEQKNTIQLRTFQD  311



>gb|KHN19214.1| Putative glutamyl endopeptidase, chloroplastic [Glycine soja]
Length=970

 Score =   314 bits (804),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 206/251 (82%), Gaps = 0/251 (0%)
 Frame = +3

Query  267   AMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIV  446
             A  ASSR  +L PL A   ED   AS ++   A+A   YDD+  +G +YR+PP  I DIV
Sbjct  44    ASMASSRLRNLAPLAAAPTEDAAAASISSSPNAAASVDYDDESTVGVRYRVPPSVISDIV  103

Query  447   DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  626
             DAPPVPALSFSP RD+I+FLKRR+LPPL+++ARPE KLAGIRIDGKCN+RSRMSFYTGIG
Sbjct  104   DAPPVPALSFSPLRDRIIFLKRRALPPLAEIARPEEKLAGIRIDGKCNTRSRMSFYTGIG  163

Query  627   IHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADV  806
             IHQ+L DGTLG E  + G P  AKINFV+WS +G +L+FS+RV EE+N SSKLTVW+ADV
Sbjct  164   IHQILPDGTLGSETEVSGFPVGAKINFVSWSPDGCHLSFSIRVNEEDNDSSKLTVWIADV  223

Query  807   ETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQ  986
             +TG AR LFQS +V+LNA+FDN+VWVN+S+LLVCTIP SRG PPKKPLVPS PK+QSNE+
Sbjct  224   KTGIARKLFQSPNVHLNAVFDNYVWVNNSSLLVCTIPSSRGAPPKKPLVPSCPKIQSNEE  283

Query  987   KSIIQVRTFQD  1019
             +SIIQVRTFQD
Sbjct  284   RSIIQVRTFQD  294



>ref|XP_002467980.1| hypothetical protein SORBIDRAFT_01g037483 [Sorghum bicolor]
 gb|EER94978.1| hypothetical protein SORBIDRAFT_01g037483 [Sorghum bicolor]
Length=943

 Score =   312 bits (799),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 185/213 (87%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             DD  + G+  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  86    DDGLSSGDMGYRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDLAKPEEKL  145

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDG  N+RSRMSFYTGIGIH+LL+DGTLGPEK +HG P  A+INFVTWS +G +++
Sbjct  146   AGLRIDGNSNTRSRMSFYTGIGIHKLLDDGTLGPEKEVHGYPVGARINFVTWSQDGRHIS  205

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FSVRV+EE++ S KL VW+ADVE+G ARPLF+S ++YLNAIFD+FVWVND TLLVCTIP 
Sbjct  206   FSVRVDEEDSKSGKLRVWIADVESGEARPLFKSPEIYLNAIFDSFVWVNDCTLLVCTIPA  265

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             +RG PP KP VPSGPK+QSNE K+++QVRTFQD
Sbjct  266   TRGAPPHKPSVPSGPKIQSNESKNVVQVRTFQD  298



>ref|XP_004984623.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Setaria italica]
Length=943

 Score =   311 bits (796),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  96    YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDLAKPEEKLAGLRIDGNSN  155

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             +RSRMSFYTGIGIH+LL+DGTLGPEK ++G P  A+INFVTWS +G +++F+VRV+EE+N
Sbjct  156   TRSRMSFYTGIGIHKLLDDGTLGPEKEVYGYPVGARINFVTWSQDGRHISFTVRVDEEDN  215

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
              S KL VW+ADVE+G ARPLF+S ++YLNAIFD+FVWVN+STLLVCTIP++RG PP+KP 
Sbjct  216   KSGKLRVWIADVESGEARPLFKSPEIYLNAIFDSFVWVNNSTLLVCTIPVTRGAPPQKPS  275

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VPSGPK+QSNE K+++QVRTFQD
Sbjct  276   VPSGPKIQSNETKNVVQVRTFQD  298



>ref|XP_004984622.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Setaria italica]
Length=944

 Score =   311 bits (796),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  96    YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDLAKPEEKLAGLRIDGNSN  155

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             +RSRMSFYTGIGIH+LL+DGTLGPEK ++G P  A+INFVTWS +G +++F+VRV+EE+N
Sbjct  156   TRSRMSFYTGIGIHKLLDDGTLGPEKEVYGYPVGARINFVTWSQDGRHISFTVRVDEEDN  215

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
              S KL VW+ADVE+G ARPLF+S ++YLNAIFD+FVWVN+STLLVCTIP++RG PP+KP 
Sbjct  216   KSGKLRVWIADVESGEARPLFKSPEIYLNAIFDSFVWVNNSTLLVCTIPVTRGAPPQKPS  275

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VPSGPK+QSNE K+++QVRTFQD
Sbjct  276   VPSGPKIQSNETKNVVQVRTFQD  298



>tpg|DAA45011.1| TPA: hypothetical protein ZEAMMB73_493989 [Zea mays]
Length=850

 Score =   308 bits (790),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KLAG+RIDG  N
Sbjct  3     YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKLAGLRIDGNSN  62

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             +RSRMSFYTGI IH+LL+DGTLGPEK +HG P  A+INFVTWS +G +++FS+RV+EE++
Sbjct  63    TRSRMSFYTGISIHKLLDDGTLGPEKEVHGYPVGARINFVTWSQDGRHISFSIRVDEEDS  122

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
              S KL VW+ADVE+G ARPLF+S ++YLNAIFD+FVWVND TLLVCTIP +RGDPP KP 
Sbjct  123   KSGKLRVWIADVESGEARPLFKSPEIYLNAIFDSFVWVNDCTLLVCTIPATRGDPPHKPS  182

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VPSGPK+QSNE K+++Q RTFQD
Sbjct  183   VPSGPKIQSNESKNVVQARTFQD  205



>ref|XP_008654905.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Zea mays]
Length=945

 Score =   310 bits (794),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 184/213 (86%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             DD  + G+  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KL
Sbjct  88    DDGLSSGDMGYRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKL  147

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDG  N+RSRMSFYTGI IH+LL+DGTLGPEK +HG P  A+INFVTWS +G +++
Sbjct  148   AGLRIDGNSNTRSRMSFYTGISIHKLLDDGTLGPEKEVHGYPVGARINFVTWSQDGRHIS  207

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS+RV+EE++ S KL VW+ADVE+G ARPLF+S ++YLNAIFD+FVWVND TLLVCTIP 
Sbjct  208   FSIRVDEEDSKSGKLRVWIADVESGEARPLFKSPEIYLNAIFDSFVWVNDCTLLVCTIPA  267

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             +RGDPP KP VPSGPK+QSNE K+++Q RTFQD
Sbjct  268   TRGDPPHKPSVPSGPKIQSNESKNVVQARTFQD  300



>ref|XP_008654909.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Zea mays]
Length=871

 Score =   308 bits (790),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KLAG+RIDG  N
Sbjct  23    YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKLAGLRIDGNSN  82

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             +RSRMSFYTGI IH+LL+DGTLGPEK +HG P  A+INFVTWS +G +++FS+RV+EE++
Sbjct  83    TRSRMSFYTGISIHKLLDDGTLGPEKEVHGYPVGARINFVTWSQDGRHISFSIRVDEEDS  142

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
              S KL VW+ADVE+G ARPLF+S ++YLNAIFD+FVWVND TLLVCTIP +RGDPP KP 
Sbjct  143   KSGKLRVWIADVESGEARPLFKSPEIYLNAIFDSFVWVNDCTLLVCTIPATRGDPPHKPS  202

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VPSGPK+QSNE K+++Q RTFQD
Sbjct  203   VPSGPKIQSNESKNVVQARTFQD  225



>ref|XP_008654901.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Zea mays]
Length=946

 Score =   310 bits (793),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 184/213 (86%), Gaps = 1/213 (0%)
 Frame = +3

Query  384   DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             DD  + G+  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KL
Sbjct  88    DDGLSSGDMGYRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKL  147

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AG+RIDG  N+RSRMSFYTGI IH+LL+DGTLGPEK +HG P  A+INFVTWS +G +++
Sbjct  148   AGLRIDGNSNTRSRMSFYTGISIHKLLDDGTLGPEKEVHGYPVGARINFVTWSQDGRHIS  207

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS+RV+EE++ S KL VW+ADVE+G ARPLF+S ++YLNAIFD+FVWVND TLLVCTIP 
Sbjct  208   FSIRVDEEDSKSGKLRVWIADVESGEARPLFKSPEIYLNAIFDSFVWVNDCTLLVCTIPA  267

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             +RGDPP KP VPSGPK+QSNE K+++Q RTFQD
Sbjct  268   TRGDPPHKPSVPSGPKIQSNESKNVVQARTFQD  300



>ref|XP_006649964.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Oryza brachyantha]
Length=851

 Score =   307 bits (787),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  4     YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGHSN  63

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             +RSRMSFYTGIGIH+L+EDGTLGPEK +HG P+ A+INFVTWS +G +L+FSVRVEEE+N
Sbjct  64    TRSRMSFYTGIGIHRLMEDGTLGPEKEVHGYPDGARINFVTWSQDGRHLSFSVRVEEEDN  123

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
             +S KL +WVADVE+G ARPLF+S +++LNAIFD+FVW+++STLLVCTIPLSRG  P+KP 
Sbjct  124   TSGKLRLWVADVESGEARPLFKSPEIHLNAIFDSFVWIDNSTLLVCTIPLSRGALPQKPS  183

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VPSGPK+QSNE  +++QVRTFQD
Sbjct  184   VPSGPKIQSNETSNVVQVRTFQD  206



>gb|KHN43458.1| Putative glutamyl endopeptidase, chloroplastic [Glycine soja]
Length=910

 Score =   308 bits (790),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  381   YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             YDD+  +G +Y +PP  I DIVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  37    YDDESTVGVRYHVPPSVISDIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEEKL  96

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AGIRIDGKCN+RSRMSFYT IGIHQ+L DGTLGPE  + G P  AKINFV+WS +G +L+
Sbjct  97    AGIRIDGKCNTRSRMSFYTAIGIHQILPDGTLGPETEVSGFPVGAKINFVSWSPDGCHLS  156

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS RV EE++ SSKLTVW+ADV+TG AR LFQS +V+LNA+FDN+VWVN+ +LLVCTIP 
Sbjct  157   FSTRVNEEDHDSSKLTVWIADVKTGIARKLFQSPNVHLNAVFDNYVWVNNCSLLVCTIPS  216

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRG PPKKPLVPS PK+QSNE +S IQVRTFQD
Sbjct  217   SRGAPPKKPLVPSCPKIQSNEARSTIQVRTFQD  249



>ref|XP_006604741.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006604742.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X3 [Glycine max]
Length=948

 Score =   308 bits (789),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  381   YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             YDD+  +G +Y +PP  I DIVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  76    YDDESTVGVRYHVPPSVISDIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEEKL  135

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AGIRIDGKCN+RSRMSFYT IGIHQ+L DGTLGPE  + G P  AKINFV+WS +G +L+
Sbjct  136   AGIRIDGKCNTRSRMSFYTAIGIHQILPDGTLGPETEVSGFPVGAKINFVSWSPDGCHLS  195

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS RV EE++ SSKLTVW+ADV+TG AR LFQS +V+LNA+FDN+VWVN+ +LLVCTIP 
Sbjct  196   FSTRVNEEDHDSSKLTVWIADVKTGIARKLFQSPNVHLNAVFDNYVWVNNCSLLVCTIPS  255

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRG PPKKPLVPS PK+QSNE +S IQVRTFQD
Sbjct  256   SRGAPPKKPLVPSCPKIQSNEARSTIQVRTFQD  288



>ref|XP_006604740.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Glycine max]
Length=949

 Score =   308 bits (789),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 182/213 (85%), Gaps = 0/213 (0%)
 Frame = +3

Query  381   YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  560
             YDD+  +G +Y +PP  I DIVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  76    YDDESTVGVRYHVPPSVISDIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEEKL  135

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             AGIRIDGKCN+RSRMSFYT IGIHQ+L DGTLGPE  + G P  AKINFV+WS +G +L+
Sbjct  136   AGIRIDGKCNTRSRMSFYTAIGIHQILPDGTLGPETEVSGFPVGAKINFVSWSPDGCHLS  195

Query  741   FsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL  920
             FS RV EE++ SSKLTVW+ADV+TG AR LFQS +V+LNA+FDN+VWVN+ +LLVCTIP 
Sbjct  196   FSTRVNEEDHDSSKLTVWIADVKTGIARKLFQSPNVHLNAVFDNYVWVNNCSLLVCTIPS  255

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             SRG PPKKPLVPS PK+QSNE +S IQVRTFQD
Sbjct  256   SRGAPPKKPLVPSCPKIQSNEARSTIQVRTFQD  288



>dbj|BAK03859.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=291

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI++IVD PP P+   SP+RD+I+FLKRR++PPLS+LA+P+  LAGIRID   N
Sbjct  10    YRLPPKEIQEIVDVPPNPSYHLSPRRDRIMFLKRRAMPPLSELAKPDKVLAGIRIDPGSN  69

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              RSRMSFYTG+ IH L++DG+LGPEK++HG  + +KINFVTWS +G  +AF+VR E+E  
Sbjct  70    MRSRMSFYTGVSIHLLMDDGSLGPEKVVHGYTDGSKINFVTWSPDGQNVAFTVRYEDEAG  129

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
             S S L +WVA+ E+G ARPLF+ TD+ LNAIF+ FVWV+ STLLVCTIP SRGDPPKKPL
Sbjct  130   SDSNLVLWVANAESGEARPLFKQTDIRLNAIFELFVWVDHSTLLVCTIPSSRGDPPKKPL  189

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VP GP+++SNEQK++IQ+R  ++
Sbjct  190   VPFGPRIRSNEQKNVIQMRATKE  212



>gb|KJB49818.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=830

 Score =   278 bits (712),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = +3

Query  504   LKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGL  683
             +KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH L+ DG+LGPE  + GL
Sbjct  1     MKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHSLMPDGSLGPETEVRGL  60

Query  684   PERAKINFVTWSNNGHYLAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAI  863
             P+ AKINFVTWSN+G +LAFSVR EEEE+SSSKL VWVADVETG ARPLFQS D+YLNA+
Sbjct  61    PDGAKINFVTWSNDGKHLAFSVRFEEEESSSSKLRVWVADVETGMARPLFQSPDIYLNAV  120

Query  864   FDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             FDN+VWV++STLLVCTIPLSRGDPPKKPLVPSGPK+QSNEQK+I+QVRTFQD
Sbjct  121   FDNYVWVDNSTLLVCTIPLSRGDPPKKPLVPSGPKIQSNEQKTIVQVRTFQD  172



>ref|XP_002515283.1| dipeptidyl-peptidase, putative [Ricinus communis]
 gb|EEF47267.1| dipeptidyl-peptidase, putative [Ricinus communis]
Length=926

 Score =   277 bits (708),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = +3

Query  384  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
            +DDEALG +Y+LPPPEIRDIVDAPP+PALSFSPQRDKILFLKRR+LPPL++LARPE KLA
Sbjct  94   EDDEALGGKYQLPPPEIRDIVDAPPLPALSFSPQRDKILFLKRRALPPLAELARPEEKLA  153

Query  564  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
            G+RIDGKCN+RSRMSFYTGI IHQL+ DGTLGPEK +HG P+ AKINFVTWS +G +L+F
Sbjct  154  GMRIDGKCNTRSRMSFYTGINIHQLMPDGTLGPEKEVHGFPDGAKINFVTWSLDGRHLSF  213

Query  744  svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTL  899
            S+RV+EE+NSSSKL VWVADVETG ARPLFQS+DVYLNA+FDNFVWV++S+L
Sbjct  214  SIRVDEEDNSSSKLRVWVADVETGKARPLFQSSDVYLNAVFDNFVWVDESSL  265



>ref|XP_004958766.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Setaria italica]
Length=933

 Score =   270 bits (689),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             +DD  LG  YRLPP EI++IVD PP P+   SP+RD+I+FLKRR++PPLSDLA+P+  LA
Sbjct  64    EDDGDLG--YRLPPKEIQEIVDVPPTPSYYISPRRDRIMFLKRRAMPPLSDLAKPDKILA  121

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID   N+RSRMSFYTGI IH L++DGTLGPEK ++G  + AKINFV WS +G ++AF
Sbjct  122   GIRIDPSSNTRSRMSFYTGISIHLLMDDGTLGPEKAVNGYNDNAKINFVGWSPDGQHVAF  181

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             +VR E+E ++ S L +W+AD E+G ARPLF+S D+ LNA+F+ +VWVN+S+LLVCTIP S
Sbjct  182   TVRYEDEVDNGSNLALWIADAESGKARPLFKSADIMLNAVFELYVWVNESSLLVCTIPSS  241

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RGDPP KPLVP GP+++SNEQ++IIQ+R+ ++
Sbjct  242   RGDPPTKPLVPFGPRIRSNEQRNIIQMRSTKE  273



>ref|XP_006431496.1| hypothetical protein CICLE_v10000356mg [Citrus clementina]
 gb|ESR44736.1| hypothetical protein CICLE_v10000356mg [Citrus clementina]
Length=770

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 168/203 (83%), Gaps = 1/203 (0%)
 Frame = +3

Query  402   GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  581
             G +Y+LPP E+R+IVDAP +P LSFSP+RDKILFLKR +LPPL++LARPE KLAGIRID 
Sbjct  25    GGRYQLPPAELREIVDAPSLPVLSFSPRRDKILFLKRSALPPLAELARPEDKLAGIRIDR  84

Query  582   KCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrve-  758
              CN++SR+ FYTG+GIH +L D +LGPEK +HGLP+ AKINFVT S +G +LA SVR++ 
Sbjct  85    SCNTKSRIPFYTGLGIHLILPDDSLGPEKPVHGLPDGAKINFVTSSPDGKHLALSVRLDH  144

Query  759   eeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPP  938
             +++    KL VWVADVET  A+PLF+S D+ LNA+F +FVWVN S LLV TIPLSRGDPP
Sbjct  145   DDDGEDGKLRVWVADVETEKAKPLFESPDMCLNAVFGSFVWVNSSVLLVYTIPLSRGDPP  204

Query  939   KKPLVPSGPKVQSNEQKSIIQVR  1007
             KK LVP GPK+QSNEQ+++IQ R
Sbjct  205   KKSLVPLGPKIQSNEQQNVIQNR  227



>ref|XP_006442098.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
 gb|ESR55338.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
Length=693

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             ++LP PE+R+IVDAP +P+LSFSPQRDKILFLKR SL PL +LARPE KLA  +ID KCN
Sbjct  14    FQLPAPELREIVDAPALPSLSFSPQRDKILFLKRSSLLPLVELARPEEKLASAKIDVKCN  73

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             ++SRM F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N
Sbjct  74    AKSRMPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDN  133

Query  771   sss-KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
              SS KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIPLSR DPPKK 
Sbjct  134   VSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPLSRRDPPKKT  193

Query  948   LVPSGPKVQSNEQKSIIQVR  1007
             +VP GPK+QSNEQK+II  R
Sbjct  194   MVPLGPKIQSNEQKNIIISR  213



>ref|XP_006442097.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
 gb|ESR55337.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
Length=672

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             ++LP PE+R+IVDAP +P+LSFSPQRDKILFLKR SL PL +LARPE KLA  +ID KCN
Sbjct  14    FQLPAPELREIVDAPALPSLSFSPQRDKILFLKRSSLLPLVELARPEEKLASAKIDVKCN  73

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             ++SRM F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N
Sbjct  74    AKSRMPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDN  133

Query  771   sss-KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
              SS KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIPLSR DPPKK 
Sbjct  134   VSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPLSRRDPPKKT  193

Query  948   LVPSGPKVQSNEQKSIIQVR  1007
             +VP GPK+QSNEQK+II  R
Sbjct  194   MVPLGPKIQSNEQKNIIISR  213



>ref|XP_006442099.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
 gb|ESR55339.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
Length=829

 Score =   260 bits (665),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 168/200 (84%), Gaps = 1/200 (1%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             ++LP PE+R+IVDAP +P+LSFSPQRDKILFLKR SL PL +LARPE KLA  +ID KCN
Sbjct  14    FQLPAPELREIVDAPALPSLSFSPQRDKILFLKRSSLLPLVELARPEEKLASAKIDVKCN  73

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             ++SRM F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N
Sbjct  74    AKSRMPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDN  133

Query  771   sss-KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
              SS KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIPLSR DPPKK 
Sbjct  134   VSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPLSRRDPPKKT  193

Query  948   LVPSGPKVQSNEQKSIIQVR  1007
             +VP GPK+QSNEQK+II  R
Sbjct  194   MVPLGPKIQSNEQKNIIISR  213



>ref|XP_001754620.1| predicted protein [Physcomitrella patens]
 gb|EDQ80590.1| predicted protein [Physcomitrella patens]
Length=850

 Score =   256 bits (653),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP EIR+IVDAPP+PALSFSP+RD+I+FL+RRSLPP+++ A+PE+KLAGIRID   N
Sbjct  23    YQLPPKEIREIVDAPPIPALSFSPKRDEIVFLQRRSLPPVAEFAKPELKLAGIRIDPDYN  82

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SRMSFYTGI I +LL++G LGPE+ + GLPE A+INFV+WS +G +LAFSVR  EEEN
Sbjct  83    SGSRMSFYTGISIRKLLDEGILGPERSVDGLPEDARINFVSWSPDGQHLAFSVRGVEEEN  142

Query  771   sssK-LTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
                  LT+W+A+V+TG AR L    +++LN+IF+++ WV+D T++V TIP +RG PPKKP
Sbjct  143   GPPSLLTLWIANVKTGKARRLIGPPELHLNSIFESYSWVDDETIVVSTIPATRGAPPKKP  202

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
             L PSGPK+QSNE++ ++Q RT+QD
Sbjct  203   LTPSGPKIQSNEEQLVVQNRTYQD  226



>dbj|BAC21362.1| aminoacyl peptidase-like [Oryza sativa Japonica Group]
 dbj|BAD30598.1| aminoacyl peptidase-like [Oryza sativa Japonica Group]
Length=704

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 167/212 (79%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  57    EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  116

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID   N RSRMSFYTGI IH L++ GTLGP K +HG  + AKINFVTWS +G ++AF
Sbjct  117   GIRIDPGSNMRSRMSFYTGIIIHDLMDSGTLGPAKEVHGYADGAKINFVTWSPDGQHMAF  176

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             +VR E++ ++S  L++WVA+ E+G ARPL  S D+ LNAIF+ FVWVNDST+LVCTIP S
Sbjct  177   TVRYEDKVDNSVNLSLWVANAESGEARPLCISEDIRLNAIFELFVWVNDSTVLVCTIPSS  236

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG PPKKPLVP GP+++SNE K+++Q+R  ++
Sbjct  237   RGCPPKKPLVPFGPRIRSNEHKNVVQMRATKE  268



>ref|NP_001060706.1| Os07g0689400 [Oryza sativa Japonica Group]
 dbj|BAF22620.1| Os07g0689400 [Oryza sativa Japonica Group]
Length=712

 Score =   251 bits (642),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 167/212 (79%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  65    EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  124

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID   N RSRMSFYTGI IH L++ GTLGP K +HG  + AKINFVTWS +G ++AF
Sbjct  125   GIRIDPGSNMRSRMSFYTGIIIHDLMDSGTLGPAKEVHGYADGAKINFVTWSPDGQHMAF  184

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             +VR E++ ++S  L++WVA+ E+G ARPL  S D+ LNAIF+ FVWVNDST+LVCTIP S
Sbjct  185   TVRYEDKVDNSVNLSLWVANAESGEARPLCISEDIRLNAIFELFVWVNDSTVLVCTIPSS  244

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG PPKKPLVP GP+++SNE K+++Q+R  ++
Sbjct  245   RGCPPKKPLVPFGPRIRSNEHKNVVQMRATKE  276



>gb|EEE67855.1| hypothetical protein OsJ_25660 [Oryza sativa Japonica Group]
Length=916

 Score =   253 bits (646),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 167/212 (79%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  57    EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  116

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID   N RSRMSFYTGI IH L++ GTLGP K +HG  + AKINFVTWS +G ++AF
Sbjct  117   GIRIDPGSNMRSRMSFYTGIIIHDLMDSGTLGPAKEVHGYADGAKINFVTWSPDGQHMAF  176

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             +VR E++ ++S  L++WVA+ E+G ARPL  S D+ LNAIF+ FVWVNDST+LVCTIP S
Sbjct  177   TVRYEDKVDNSVNLSLWVANAESGEARPLCISEDIRLNAIFELFVWVNDSTVLVCTIPSS  236

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG PPKKPLVP GP+++SNE K+++Q+R  ++
Sbjct  237   RGCPPKKPLVPFGPRIRSNEHKNVVQMRATKE  268



>gb|EEC82725.1| hypothetical protein OsI_27416 [Oryza sativa Indica Group]
Length=916

 Score =   253 bits (645),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 167/212 (79%), Gaps = 0/212 (0%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  563
             +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  57    EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  116

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAF  743
             GIRID   N RSRMSFYTGI +H L++ GTLGP K +HG  + AKINFVTWS +G ++AF
Sbjct  117   GIRIDPGSNMRSRMSFYTGIIVHDLMDSGTLGPAKEVHGYADGAKINFVTWSPDGQHMAF  176

Query  744   svrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLS  923
             +VR E++ ++S  L++WVA+ E+G ARPL  S D+ LNAIF+ FVWVNDST+LVCTIP S
Sbjct  177   TVRYEDKVDNSVNLSLWVANAESGEARPLCISEDIRLNAIFELFVWVNDSTVLVCTIPSS  236

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             RG PPKKPLVP GP+++SNE K+++Q+R  ++
Sbjct  237   RGCPPKKPLVPFGPRIRSNEHKNVVQMRATKE  268



>gb|EMS61523.1| putative glutamyl endopeptidase, chloroplastic [Triticum urartu]
Length=792

 Score =   248 bits (633),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YR+PP EI++IVD PP P+   SP+RD+I+FLKRR++PPLS+LA+ +  LAGIRID   N
Sbjct  10    YRIPPKEIQEIVDVPPNPSYHLSPRRDRIMFLKRRAMPPLSELAKSDKILAGIRIDSSSN  69

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              RSRMSFYTGI IH L++DG+LGPEK++HG P+ AKINFVTWS +G  +AF+VR E+E  
Sbjct  70    MRSRMSFYTGISIHLLMDDGSLGPEKVVHGYPDGAKINFVTWSPDGQNVAFTVRYEDEVG  129

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
             S S L +WVA+ E+G ARPLF+ TD+ LNAIF+ FVWV+ STLLVCTIP SRGD PKKPL
Sbjct  130   SDSNLALWVANAESGEARPLFRQTDIRLNAIFELFVWVDHSTLLVCTIPSSRGDSPKKPL  189

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VP GP+++SNEQ ++IQ+R  ++
Sbjct  190   VPFGPRIRSNEQNNVIQMRATKE  212



>ref|XP_001761707.1| predicted protein [Physcomitrella patens]
 gb|EDQ73463.1| predicted protein [Physcomitrella patens]
Length=930

 Score =   243 bits (620),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 159/204 (78%), Gaps = 1/204 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP EIR+IVDAP  PALSFSP+RD+ILFL+RRSLPP++D A+PE+KLAG+RID   N
Sbjct  121   YQLPPEEIREIVDAPSTPALSFSPKRDEILFLQRRSLPPVADFAKPELKLAGMRIDPDYN  180

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             +RSRMSFYTGI IH+ L++G LGP + + GLPE AKINFV+WS +  ++AFSVRV EEE+
Sbjct  181   ARSRMSFYTGINIHKFLDEGMLGPGRSVSGLPEGAKINFVSWSPDAQHIAFSVRVPEEED  240

Query  771   sssK-LTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
                  L++WVADV+TG AR L     V LN IF  + WV+D T++V TIP S G PPKKP
Sbjct  241   GPPSLLSLWVADVKTGQARKLIGPPQVCLNTIFRLYSWVDDKTIVVSTIPASHGSPPKKP  300

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
             L P+ P +QSNEQK ++Q RT+QD
Sbjct  301   LSPACPNIQSNEQKLVVQNRTYQD  324



>ref|XP_001772878.1| predicted protein [Physcomitrella patens]
 gb|EDQ62280.1| predicted protein [Physcomitrella patens]
Length=886

 Score =   231 bits (590),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 155/215 (72%), Gaps = 1/215 (0%)
 Frame = +3

Query  378   SYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVK  557
             +Y+  +   N Y++PP EIR IVDAPP P L FSP +  ILFL+RRSL PLSD+ARPE+K
Sbjct  27    NYESTQPADNGYQIPPEEIRKIVDAPPTPTLMFSPTKKTILFLQRRSLAPLSDIARPELK  86

Query  558   LAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYL  737
             L G+RID + N++SRMSFYTGI I ++L D  +G + ++ G+PE ++IN+ +WS +G Y 
Sbjct  87    LGGMRIDPEYNTKSRMSFYTGIHIRKVLSDNNIGEDLVMTGVPEGSRINYCSWSPDGRYF  146

Query  738   AFsvrveeeensssKL-TVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             AFSVR  ++      L ++WVAD ETG AR L  + +  LN + D+F W++D+ L+VCTI
Sbjct  147   AFSVREPDQGEGPVTLPSLWVADAETGKARQLLGAPEYALNTVLDHFSWIDDTRLVVCTI  206

Query  915   PLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P  RG PPKKP  P GPK+QSNE ++++Q RT+QD
Sbjct  207   PQGRGAPPKKPPTPFGPKIQSNEGQAVMQNRTYQD  241



>ref|XP_009774674.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Nicotiana sylvestris]
Length=809

 Score =   221 bits (564),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  606   SFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensssKL  785
             SFYTGIGIH L+EDG+LGPEK I GLPE A+INF+TWSNNG +LAF+VR++E++ SSSKL
Sbjct  7     SFYTGIGIHHLMEDGSLGPEKEIQGLPEGARINFLTWSNNGQHLAFTVRLDEDDGSSSKL  66

Query  786   TVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPSGP  965
              VWVA+V+TG ARPLF+S D+Y+NA+FDNFVWVNDSTLLVCTIPLSRGDPP+KPLVPSGP
Sbjct  67    RVWVANVDTGKARPLFESPDIYVNAVFDNFVWVNDSTLLVCTIPLSRGDPPRKPLVPSGP  126

Query  966   KVQSNEQKSIIQVRTFQD  1019
             K+QSNEQK++IQ RT+QD
Sbjct  127   KIQSNEQKNVIQSRTYQD  144



>ref|XP_002990171.1| hypothetical protein SELMODRAFT_131182, partial [Selaginella 
moellendorffii]
 gb|EFJ08731.1| hypothetical protein SELMODRAFT_131182, partial [Selaginella 
moellendorffii]
Length=837

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP PEIR IVDAPP PALSFSP+RDKILF+KR SLPPLS+LARPE+KLAG+RID +CN
Sbjct  2     YQLPAPEIRRIVDAPPNPALSFSPKRDKILFMKRTSLPPLSELARPELKLAGLRIDPECN  61

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsv-rveeee  767
              RSRMS Y G+G+  L  DG +G E+L+ GLP  A+INFV+WS +G +LAF +  +++E+
Sbjct  62    CRSRMSSYVGLGMSSLSHDGLVGVERLVTGLPAGARINFVSWSPDGSHLAFVLWGIDKED  121

Query  768   nsssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
              + S+L +W+ DV+T  AR L    +  LN +FD++ W++ STL+ C +P +RG PPKKP
Sbjct  122   GTRSELGLWIVDVQTLEARELIGPPNYCLNTVFDSYSWLDPSTLVACVVPSARGPPPKKP  181

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
             L P  PKV  NE+K ++Q RT+QD
Sbjct  182   LTPLSPKVLMNEEKRVVQNRTYQD  205



>ref|XP_002992516.1| hypothetical protein SELMODRAFT_135368, partial [Selaginella 
moellendorffii]
 gb|EFJ06454.1| hypothetical protein SELMODRAFT_135368, partial [Selaginella 
moellendorffii]
Length=837

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 156/204 (76%), Gaps = 1/204 (0%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP PEIR IVDAPP PALSFSP+RDKILF+KR SLPPLS+LARPE+KLAG+RID +CN
Sbjct  2     YQLPAPEIRRIVDAPPNPALSFSPKRDKILFMKRTSLPPLSELARPELKLAGLRIDPECN  61

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsv-rveeee  767
              RSRMS Y G+G+  L +DG +G E+L+ GLP  A+INFV+WS +G +LAF +  +++E+
Sbjct  62    CRSRMSSYVGLGMSSLSDDGLVGVERLVTGLPAGARINFVSWSPDGSHLAFVLWGIDKED  121

Query  768   nsssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
              + S+L +W+ DV+T  AR L    +  LN +FD++ W++ STL+ C +P +RG PPKKP
Sbjct  122   GTRSELGLWIVDVQTLEARELIGPPNYCLNTVFDSYSWLDPSTLVACVVPSARGPPPKKP  181

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
             L P  PKV  NE+K ++Q RT+QD
Sbjct  182   LTPPSPKVLMNEEKRVVQNRTYQD  205



>gb|EPS59919.1| hypothetical protein M569_14885 [Genlisea aurea]
Length=198

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  396  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
            +LGN YRLP  EIRDIVDAPP+P L+  P++DKILFLKR SLP L+DLARPE KLAG+RI
Sbjct  40   SLGNGYRLPVQEIRDIVDAPPLPNLTLPPRKDKILFLKRNSLPNLADLARPEEKLAGLRI  99

Query  576  DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
            DGK   RSRMS YTGI ++Q+LED TLGPE+ I GLP  AKINFVTWSN+G YLAF++R 
Sbjct  100  DGKSYCRSRMSSYTGISVYQILEDYTLGPEREISGLPSGAKINFVTWSNDGSYLAFAIRT  159

Query  756  eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFD  869
             E++ SSS L +WVAD++ G ARPLF++ D+ LNA+FD
Sbjct  160  NEDDGSSSMLRLWVADMDAGNARPLFKAADICLNAVFD  197



>gb|EMT02117.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=822

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 132/203 (65%), Gaps = 37/203 (18%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI++IVD PP  +   SP+RD+I+FLKRR++PPLS+LA+P+  LAGIRID  CN
Sbjct  10    YRLPPKEIQEIVDVPPNASYHLSPRRDRIMFLKRRAMPPLSELAKPDKILAGIRIDSSCN  69

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              RSRMS                                      +G  +AF+VR E+E  
Sbjct  70    MRSRMS-------------------------------------PDGQNVAFTVRYEDEAG  92

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPL  950
             S S L +WVA+ E+G ARPLF+ TD+ LNAIF+ FVWV+ STLLVC IP SRGD PKKPL
Sbjct  93    SDSNLALWVANAESGEARPLFRQTDIRLNAIFELFVWVDHSTLLVCIIPSSRGDSPKKPL  152

Query  951   VPSGPKVQSNEQKSIIQVRTFQD  1019
             VP GP+++SNEQ ++IQ+R  ++
Sbjct  153   VPFGPRIRSNEQNNVIQMRATKE  175



>gb|EEC75088.1| hypothetical protein OsI_11240 [Oryza sativa Indica Group]
Length=887

 Score =   178 bits (451),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 3/112 (3%)
 Frame = +3

Query  411  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  77   YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGYSN  136

Query  591  SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVT---WSNNGHYL  737
            +RSRMSFYTGIGIH+L++DGTLGPEK++HG PE A+INFVT   W NN   L
Sbjct  137  TRSRMSFYTGIGIHKLMDDGTLGPEKVVHGYPEGARINFVTCFVWVNNSTLL  188


 Score = 88.6 bits (218),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  873   FVWVNDSTLLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             FVWVN+STLLVCTIPLSRG PP+KP VPSGPK+QSNE  +++QVRTFQD
Sbjct  179   FVWVNNSTLLVCTIPLSRGAPPQKPSVPSGPKIQSNETSNVVQVRTFQD  227



>ref|XP_005642798.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE18254.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
Length=824

 Score =   172 bits (435),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 132/208 (63%), Gaps = 7/208 (3%)
 Frame = +3

Query  417   LPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRS-LPPLSDLARPEVKLAGIRIDGKCNS  593
             LPP EI D+VD PP P LSFSP R ++L L R   LPP+S++ARPE+KLAG+RID + NS
Sbjct  2     LPPQEIIDLVDVPPEPNLSFSPDRTQVLQLYRPPPLPPISEVARPELKLAGLRIDAETNS  61

Query  594   RSRMSFYTGIGIHQLLEDGTLGPEKL----IHGLPERAKINFVTWSNNGHYLAFsvrvee  761
              SRM +Y G+ I Q+ +D  L   K     I G PE   IN V+WS +G ++AF+VR   
Sbjct  62    GSRMGYYLGLSIVQMTDDLVLPAPKERTTPIVGYPEGLWINLVSWSQDGRHIAFTVRSPG  121

Query  762   eensssK--LTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDP  935
               +   +  L +WVA+  TG AR L +S +  L++IFD+++WV++ T+    IP  RG P
Sbjct  122   GPSDPPRQPLELWVAETATGQARRLLKSPEQGLSSIFDDYMWVDNDTIGAVVIPPGRGPP  181

Query  936   PKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P+KPLVP GP +Q N      Q RT+ D
Sbjct  182   PEKPLVPIGPNIQDNTSGKTSQARTYPD  209



>gb|KDO41281.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=595

 Score =   167 bits (423),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  603   MSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensss-  779
             M F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N SS 
Sbjct  1     MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC  60

Query  780   KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPS  959
             KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIP SR DPPKK +VP 
Sbjct  61    KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL  120

Query  960   GPKVQSNEQKSIIQVR  1007
             GPK+QSNEQK+II  R
Sbjct  121   GPKIQSNEQKNIIISR  136



>gb|KDO41280.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=616

 Score =   167 bits (423),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  603   MSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensss-  779
             M F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N SS 
Sbjct  1     MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC  60

Query  780   KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPS  959
             KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIP SR DPPKK +VP 
Sbjct  61    KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL  120

Query  960   GPKVQSNEQKSIIQVR  1007
             GPK+QSNEQK+II  R
Sbjct  121   GPKIQSNEQKNIIISR  136



>gb|KDO41279.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=607

 Score =   167 bits (422),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  603   MSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensss-  779
             M F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N SS 
Sbjct  1     MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC  60

Query  780   KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPS  959
             KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIP SR DPPKK +VP 
Sbjct  61    KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL  120

Query  960   GPKVQSNEQKSIIQVR  1007
             GPK+QSNEQK+II  R
Sbjct  121   GPKIQSNEQKNIIISR  136



>gb|KDO41276.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=706

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  603   MSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensss-  779
             M F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N SS 
Sbjct  1     MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC  60

Query  780   KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPS  959
             KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIP SR DPPKK +VP 
Sbjct  61    KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL  120

Query  960   GPKVQSNEQKSIIQVR  1007
             GPK+QSNEQK+II  R
Sbjct  121   GPKIQSNEQKNIIISR  136



>gb|KDO41277.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=744

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  603   MSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensss-  779
             M F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N SS 
Sbjct  1     MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC  60

Query  780   KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPS  959
             KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIP SR DPPKK +VP 
Sbjct  61    KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL  120

Query  960   GPKVQSNEQKSIIQVR  1007
             GPK+QSNEQK+II  R
Sbjct  121   GPKIQSNEQKNIIISR  136



>gb|KDO41278.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=751

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  603   MSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensss-  779
             M F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N SS 
Sbjct  1     MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC  60

Query  780   KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPS  959
             KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIP SR DPPKK +VP 
Sbjct  61    KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL  120

Query  960   GPKVQSNEQKSIIQVR  1007
             GPK+QSNEQK+II  R
Sbjct  121   GPKIQSNEQKNIIISR  136



>gb|KDO41275.1| hypothetical protein CISIN_1g004456mg [Citrus sinensis]
Length=752

 Score =   167 bits (422),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  603   MSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeensss-  779
             M F+TGIGIH+LL D +LGPEK +HG P+ AKINFV+WS +G  +AFSVRV+EE+N SS 
Sbjct  1     MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC  60

Query  780   KLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDPPKKPLVPS  959
             KL VW+AD ETG A+PLF+S D+ LNA+F +FVWVN+STLL+ TIP SR DPPKK +VP 
Sbjct  61    KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL  120

Query  960   GPKVQSNEQKSIIQVR  1007
             GPK+QSNEQK+II  R
Sbjct  121   GPKIQSNEQKNIIISR  136



>gb|KIY94927.1| hypothetical protein MNEG_13035 [Monoraphidium neglectum]
Length=511

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 118/216 (55%), Gaps = 26/216 (12%)
 Frame = +3

Query  375   PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKR-RSLPPLSDLARPE  551
             PS +   A G+ YR PPPEI  IVDAPP P+LSFSP R  +L L+R  SLPP+S+++RPE
Sbjct  28    PSSNGAAAPGSGYRQPPPEILQIVDAPPQPSLSFSPDRRLLLQLQRPPSLPPISEISRPE  87

Query  552   VKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGH  731
             +KLAGIRID +  SRSRM + T + I    E                     +  S N  
Sbjct  88    LKLAGIRIDAEQFSRSRMGYNTSLAIVSADE---------------------MVPSTNAR  126

Query  732   YLAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCT  911
              +         +     LT+WVADV T TARP  +     LN +FD++ WV+D+T++ C 
Sbjct  127   EIT--GPGGPSDPPRGPLTLWVADVATCTARPALEGRS--LNTVFDSYSWVDDTTIVACC  182

Query  912   IPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             IP     PP++P  P GPKVQ N      Q RT+ D
Sbjct  183   IPEGVSSPPQRPPAPLGPKVQDNTAARKSQNRTYAD  218



>ref|XP_007510843.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18376.1| predicted protein [Bathycoccus prasinos]
Length=1001

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 126/228 (55%), Gaps = 16/228 (7%)
 Frame = +3

Query  384   DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFL-KRRSLPPLSDLARPEVKL  560
             +D E    +Y++PP +I   V  P  P++S SP R ++L+  K +  PP+++LAR E+KL
Sbjct  96    NDHEEASTKYKIPPDDISVFVTRPDAPSISLSPSRTQVLYSHKPKDNPPVAELARKELKL  155

Query  561   AGIRIDGKCNSRSRMSFYTGIGIHQLLE-DGTLGPEKLIHGLPERAKINFVTWSNNGHYL  737
              GIRID K NS SRM     + I +  + +  +G  + I GLPE   INFV+WS NG  L
Sbjct  156   GGIRIDTKQNSSSRMGHTVKLSIGKFPKTEADIGAYEDITGLPENGLINFVSWSPNGKKL  215

Query  738   AFs------------vrveeeensssKLTVWVADVETGTARPLFQSTDVY-LNAIFDNFV  878
             AF+                        L +W+ADV T +A+ +    + Y LN IF+++ 
Sbjct  216   AFTVRFHGDEHEDEDESPSSSATGRKPLELWIADVATKSAQKITSLAENYQLNTIFESYS  275

Query  879   WVNDSTLLVCTIPLSR-GDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             W+ND  LL C IP  R  + PK+P  P GP+++SN   ++ Q RT+ D
Sbjct  276   WLNDDELLCCVIPKDRPKNAPKRPKTPLGPRIESNVAGNVRQARTYAD  323



>ref|XP_010679383.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=764

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  717   SNNGHYLAFsvrveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST  896
             + +G +LAF+VRV+E++  +SKL +WVA+VETG A+PLF S D+Y+NA+FDNFVWV+ ST
Sbjct  10    ATDGRHLAFTVRVDEDDGGNSKLQIWVANVETGQAKPLFLSADIYVNAVFDNFVWVDAST  69

Query  897   LLVCTIPLSRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             LLVCTIP SRGDPPKKPLVP GPK+QSNEQK+ IQ+RTFQD
Sbjct  70    LLVCTIPSSRGDPPKKPLVPPGPKIQSNEQKNTIQLRTFQD  110



>ref|XP_003057252.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58897.1| predicted protein [Micromonas pusilla CCMP1545]
Length=877

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 122/210 (58%), Gaps = 7/210 (3%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRS-LPPLSDLARPEVKLAGIRIDG  581
             ++Y++PPP++   V+ P  P LS SP R  +L+  R    P +S+LARPE+KLAG+RID 
Sbjct  25    DRYKMPPPDVAQFVERPQSPGLSLSPDRSSLLYSFRPPPYPFVSELARPELKLAGLRIDE  84

Query  582   KCNSRSRMSFYTGIGIHQL-LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrve  758
               NSRSRMS  TGI +  +   +  +   +   G+P  A +N+V+WS +   +AF+VR  
Sbjct  85    TQNSRSRMSGQTGIALGPIPATEDEINAFQDFKGVPPGATLNYVSWSTDAKSIAFTVRFA  144

Query  759   eeensssKLT---VWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRG  929
               +          +WVADVET   R L       LN +F+++ W++  T++ C +P  RG
Sbjct  145   GPDVPDEDRAPPELWVADVETKQCRALLPGRG--LNTLFESYSWLDPDTIVACVVPEGRG  202

Query  930   DPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
               P+KP  P GP+VQSN   ++ Q RT+ D
Sbjct  203   GRPQKPPTPRGPRVQSNTSGNVAQARTYAD  232



>emb|CEF98925.1| Peptidase S9, prolyl oligopeptidase, catalytic domain [Ostreococcus 
tauri]
Length=917

 Score =   140 bits (352),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 122/216 (56%), Gaps = 7/216 (3%)
 Frame = +3

Query  387   DDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFL-KRRSLPPLSDLARPEVKLA  563
             DD +    YR PP ++    + P  P ++ SP R ++LFL K   LPP+S LA  EVKL 
Sbjct  54    DDASDAGGYRRPPDDLTQFTERPASPNVTLSPDRSRLLFLHKPPPLPPVSTLALEEVKLG  113

Query  564   GIRIDGKCNSRSRMSFYTGIGIHQL-LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLA  740
             G+R+D   NS SRM   T + +  +  +D  +G  +   G+PE A +N+V+WS  G  +A
Sbjct  114   GVRVDPAQNSSSRMGHQTKLSMGAMPTKDEEIGVSEEFKGIPENALLNYVSWSPGGTKIA  173

Query  741   FsvrveeeensssK--LTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTI  914
             F+ R   E     +  L +W+AD  T   + L    D  LN +F+++ W++D T++ C I
Sbjct  174   FTTRSSGEPGEPERGPLKLWIADANTLECKVLL--PDRGLNTVFESYSWLDDDTIVACCI  231

Query  915   PLSR-GDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P +R  D PK+P  P GP++QSN   ++ Q RT+ D
Sbjct  232   PKNRPNDAPKRPQTPFGPRIQSNRGGNVAQARTYAD  267



>ref|XP_001419477.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97770.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=835

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 118/208 (57%), Gaps = 7/208 (3%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFL-KRRSLPPLSDLARPEVKLAGIRIDGKC  587
             YR PP  +    + P  P ++ SP R ++L+L K   LP ++ LAR EVKLAG+RID   
Sbjct  2     YRRPPDALTQFTERPQSPNVTVSPDRRRLLYLHKPPPLPDVATLAREEVKLAGVRIDAAQ  61

Query  588   NSRSRMSFYTGIGIHQL-LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
             NS SRM   T + I  +   +  +G  +   G PE A IN+V+WS +G  +AF+ R   E
Sbjct  62    NSTSRMGHQTKLAIGAMPAREEEIGAAEDFVGTPENALINYVSWSPDGTKIAFTTRSSGE  121

Query  765   ensssK--LTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSR-GDP  935
                  +  LT+W+AD  T   R L    D  LN IF+++ W+ND  ++ C IP +R  + 
Sbjct  122   PGEPERGPLTLWIADAHTRQCRVLL--PDRGLNTIFESYSWLNDDVIVACCIPENRPKEA  179

Query  936   PKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             PK+P  P GP++Q+N   ++ Q RT+ D
Sbjct  180   PKRPQTPFGPRIQTNRGGNVAQARTYAD  207



>ref|WP_015265145.1| prolyl oligopeptidase family protein [Echinicola vietnamensis]
 gb|AGA77581.1| prolyl oligopeptidase family protein [Echinicola vietnamensis 
DSM 17526]
Length=810

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 123/204 (60%), Gaps = 15/204 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  I+++V+AP  P++ FS + D +L L+R     L ++++PE+++ GIRI+ K N
Sbjct  32    YKAPPQAIQELVNAPVTPSVYFSKKGDIMLILERPGYKSLKEVSQPELRIGGIRINPKTN  91

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SR S Y+GI + ++      G E  I GLPE AKI+ ++WS++  YLAF         
Sbjct  92    GPSRSSSYSGIKVKEVKS----GEETAITGLPEDAKISGISWSDDEQYLAF------GLV  141

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDSTLLVCTIPLSRGDPPKKP  947
                 +++WVA++ T TA+PL   TD  +N ++   F W+ D++LLV  I  SRG+ P+KP
Sbjct  142   GDEGISLWVANLATKTAKPL---TDEIINDVYGTAFTWLPDNSLLVKAINPSRGEMPEKP  198

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
              VPS P +Q+    +    RT+QD
Sbjct  199   SVPSSPIIQATSGNAAPS-RTYQD  221



>ref|WP_035401763.1| aminoacyl peptidase [Chlorobium sp. GBChlB]
Length=805

 Score =   128 bits (321),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 119/213 (56%), Gaps = 20/213 (9%)
 Frame = +3

Query  399   LGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRID  578
             L + Y+LPP  I DIVDAPP P LS SP+ D  L L+R SLPP+S+LA PE++LAGIRI+
Sbjct  15    LQSGYKLPPKAIADIVDAPPTPLLSVSPKNDVALVLERSSLPPISELAAPELRLAGIRIN  74

Query  579   GKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrve  758
              +   RSR  ++T + I  +      G E++I GLP   +I    WS++G  +AF++ VE
Sbjct  75    PRTFGRSRAPYFTKLTIKDIAS----GKERVISGLPPNPRIGSPRWSSDGKQVAFTLTVE  130

Query  759   eeensssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTIP-----L  920
                     + +W AD+   +A+ L +     LN I+  +F W++D   LV  +       
Sbjct  131   NG------IELWTADLGDASAKRLIEPM---LNDIYGASFAWLSDGKTLVAKVRPDKFMS  181

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
              +   P  P VP GP +Q N  K+ +   TFQD
Sbjct  182   EKRQMPDAPSVPDGPTIQENTGKA-LAAPTFQD  213



>gb|KER10044.1| aminoacyl peptidase [Chlorobium sp. GBChlB]
Length=820

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 120/213 (56%), Gaps = 20/213 (9%)
 Frame = +3

Query  399   LGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRID  578
             L + Y+LPP  I DIVDAPP P LS SP+ D  L L+R SLPP+S+LA PE++LAGIRI+
Sbjct  30    LQSGYKLPPKAIADIVDAPPTPLLSVSPKNDVALVLERSSLPPISELAAPELRLAGIRIN  89

Query  579   GKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrve  758
              +   RSR  ++T + I    +D   G E++I GLP   +I    WS++G  +AF++ VE
Sbjct  90    PRTFGRSRAPYFTKLTI----KDIASGKERVISGLPPNPRIGSPRWSSDGKQVAFTLTVE  145

Query  759   eeensssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTIP-----L  920
                     + +W AD+   +A+ L +     LN I+  +F W++D   LV  +       
Sbjct  146   NG------IELWTADLGDASAKRLIEPM---LNDIYGASFAWLSDGKTLVAKVRPDKFMS  196

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
              +   P  P VP GP +Q N  K+ +   TFQD
Sbjct  197   EKRQMPDAPSVPDGPTIQENTGKA-LAAPTFQD  228



>ref|WP_045690483.1| hypothetical protein, partial [Hymenobacter sp. AT01-02]
Length=580

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 116/206 (56%), Gaps = 10/206 (5%)
 Frame = +3

Query  408   QYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKC  587
             +Y+ PP  ++D++ APP P +S +     +  L+ +  P +++LA+PE++LAG+RI+ + 
Sbjct  23    KYQTPPKALQDLLLAPPTPRVSLASNGRTMALLQVQDFPTVAELAQPELRLAGLRINPRT  82

Query  588   NSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeee  767
             N +SR+S+  GI +  L      G E  + GLP +A+I+ V+WS +   +AF        
Sbjct  83    NGQSRVSYAVGIKLKTL----PTGAEIEVKGLPVQARISDVSWSPDNKTIAF-ALTNPGA  137

Query  768   nsssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPK  941
              +  ++ +WV DV T TAR L  +    LN  F N F WV+DS T++ CT+P  RG  P 
Sbjct  138   GTDGRVELWVVDVATATARRLLATP---LNDAFGNSFDWVSDSKTIVACTVPAGRGAAPS  194

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
                 P+GP VQ +        RT+QD
Sbjct  195   ADTAPTGPAVQESGGGIKTAARTYQD  220



>ref|WP_033370232.1| aminoacyl peptidase, partial [Hymenobacter norwichensis]
Length=820

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 116/206 (56%), Gaps = 10/206 (5%)
 Frame = +3

Query  408   QYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKC  587
             +Y+ PP  ++D++ APP P +S +     +  L+ +  P +++LA+PE++LAG+R++ + 
Sbjct  31    KYQTPPKALQDLLLAPPTPRVSLASNGRTMALLQVQDFPTVAELAQPELRLAGLRMNPRT  90

Query  588   NSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeee  767
             N +SR+S+  GI +  L      G E  + GLP +A+I+ V+WS +   +AF        
Sbjct  91    NGQSRVSYAVGIKLKTLPN----GAEIEVKGLPAQARISDVSWSPDNKTIAF-ALTVPGS  145

Query  768   nsssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPK  941
              +  ++ +W+ADV   TAR L  +    LN  F N F WV+DS T+L CT+P  RG  P 
Sbjct  146   GTDGRVELWIADVAGATARRLLATP---LNDAFGNSFDWVSDSKTILACTVPAGRGTAPS  202

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
                 P+GP VQ +        RT+QD
Sbjct  203   ADTAPTGPAVQESGGGIKTAARTYQD  228



>ref|XP_002954276.1| hypothetical protein VOLCADRAFT_106292 [Volvox carteri f. nagariensis]
 gb|EFJ44700.1| hypothetical protein VOLCADRAFT_106292 [Volvox carteri f. nagariensis]
Length=998

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 109/192 (57%), Gaps = 21/192 (11%)
 Frame = +3

Query  405  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR-SLPPLSDLARPEVKLAGIRIDG  581
            N Y+LPPPEI  IVDAP  P+LS+SP R   L L R  SLPP+ +++RPE+KLAG+R+D 
Sbjct  79   NGYKLPPPEIATIVDAPAQPSLSYSPDRKTFLQLTRPPSLPPILEMSRPELKLAGLRVDP  138

Query  582  KCNSRSRMSFYTGIGIHQLLEDGTLGPEKL--IHGLPERAKINFVTWSNNGHYLAFsvrv  755
               +RS+MS+YTGI I    E      +K   + G P  + IN+V+WS +G ++AF+VR 
Sbjct  139  DLYARSKMSYYTGISIVPATEVVPAPADKCRTLTGFPAGSWINYVSWSPDGTHIAFTVRS  198

Query  756  eeeensssK--LTVWVADVETGTARPLFQSTDVY----------------LNAIFDNFVW  881
                    +  L +W+AD  TGT RP  +                     LN +FD++ W
Sbjct  199  PGAPGDPPRGPLELWIADPHTGTCRPALRHPAAAAAAAAAAMPLGLPYRGLNTVFDDYAW  258

Query  882  VNDSTLLVCTIP  917
            ++D TL+   +P
Sbjct  259  LDDDTLVAAVLP  270



>ref|XP_011401392.1| putative glutamyl endopeptidase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM28377.1| putative glutamyl endopeptidase, chloroplastic [Auxenochlorella 
protothecoides]
Length=841

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 109/208 (52%), Gaps = 6/208 (3%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR-SLPPLSDLARPEVKLAGIRIDGKC  587
             Y LPPPE+  +VDAPP P LSFSP R  +L L R  S PP+S+LARPE+KLAG+RID + 
Sbjct  10    YMLPPPEMAAVVDAPPEPTLSFSPDRKMVLQLGRPPSNPPISELARPELKLAGLRIDPET  69

Query  588   NSRSRMSFYTGIGIHQLLEDGTL-GPEKLIH---GLPERAKINFVTWSNNGHYLAFsvrv  755
              SRSRMS+YT +      +   L  P    H   G+P  + IN+  WS +  ++A     
Sbjct  70    FSRSRMSYYTDLMFTPFHDALVLPAPAADCHHPTGIPPGSWINYARWSPDSRHVAL-TLR  128

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDP  935
                E +   L +W  D E+  AR +F +      +    + W++  T++   IP      
Sbjct  129   SSAEGARGPLRLWTVDTESWQAREVFPALGASTQSSSGIYDWMDSDTIIAALIPEDHPTL  188

Query  936   PKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P KP    GPKV+ N      Q RT+ D
Sbjct  189   PVKPATVGGPKVEDNSSGKKSQARTYPD  216



>ref|WP_040613448.1| peptidase S9 prolyl oligopeptidase, partial [Oceanicaulis sp. 
HTCC2633]
Length=798

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 109/206 (53%), Gaps = 16/206 (8%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             + YRLPP +I DIVDAPP P  + SP +  +L L R  LPP+S+LARP  +LAG+R+D +
Sbjct  26    DGYRLPPQDIVDIVDAPPSPFTTLSPDKRHLLLLHREGLPPVSELARPMERLAGLRLDAE  85

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
              N R       G+ +  L      G E  I   PE A ++  TWS +G   AF       
Sbjct  86    TNGRHGPRSVVGLSVIDL----DTGEETEIR-TPEDAGLSGFTWSPDGSKAAF------L  134

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
                +  + VWVAD+ TG AR +       +NA+F    W+ND+ TLLV  +   RG  P+
Sbjct  135   VTDADSIGVWVADMATGRARVIIPEG---VNAVFSALDWMNDNETLLVTLVSDERGPRPE  191

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             +  VP GP +Q         VRT+QD
Sbjct  192   RARVPDGPVIQQANGYE-APVRTYQD  216



>gb|EAP89653.1| hypothetical protein OA2633_10314 [Oceanicaulis sp. HTCC2633]
Length=816

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 109/206 (53%), Gaps = 16/206 (8%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             + YRLPP +I DIVDAPP P  + SP +  +L L R  LPP+S+LARP  +LAG+R+D +
Sbjct  26    DGYRLPPQDIVDIVDAPPSPFTTLSPDKRHLLLLHREGLPPVSELARPMERLAGLRLDAE  85

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
              N R       G+ +  L      G E  I   PE A ++  TWS +G   AF       
Sbjct  86    TNGRHGPRSVVGLSVIDL----DTGEETEIR-TPEDAGLSGFTWSPDGSKAAF------L  134

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
                +  + VWVAD+ TG AR +       +NA+F    W+ND+ TLLV  +   RG  P+
Sbjct  135   VTDADSIGVWVADMATGRARVIIPEG---VNAVFSALDWMNDNETLLVTLVSDERGPRPE  191

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             +  VP GP +Q         VRT+QD
Sbjct  192   RARVPDGPVIQQANGYE-APVRTYQD  216



>ref|XP_002500610.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61868.1| predicted protein [Micromonas sp. RCC299]
Length=865

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 125/208 (60%), Gaps = 7/208 (3%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPL-SDLARPEVKLAGIRIDGKC  587
             YR+PPPE+   V+ P  P++S SP RD++L+L R    PL S+LARPE+KLAG+RID   
Sbjct  29    YRMPPPEVAQFVERPQNPSISISPMRDQLLYLMRPPPYPLVSELARPELKLAGMRIDETQ  88

Query  588   NSRSRMSFYTGIGIHQL-LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
             NSRSRMS  TGI I  +   +  +   +   GLP+ A +N+V+W  +  ++AF+VR    
Sbjct  89    NSRSRMSGNTGIAIGPMPTSEEEINSFEHFDGLPDGATLNYVSWGVDARHIAFTVRFAGP  148

Query  765   ensssKLT---VWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRGDP  935
             E   +      +W+ADV T   RPL       LN +F+++ W++  T++ C +P  R   
Sbjct  149   EVPETDRAPPELWIADVTTRACRPLLPGRG--LNTLFESYSWLDKDTIVACVVPAGRPPR  206

Query  936   PKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P++P  P GP+VQ+N   ++ Q RT+ D
Sbjct  207   PQRPPTPPGPRVQTNFGGNVAQARTYAD  234



>ref|WP_011644979.1| peptidase S9 prolyl oligopeptidase [Maricaulis maris]
 gb|ABI67335.1| glutamyl peptidase, Serine peptidase, MEROPS family S09D [Maricaulis 
maris MCS10]
Length=815

 Score =   124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 109/204 (53%), Gaps = 16/204 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI DIVDA P P  S SP RD +L + R +LPP+++LARP  +LAG+R+D   N
Sbjct  29    YRLPPQEIIDIVDAAPSPWTSLSPARDTLLLMHREALPPVAELARPMERLAGLRLDATLN  88

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              R       G+ +  L      G E+ +  LP  A I+  +WS +G  +AF         
Sbjct  89    GRHGPRSVIGLSLVDL----ESGEEREVS-LPADAGISSTSWSPDGSQIAF------VMT  137

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
              + +L++WV DVE   AR L    D  +NA+F    W+ D   LLV  +   RG  P++P
Sbjct  138   RNDQLSLWVVDVERARAREL---VDGGINAVFSPLGWMPDGERLLVSLVDPERGPMPERP  194

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
              VPSGP  Q         VRT+QD
Sbjct  195   RVPSGPVTQEASGYE-APVRTYQD  217



>ref|WP_029944702.1| hypothetical protein, partial [Cloacimonetes bacterium JGI 0000014-K11]
Length=679

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 122/206 (59%), Gaps = 17/206 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP EI D+VDA   P +   P+   +L L+R SLPP+ +L +P++KLAG+RI+ K N
Sbjct  38    YQLPPKEIIDLVDAHLTPLIRIDPKIKWMLLLERPSLPPIEELTKPDLKLAGLRINPKTN  97

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              +S   +YT I +H +  DG +  EK I   P+   I  V+WS +G  +AF++  +    
Sbjct  98    GKSTTYYYTNIKLHSI--DGKV--EKQIINFPKNPLIENVSWSPDGEKIAFTITKKNG--  151

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN--FVWVNDS-TLLVCTIPLSRGDPPK  941
                 + +W A V+T  A+ L   TD  L+  +    + W++DS TL+  +I  +RG+PP+
Sbjct  152   ----IELWFAYVKTCKAKKL---TDAILSNTYYGAPYTWLSDSNTLIYKSIVENRGEPPE  204

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             + LVPSGP +Q +  K    VRT+QD
Sbjct  205   ESLVPSGPVIQESTGKK-SPVRTYQD  229



>ref|WP_029952658.1| MULTISPECIES: aminoacyl peptidase [unclassified Cloacimonetes]
Length=819

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 122/206 (59%), Gaps = 17/206 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP EI D+VDA   P +   P+   +L L+R SLPP+ +L +P++KLAG+RI+ K N
Sbjct  38    YQLPPKEIIDLVDAHLTPLIRIDPKIKWMLLLERPSLPPIEELTKPDLKLAGLRINPKTN  97

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              +S   +YT I +H +  DG +  EK I   P+   I  V+WS +G  +AF++  +    
Sbjct  98    GKSTTYYYTNIKLHSI--DGKV--EKQIINFPKNPLIENVSWSPDGEKIAFTITKKNG--  151

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN--FVWVNDS-TLLVCTIPLSRGDPPK  941
                 + +W A V+T  A+ L   TD  L+  +    + W++DS TL+  +I  +RG+PP+
Sbjct  152   ----IELWFAYVKTCKAKKL---TDAILSNTYYGAPYTWLSDSNTLIYKSIVENRGEPPE  204

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             + LVPSGP +Q +  K    VRT+QD
Sbjct  205   ESLVPSGPVIQESTGKK-SPVRTYQD  229



>ref|WP_039718325.1| peptidase S9 prolyl oligopeptidase [Scytonema millei]
 gb|KIF12997.1| peptidase S9 prolyl oligopeptidase [Scytonema millei VB511283]
Length=817

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 113/206 (55%), Gaps = 20/206 (10%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP ++ DIVDAP  P  S SP RD +L + R +LPP+S+LARP  +LAG+R+D   N
Sbjct  30    YRLPPQDVVDIVDAPLPPFPSLSPNRDTLLLMHREALPPVSELARPMERLAGLRLDAATN  89

Query  591   SRSRMSFYTGIGIHQL--LEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
              R       G+ +  L  LE+ T+        LP  + I+  TWS +G  +AF       
Sbjct  90    GRHGPRSVVGLSVMDLDTLEERTI-------ALPADSGISNTTWSPDGTEIAF------V  136

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPK  941
                   L++WVAD+ET TAR L  S    +NA+F    W+ D   LLV   P SRG  P+
Sbjct  137   MTRGDTLSLWVADLETATARELVPSG---INAVFSPVSWMPDGEHLLVHLTPDSRGALPE  193

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             +P VPSGP  Q        QVRT+QD
Sbjct  194   RPRVPSGPVTQEASGVE-AQVRTYQD  218



>ref|WP_018479746.1| glutamyl peptidase [Pontibacter roseus]
Length=823

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 118/206 (57%), Gaps = 17/206 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  I  I+DAP  P +S + + D +L L+R   P + +LA+PE +LAG+RI+   N
Sbjct  42    YQRPPEAIASIIDAPSTPGVSINSKGDWMLLLERAGYPSIEELAQPESRLAGLRINPATN  101

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              +SR +F   I + Q+      G E  ++GLP+ A+I++VTWS +   LAF+V   +   
Sbjct  102   GQSRAAFINNIKLKQV----NGGQEFQLNGLPQNAQISYVTWSPDEKQLAFTVTTAQG--  155

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN--FVWVNDS-TLLVCTIPLSRGDPPK  941
                 + +WVA +    A+ L ++T   LN  +    F W++DS +LLV  +   RG+ PK
Sbjct  156   ----IELWVAGIADRQAKKLTEAT---LNDAYSGRPFSWMSDSKSLLVKFVDEKRGEMPK  208

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
               LVP+GP +Q N  K+    RT+QD
Sbjct  209   ANLVPAGPNIQQNIGKANPS-RTYQD  233



>ref|WP_017733953.1| hypothetical protein [Nafulsella turpanensis]
Length=820

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 113/207 (55%), Gaps = 17/207 (8%)
 Frame = +3

Query  408   QYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKC  587
             +Y+ PP  I DI++AP  P +    +   +L L+    P + ++++PE+++AG+RI+   
Sbjct  38    RYQTPPKAIADIIEAPETPEVMIDSKGKTMLLLEENGYPTIEEVSQPELRIAGLRINPAT  97

Query  588   NSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeee  767
             N  SR S+Y+GI +  +      G E  + GLPE A+I+ V+WS N  Y+AF+    +  
Sbjct  98    NGGSRQSYYSGIKVKNI----ASGKEYALKGLPENARISSVSWSPNEEYVAFTNTTNKG-  152

Query  768   nsssKLTVWVADVETGTARPLFQSTDVYLNAIFDN--FVWVNDST-LLVCTIPLSRGDPP  938
                  + +W+A +E  TARPL   T+  LN  +    F W  DS  L+  +I  +RG+ P
Sbjct  153   -----IELWIASLEDRTARPL---TEAKLNDAYYGRPFAWQPDSKGLIYKSIADNRGERP  204

Query  939   KKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             +K   P GP VQ N    +   RT+QD
Sbjct  205   EKSQAPEGPIVQEN-TGGVAPSRTYQD  230



>ref|WP_027069324.1| aminoacyl peptidase [Lysobacter defluvii]
Length=814

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 118/208 (57%), Gaps = 14/208 (7%)
 Frame = +3

Query  402   GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  581
             G+ Y+LP P ++ +VDAP  P  S SP+RD + F++  SLP +  +A+ E++LAG+RI  
Sbjct  29    GSGYQLPVPALQALVDAPRPPQASLSPRRDLLAFIETPSLPGIDVVAQEELRLAGMRIHP  88

Query  582   KCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrvee  761
                SRS  SF TG+ +  +  DG    E+ + GLPE+  I  + WS +  +LAF      
Sbjct  89    HTWSRSAFSFGTGLSLRAV--DGEQ--ERPVQGLPEKPAIASIAWSPDQRHLAF----SH  140

Query  762   eensssKLTVWVADVETGTARPLFQSTDVYLNAIF-DNFVWVNDSTLLVCTI-PLSRGDP  935
              + ++ ++ +W+ DV  G+AR L       LNA+    F W+ DS  L+ T+ P   G P
Sbjct  141   VDTAAGEVQLWLVDVAAGSARQLLAQP---LNAVAGSGFTWMPDSAGLLVTLRPAGAGAP  197

Query  936   PKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P    VP+GP +Q     ++ Q+RT+QD
Sbjct  198   PTAG-VPTGPNIQQTSGGAVQQIRTYQD  224



>ref|WP_007653415.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Pontibacter sp. BAB1700]
 gb|EJF11239.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Pontibacter sp. BAB1700]
Length=823

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/213 (37%), Positives = 118/213 (55%), Gaps = 21/213 (10%)
 Frame = +3

Query  402   GNQ----YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGI  569
             GNQ    Y+ PP  I  I+DAP  P +S + + D +L L+R   P + +LA+PE +LAG+
Sbjct  35    GNQATTGYQRPPEAIASIIDAPSTPGVSINSKGDWMLLLERAGYPSIEELAQPESRLAGL  94

Query  570   RIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsv  749
             RI+   N +SR SF   I + Q+      G E  + G+P+ A+I++VTWS +   +AF++
Sbjct  95    RINPATNGQSRASFINNIKLKQV----NGGQEFEVSGIPQNAQISYVTWSPDEKQIAFTI  150

Query  750   rveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDN--FVWVNDS-TLLVCTIPL  920
                        + +WVA +    AR L ++T   LN  +    F W+ DS +LLV  +  
Sbjct  151   TKANG------IELWVAGIADRQARKLTEAT---LNDAYSGRPFSWMPDSKSLLVKFVDE  201

Query  921   SRGDPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
              RG+ PK  LVP+GP +Q N  K+    RT+QD
Sbjct  202   KRGEMPKANLVPTGPNIQENIGKANPS-RTYQD  233



>ref|WP_029945099.1| hypothetical protein, partial [Aminicenantes bacterium SCGC AAA252-P13]
Length=232

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 116/205 (57%), Gaps = 17/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26    YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             SR   +FYT +    +++D   G E+ +  LPE AK  F  WS +G + AF+  ++    
Sbjct  86    SRQVTTFYTRL----VIKDIKTGSERRV-SLPEGAKFGFPYWSYDGKWAAFTRYLDNG--  138

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRGDPPKK  944
                 + +W  +++TG A+ L   T   +NA     F W+ D+  +L  TI  +RG PPKK
Sbjct  139   ----IELWALELKTGKAKAL---TKAVINATLGRGFQWLPDNHHILFHTILENRGSPPKK  191

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P VP GP +Q    K   +V T+QD
Sbjct  192   PDVPVGPNIQETSGK-FAKVWTYQD  215



>gb|KDD76957.1| hypothetical protein H632_c56p2 [Helicosporidium sp. ATCC 50920]
Length=883

 Score =   119 bits (299),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 106/180 (59%), Gaps = 10/180 (6%)
 Frame = +3

Query  399  LGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKR-RSLPPLSDLARPEVKLAGIRI  575
            L + Y LPPPEI +IVD  P P L  SP R  +L L +  + PP+S+L+RPE+KLAGIRI
Sbjct  46   LSHPYLLPPPEIAEIVDRVPPPRLVVSPDRRLVLQLSQPHANPPISELSRPELKLAGIRI  105

Query  576  DGKCNSRSRMSFYTGIGIHQLLEDGTL----GPEKLIHGLPERAKINFVTWSNNGHYLAF  743
            D +  SRSRMS YT + +    E  T     G  +++  LP  + INF TWS    ++AF
Sbjct  106  DPELYSRSRMSHYTALAVAPFSEAVTFPLASGQGRVLGPLPPGSWINFATWSPGSSHVAF  165

Query  744  svrveeeensssK--LTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIP  917
            ++R + +  S+ +  LT+WVAD   G AR +       LN +   + W +DSTL+ C +P
Sbjct  166  TLRSDGQPGSAPRGPLTLWVADASDGRARQVLSRP---LNTVMSGYAWADDSTLVCCALP  222



>ref|WP_007163371.1| hypothetical protein [Erythrobacter sp. NAP1]
 gb|EAQ29341.1| hypothetical protein NAP1_01175 [Erythrobacter sp. NAP1]
Length=804

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 103/210 (49%), Gaps = 18/210 (9%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A  + Y+ PPPE+ DIV   P P +S SP  D IL ++R +LPP++DLARP  KLAGIR+
Sbjct  24    AAQDGYQTPPPEVTDIVTRAPAPRVSISPDNDLILLMEREALPPVADLARPMEKLAGIRL  83

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
             D   N R     + G+     L+D   G  + I  LP  A I+ V WS +G  + F+   
Sbjct  84    DASINDRYGTRAFVGLS----LQDIATGEVRAID-LPANADISDVAWSTDGSKIVFTNTR  138

Query  756   eeeensssKLTV--WVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPLSRG  929
              +  +     T    VA + TG   P+FQS             W+   +LL   IP  RG
Sbjct  139   ADAMDVHVLNTASGAVATLMTGGVNPVFQSPS-----------WLPGGSLLTLAIPSDRG  187

Query  930   DPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
               P + L P GP +Q        Q RTFQ+
Sbjct  188   AKPIESLTPQGPAIQDASGGQEAQTRTFQN  217



>ref|WP_044014202.1| aminoacyl peptidase [Hymenobacter sp. APR13]
 gb|AII51349.1| hypothetical protein N008_05040 [Hymenobacter sp. APR13]
Length=817

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 121/205 (59%), Gaps = 16/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP  I  + + PP P +S SP    +L L  + +P ++DL++PE++LAG+RI+ + N
Sbjct  24    YQLPPKAIATLAETPPTPRVSISPDGQWMLQLDVQDMPTIADLSQPELRLAGLRINPRTN  83

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SR+++ T + + +L +    G E LI GLP  A+I+ VTWS +   +AF         
Sbjct  84    GPSRVTYATMLRLKRLPD----GKELLIQGLPANARISEVTWSPDNTKIAF------THT  133

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIF-DNFVWVNDSTLLVC-TIPLSRGDPPKK  944
             +++ + +W+ADV + +AR +    +++LN +F  ++ WV+DS  ++   I   RG+ P  
Sbjct  134   TNNHIELWLADVASASARLV---PNIFLNGVFGSSYEWVSDSKAVIARAIVGGRGEVPSA  190

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
              + P+GP +Q N  ++    RT+QD
Sbjct  191   TVAPTGPTIQENNGRTAA-ARTYQD  214



>ref|WP_020258490.1| hypothetical protein [Candidatus Aminicenans sakinawicola]
Length=802

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 117/205 (57%), Gaps = 17/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26    YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             SR   +FYTG+    +++D   G E+ +  LPE +K  F  WS +G + AF+  ++    
Sbjct  86    SRQVTTFYTGL----VIKDIKTGSERRV-SLPEESKFGFPYWSYDGKWAAFTRYLDNG--  138

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRGDPPKK  944
                 + +W  +++TG A+ L   T   +NA     F W+ D+  +L  TI  +RG PPKK
Sbjct  139   ----IELWALELKTGKAKAL---TKAVINATLGRGFQWLPDNHHILFHTILENRGSPPKK  191

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P VP GP +Q    K   +V T+QD
Sbjct  192   PDVPVGPNIQETSGK-FAKVWTYQD  215



>ref|WP_022700787.1| peptidase S9 prolyl oligopeptidase [Oceanicaulis alexandrii]
Length=816

 Score =   117 bits (293),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 104/204 (51%), Gaps = 16/204 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP EI DIVDAP  P  + SP +  +L L R  LPP+S++ARP  +LAG+R+D + N
Sbjct  28    YRLPPQEIVDIVDAPNAPYTTLSPNKRHLLLLHREGLPPISEMARPMERLAGLRLDAETN  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              R       G+ +  L      G E  I   P    ++  TWS +G   AF         
Sbjct  88    GRHGPRTVIGLSVIDL----ETGEETAIT-TPGDVGLSGFTWSPDGSRAAF------LVT  136

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
                 + VWVAD+E   AR +    D  +NA+F    W++DS TLLV      RG  P++ 
Sbjct  137   DDDSIGVWVADMERAQAREII---DEGVNAVFSALDWMSDSETLLVTLTSDERGPRPERA  193

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
              VP+GP +Q         VRT+QD
Sbjct  194   RVPTGPVIQEAAGYE-APVRTYQD  216



>ref|WP_029164535.1| hypothetical protein [Aminicenantes bacterium SCGC AAA252-O03]
Length=802

 Score =   116 bits (290),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 116/205 (57%), Gaps = 17/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26    YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             SR   +FYTG+    +++D   G E+ +  LPE AK  F  WS +G + AF+  ++    
Sbjct  86    SRQVTTFYTGL----VIKDIKTGSERRV-SLPEGAKFGFPYWSYDGKWAAFTRYLDNG--  138

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRGDPPKK  944
                 + +W  +++ G A+ L   T   +NA     F W+ D+  +L  TI  +RG PPKK
Sbjct  139   ----IELWALELKKGKAKAL---TKAVINATLGRGFQWLPDNHHILFHTILENRGSPPKK  191

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P VP GP +Q    K   +V T+QD
Sbjct  192   PDVPVGPNIQETSGK-FAKVWTYQD  215



>ref|WP_044201691.1| aminoacyl peptidase [Echinicola pacifica]
Length=796

 Score =   115 bits (289),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 115/210 (55%), Gaps = 17/210 (8%)
 Frame = +3

Query  393   EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIR  572
             E LG  Y+ PP EI +++DAP  P++SFS   D++L L+R     +  L++PE++LAGIR
Sbjct  12    EHLG--YQTPPEEIIELLDAPVTPSVSFSKSGDRMLILERPGYTSIQQLSQPELRLAGIR  69

Query  573   IDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvr  752
             I+   N  SR S YTGI I   LE G   P   + G+P  A I+  +WS +  +LA    
Sbjct  70    INPMTNGPSRSSGYTGIKIKN-LESGQAEP---LTGMPAGAHISDYSWSPDESHLAI---  122

Query  753   veeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDSTLLVCTIPLSRG  929
                       +++W+AD+ T   R L Q     LN I+   F W+++  L++  +   RG
Sbjct  123   ---SITEEKGISLWLADLSTQKVRRLTQPV---LNEIYGQAFSWLSEDKLIIKVVNPDRG  176

Query  930   DPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
               P++P+VPSGP +Q     +    RT+QD
Sbjct  177   AMPERPMVPSGPIIQET-SGAAAPSRTYQD  205



>emb|CDG85386.1| prolyl oligopeptidase family protein [Janthinobacterium agaricidamnosum 
NBRC 102515 = DSM 9628]
Length=820

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 12/208 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP  ++ IVDAP  PALS SP+R+    L+  +LP +S++A+PE+KLAG+RI+ +  
Sbjct  19    YQLPPAPLQAIVDAPRAPALSLSPKRNLAAMLQTPALPGMSEVAQPELKLAGLRINPRTY  78

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF  G+    LL+  T    K I GLP   +I  + WS + HYLAFS     E  
Sbjct  79    SASRFSFGAGL---SLLDIATQQDIK-ISGLPAALRIADLAWSPDQHYLAFSHIAYAEAA  134

Query  771   sss--KLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTI-PLSRGDPP  938
              +    + +W+ DV T  AR L       L+A++   F W+ DS  L+  + P   G+ P
Sbjct  135   GAQHPGVELWLLDVRTKVARKLAAQP---LSAVYGRGFSWLPDSKGLIVQLKPAKLGEAP  191

Query  939   KKPLVPSGPKVQSNE-QKSIIQVRTFQD  1019
             +   +P GP  Q +E   +I Q+RT+ D
Sbjct  192   RSNGIPGGPSTQDSEPGGAIRQLRTYPD  219



>ref|WP_038496716.1| aminoacyl peptidase [Janthinobacterium agaricidamnosum]
Length=829

 Score =   115 bits (288),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 117/208 (56%), Gaps = 12/208 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP  ++ IVDAP  PALS SP+R+    L+  +LP +S++A+PE+KLAG+RI+ +  
Sbjct  28    YQLPPAPLQAIVDAPRAPALSLSPKRNLAAMLQTPALPGMSEVAQPELKLAGLRINPRTY  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF  G+    LL+  T    K I GLP   +I  + WS + HYLAFS     E  
Sbjct  88    SASRFSFGAGL---SLLDIATQQDIK-ISGLPAALRIADLAWSPDQHYLAFSHIAYAEAA  143

Query  771   sss--KLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTI-PLSRGDPP  938
              +    + +W+ DV T  AR L       L+A++   F W+ DS  L+  + P   G+ P
Sbjct  144   GAQHPGVELWLLDVRTKVARKLAAQP---LSAVYGRGFSWLPDSKGLIVQLKPAKLGEAP  200

Query  939   KKPLVPSGPKVQSNE-QKSIIQVRTFQD  1019
             +   +P GP  Q +E   +I Q+RT+ D
Sbjct  201   RSNGIPGGPSTQDSEPGGAIRQLRTYPD  228



>ref|WP_014101391.1| glutamyl peptidase [Chloracidobacterium thermophilum]
 gb|AEP13653.1| glutamyl peptidase, Serine peptidase, MEROPS family S09D [Chloracidobacterium 
thermophilum B]
Length=820

 Score =   114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 117/205 (57%), Gaps = 16/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YR PP  I D+VDAP  P    SPQR+ +L   R +LPP++++A+PE++L GIR + K N
Sbjct  22    YRTPPKAIADLVDAPLPPVALLSPQRNWLLLADRPTLPPIAEVAQPELRLGGIRFNPKTN  81

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               S+ S+ TG+ + + L DGT  P   + GLP  A+++ ++WS +  +LA          
Sbjct  82    GPSQPSYLTGLTLVR-LTDGTKRP---VTGLPNPARLSDLSWSPDERFLAL------THT  131

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDSTLLVC-TIPLSRGDPPKK  944
             ++ ++ +W+ DVE    R L    D  LNAI    F W+ +S  L+C T+P  RG PP  
Sbjct  132   TTDRVELWLLDVEQAAVRRL---GDFQLNAIAGRPFQWLPNSQALLCRTVPAKRGAPPSP  188

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P  P GP VQ N  + +   RTFQD
Sbjct  189   PAAPDGPIVQENRGR-VTAARTFQD  212



>ref|WP_009280632.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Fibrisoma limi]
 emb|CCH52046.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Fibrisoma limi BUZ 3]
Length=826

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 117/205 (57%), Gaps = 16/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  + D+V+ PP P +S + + D +L L++   P + +L++PE++LAG+R++   N
Sbjct  35    YQTPPKPLADLVNVPPTPGVSVTSKGDYLLILEQALAPSIDELSQPELRLAGLRLNPANN  94

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SR+ + TG+ I ++    +   E  + GLP    I+ V WS +    AF        +
Sbjct  95    GPSRIRYITGLKIKKM----SGKDEVAVSGLPASPLISNVQWSPDETKFAF------TNS  144

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPKK  944
             + SK+ ++VADV T  AR +   +D+ LNA++   F W+ DS  LLV TIP SRG  P+ 
Sbjct  145   TDSKIELYVADVATAAARKV---SDLALNAVYGAPFRWMPDSKNLLVKTIPASRGSAPEI  201

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
               VP+GP VQ N  +   Q  TFQD
Sbjct  202   SRVPTGPTVQENMGRK-AQAPTFQD  225



>ref|WP_020264176.1| MULTISPECIES: hypothetical protein [unclassified Aminicenantes]
Length=802

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 116/205 (57%), Gaps = 17/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26    YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             SR   +FYT +    +++D   G E+ +  LPE AK  F  WS +G + AF+  ++    
Sbjct  86    SRQVTTFYTRL----VIKDIKTGSERRV-SLPEGAKFGFPYWSYDGKWAAFTRYLDNG--  138

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRGDPPKK  944
                 + +W  +++TG A+ L   T   +NA     F W+ D+  +L  TI  +RG PPKK
Sbjct  139   ----IELWALELKTGKAKAL---TKAVINATLGRGFQWLPDNHHILFHTILENRGSPPKK  191

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P VP GP +Q    K   +V T+QD
Sbjct  192   PDVPVGPNIQETSGK-FAKVWTYQD  215



>ref|WP_024891486.1| aminoacyl peptidase [Luteimonas huabeiensis]
Length=822

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 116/213 (54%), Gaps = 14/213 (7%)
 Frame = +3

Query  390   DEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGI  569
             D A    YRLPPP ++ +VDAP  P LS SP+RD   +L+  +LP +  +A+PE++L G+
Sbjct  21    DVAAEAGYRLPPPALQALVDAPRPPRLSLSPRRDLAAYLRTPALPGIEAVAQPELRLGGL  80

Query  570   RIDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsv  749
             RI  +  + SR SF   +     L+D   G E+ I GLP+   I+ + WS +  ++AF  
Sbjct  81    RIHPRTYAASRFSFADDL----WLQDIDSGQERRIAGLPQPLAIDAMAWSPDQRHIAF--  134

Query  750   rveeeensssKLTVWVADVETGTARPLFQSTDVYLNAIF-DNFVWVNDST-LLVCTIPLS  923
                + +  + ++ +W+ DV    AR L +     LN +  D F W+ D   LLV   P  
Sbjct  135   --TQVDVRAGRVELWLVDVAALRARRLLEQA---LNTVAGDGFGWLPDGQGLLVQLRPQG  189

Query  924   RGDPPKKPLVPSGPKVQSNEQKSIIQ-VRTFQD  1019
             +G PP    +P+GP +Q  +    +Q +RT+QD
Sbjct  190   QGAPPADDGIPTGPNIQQTDGGGGVQSLRTYQD  222



>ref|WP_038690478.1| aminoacyl peptidase [Stenotrophomonas rhizophila]
 gb|AHY60278.1| aminoacyl peptidase [Stenotrophomonas rhizophila]
Length=841

 Score =   114 bits (285),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 113/211 (54%), Gaps = 14/211 (7%)
 Frame = +3

Query  396   ALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIR  572
             A G Q Y LP   ++ +VDAP  P LS SP+RD    L+  SLP ++++A+PE+KLAG+R
Sbjct  44    AKGEQGYALPSAALQAVVDAPRAPTLSLSPRRDIAAMLQTPSLPSIAEVAQPELKLAGLR  103

Query  573   IDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvr  752
             I+   ++ SR SF   + +  + +    G E+ I GLP+   I  + WS +  YLAF+  
Sbjct  104   INPATHAASRFSFGNKLWLLNVAD----GKERQITGLPQPLSIAGMAWSPDQQYLAFNQV  159

Query  753   veeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDSTLLVCTIPL-SRG  929
                   +     +W+ D+  G+AR L    +  L    D + W+ DS  LV T     +G
Sbjct  160   HAASGAN----ELWIVDIAAGSARRLLSDLNTVLG---DGYTWLPDSRGLVVTQQRKGQG  212

Query  930   DPPKKPLVPSGPKVQSNEQKSIIQ-VRTFQD  1019
               P    VP+GP +Q  E  + ++ +RT+QD
Sbjct  213   PAPAAGGVPAGPAIQQTEADAGVRAIRTYQD  243



>ref|WP_043629145.1| aminoacyl peptidase [Chromobacterium piscinae]
 gb|KIA79185.1| aminoacyl peptidase [Chromobacterium piscinae]
Length=810

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 110/209 (53%), Gaps = 15/209 (7%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A  + Y+ PPPE+  +VDAP  P  S SPQ++ +L + R  LP ++D+A+PE+KLAG+R+
Sbjct  22    AAADGYQTPPPELAALVDAPRTPQQSLSPQQNIVLQISRPGLPSIADVAQPELKLAGLRL  81

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
             + K  + S+ +F  G+     L D   G  + I GLP R +I    W+ +G ++A     
Sbjct  82    NPKMRAYSQFNFGNGLS----LLDIASGKSRSISGLPVRPRIANHQWAADGKHVAL----  133

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNA-IFDNFVWVNDSTLLVCTIPLSRGD  932
                      + +W+ DV    AR L    D +LNA     F W+ D  LLV  +P  +G 
Sbjct  134   --SLWGDKGVELWLLDVAAARARRL---GDFHLNASTGSGFAWMGDK-LLVKMLPARQGP  187

Query  933   PPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
              P     PSGP +Q ++   + Q RT+ D
Sbjct  188   APVASASPSGPNIQESQGGKLSQTRTYPD  216



>ref|WP_012925251.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Spirosoma linguale]
 gb|ADB36699.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Spirosoma linguale DSM 74]
Length=829

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 118/205 (58%), Gaps = 15/205 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  + D+V AP  P +S S + D +L L++ + P + +LA+PE+KLAG+R++   N
Sbjct  33    YQTPPKALADLVTAPLTPTVSMSTKGDMMLILEQAAAPGIDELAQPELKLAGLRLNPANN  92

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SR  + TG+ + +L +      EK I GLP    I+FV WS +G  +AF        +
Sbjct  93    GPSRARYITGLKLKKLTDKD----EKAITGLPAEPLISFVQWSPDGTKVAF------ANS  142

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPKK  944
             + +++ +++AD  + +A+ +     + LNA   + + WV+DS +L+V T+P+ RG   + 
Sbjct  143   TDTRIDLYIADAASLSAQKV---GSLALNATMGSPYYWVSDSKSLIVKTVPVGRGAAIEV  199

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
               VPSGP  Q N + S  Q  T+QD
Sbjct  200   SRVPSGPTTQENVKGSRGQAPTYQD  224



>ref|WP_045051973.1| aminoacyl peptidase [Chromobacterium violaceum]
 gb|KJH66391.1| aminoacyl peptidase [Chromobacterium violaceum]
Length=814

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 108/204 (53%), Gaps = 15/204 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PPPE+  +VDAP  P  S +PQRD +L   R  LP ++D+A+PE+KLAG+R++ +  
Sbjct  27    YQTPPPELAALVDAPRTPLQSLNPQRDAVLQTHRPGLPAIADVAQPELKLAGLRLNPRMR  86

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR  F + +     L D   G  + + GLP R +I    WS +G  +A          
Sbjct  87    AASRFDFGSAL----TLLDVKSGKSRPVTGLPARPRIADNAWSPDGKQVAL------SLW  136

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTIPLSRGDPPKKP  947
                 + +W+ D  +  AR L    D +LNA     F W+  + LLV  +P  +G  P+KP
Sbjct  137   GDRGVELWLLDAASARARRL---GDFHLNASSGRGFAWMG-AQLLVKLLPAGQGPAPEKP  192

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
               P+GP +Q +   ++ Q RT+ D
Sbjct  193   STPTGPNIQQSAGGALSQTRTYPD  216



>gb|EJP78273.1| hypothetical protein A1OC_00641 [Stenotrophomonas maltophilia 
Ab55555]
Length=634

 Score =   113 bits (282),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (54%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  VTWS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVTWSPDQKWLAFNQVDAGS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>ref|WP_018621090.1| glutamyl peptidase [Spirosoma luteum]
Length=829

 Score =   113 bits (283),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 114/205 (56%), Gaps = 15/205 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  + D+V AP  P +S S + D +L L++ + P + +LA+PE KLAG+R++   N
Sbjct  34    YQTPPKALADLVTAPLTPTVSLSDKGDMMLILEQAAAPGIDELAQPEFKLAGLRLNPANN  93

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SR  + TG+ + ++++      EK + GLP    I+FV WS +G  +AF        +
Sbjct  94    GPSRARYITGLRLKKVMDK----EEKALTGLPATPLISFVQWSPDGSKIAF------ANS  143

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRGDPPKK  944
             + S++ +++ADV T  A+ +     V LNA     + WV+DS +L+V TIP  RG  P  
Sbjct  144   TDSRIDLYIADVATAAAQKV---GSVALNATLGVPYHWVSDSKSLIVKTIPAGRGPAPVI  200

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
               VP+GP  Q N      Q  T+QD
Sbjct  201   SAVPAGPTTQQNVGGQRGQAPTYQD  225



>ref|WP_032966434.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=837

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (54%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  VTWS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVTWSPDQKWLAFNQVDAGS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>ref|WP_034784341.1| aminoacyl peptidase [Janthinobacterium lividum]
 gb|KHA77690.1| aminoacyl peptidase [Janthinobacterium lividum]
Length=835

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 114/209 (55%), Gaps = 13/209 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  ++ IVDAP  P LS SP+R+    L   SLP +S++A+PE+KLAG+RI+ +  
Sbjct  28    YQAPPAPLQAIVDAPRAPTLSLSPKRNLAAVLPTPSLPSISEVAQPELKLAGLRINPRTY  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF+TG+G    L D     E  + GLP   +I  + WS +  YLAF+     +  
Sbjct  88    SASRFSFHTGLG----LLDIDTQKEIKVSGLPAAPRIADLAWSPDQRYLAFTHVAFADPA  143

Query  771   sssK---LTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRGDP  935
                K   + +W+ DV+T  AR L       L+A++   F W+ DS TLLV   P   G  
Sbjct  144   KGVKESGVELWLLDVQTKAARKLASQP---LSAVYGRGFSWMPDSKTLLVQLKPAKLGAA  200

Query  936   PKKPLVPSGPKVQ-SNEQKSIIQVRTFQD  1019
             P    +P+GP +Q S     + Q+RT+ D
Sbjct  201   PLASGIPTGPSIQDSVPGGGVKQLRTYPD  229



>gb|EMF62653.1| Dipeptidyl aminopeptidase [Stenotrophomonas maltophilia EPM1]
Length=835

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (54%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  41    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  100

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  VTWS +  +LAF+      
Sbjct  101   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVTWSPDQKWLAFNQVDAGS  156

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  157   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  209

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  210   ADGIPTGPAVQQTSQGGGVVSIRTYQD  236



>ref|WP_012479169.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 emb|CAQ44353.1| conserved hypothetical protein [Stenotrophomonas maltophilia 
K279a]
Length=838

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (54%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  VTWS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVTWSPDQKWLAFNQVDAGS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>gb|KIS37473.1| glutamyl endopeptidase, chloroplastic [Stenotrophomonas maltophilia 
WJ66]
Length=836

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (54%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  41    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  100

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  VTWS +  +LAF+      
Sbjct  101   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVTWSPDQKWLAFNQVDAGS  156

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  157   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  209

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  210   ADGIPTGPAVQQTSQGGGVVSIRTYQD  236



>ref|WP_043035372.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 111/207 (54%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  VTWS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVTWSPDQKWLAFNQVDAGS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>ref|WP_026069661.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=844

 Score =   113 bits (282),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 109/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y LP P ++ +VDAP  P LS SP+RD    L+   LP ++D+A+PE+KLAG+RI+   +
Sbjct  53    YELPSPALQAVVDAPRAPTLSLSPRRDLAALLQTPPLPSINDVAQPELKLAGLRINPATH  112

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF   + +  + +    G E+ I GLP+   I    WS +  Y+AF+        
Sbjct  113   SASRFSFADKLWLMNVAD----GKERQISGLPQPLSIATFAWSPDQKYIAFNQVHAATNT  168

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
             +     +W+ DV+ G+AR L    +  +    D + W  DS  LLV      +G  P   
Sbjct  169   N----ELWIVDVDAGSARRLVGDLNTVMG---DGYSWQPDSRGLLVMQQLKGQGPAPSAG  221

Query  948   LVPSGPKVQSNEQKSIIQ-VRTFQD  1019
              +P+GP +Q  E  + ++ +RT+QD
Sbjct  222   GIPTGPAIQQTEADAGVRTIRTYQD  246



>ref|WP_043397996.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   113 bits (282),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P S G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPASLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTRQGGGVVSIRTYQD  238



>ref|WP_032952310.1| aminoacyl peptidase [[Pseudomonas] geniculata]
Length=838

 Score =   113 bits (282),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P S G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPASLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTRQGGGVVSIRTYQD  238



>ref|WP_033370130.1| aminoacyl peptidase [Hymenobacter norwichensis]
Length=817

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 117/205 (57%), Gaps = 16/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y++PP  I  + + PP P +S SP    +L L  + +P +++L++PE++LAG+RI+ + N
Sbjct  24    YQMPPKAIATLAETPPTPRVSISPNGAWMLMLNVQDMPTIAELSQPELRLAGLRINPRTN  83

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SR+S+ T + + +L +    G E L+ GLP  A+I+ V WS +   +A          
Sbjct  84    GPSRVSYATALRLKRLPD----GKELLVQGLPTNARISEVNWSPDNTKIAL------THT  133

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIF-DNFVWVNDS-TLLVCTIPLSRGDPPKK  944
             +++ + +W+ DV   +AR +    +++LN IF  ++ WV+DS TLL   I   RG+ P  
Sbjct  134   TANHVELWLVDVAAASARLV---PNLFLNGIFGSSYEWVSDSKTLLARAIVGGRGEAPVV  190

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
                P+GP +Q N  ++    RT+QD
Sbjct  191   TATPTGPTIQENGGRTAA-ARTYQD  214



>ref|WP_019338085.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P S G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPASLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTRQGGGVVSIRTYQD  238



>ref|WP_029496139.1| aminoacyl peptidase [Janthinobacterium lividum]
Length=835

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 116/214 (54%), Gaps = 13/214 (6%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A  + Y+ PP  ++ IVDAP  P LS SP+R+    L   SLP +S++A+PE+KLAG+RI
Sbjct  23    AQDSAYQAPPAPLQAIVDAPRAPTLSLSPKRNLAAVLATPSLPSMSEVAQPELKLAGLRI  82

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
             + +  S SR SF+TG+G    L D     E  + GLP   +I  + WS +  YLAF+   
Sbjct  83    NPRTYSASRFSFHTGLG----LLDIDTQKEIKVSGLPVSPRIADLAWSPDQRYLAFTHIA  138

Query  756   eeeensssK---LTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPL  920
               +     K   + +W+ DV+T  AR L     V L+ ++   F W+ DS TLLV   P 
Sbjct  139   FADPAKGVKESGVQLWLLDVQTKAARKL---ASVPLSTVYGRGFSWMPDSKTLLVQLKPA  195

Query  921   SRGDPPKKPLVPSGPKVQ-SNEQKSIIQVRTFQD  1019
               G  P    +P+GP +Q S     + Q+RT+ D
Sbjct  196   KLGAAPVPSGIPTGPSIQDSVPGGGVKQLRTYPD  229



>ref|WP_026952618.1| aminoacyl peptidase [Algoriphagus mannitolivorans]
Length=804

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 114/205 (56%), Gaps = 17/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PPP I D+ +AP  P++SF+   + +L L+R   P + DLA+PE+++ GIRI+    
Sbjct  27    YQSPPPSIADLFNAPATPSVSFNKSGNLMLILERSEAPSIEDLAQPELRIGGIRINPATT  86

Query  591   SRSRM-SFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeee  767
               SR  SFY     +  L++   G E  + GLP+  K++  ++S +  YLAF        
Sbjct  87    GPSRSGSFY-----NLKLKNTRSGEEIQVTGLPQNPKMSGFSFSRDEKYLAF------TH  135

Query  768   nsssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFV-WVNDSTLLVCTIPLSRGDPPKK  944
               S+ +++WV D+ +  A+ L   TD  LN +F N V W+ D++LLV  +  SRG  PK 
Sbjct  136   TESNGISLWVVDLNSYQAKKL---TDPILNQVFGNSVTWMPDNSLLVKAVNPSRGAMPKA  192

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P  PSGP +Q     +    RT+QD
Sbjct  193   PSAPSGPVIQETSGNAAPS-RTYQD  216



>ref|WP_034753463.1| aminoacyl peptidase [Janthinobacterium lividum]
 gb|EZP38873.1| Peptidase S9 prolyl oligopeptidase catalytic domain-containing 
protein [Janthinobacterium lividum]
Length=831

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 113/209 (54%), Gaps = 13/209 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  ++ IVDAP  P LS SP+R+    L   SLP +S++A+PE+KLAG+RI+ +  
Sbjct  28    YQAPPAPLQAIVDAPRAPTLSLSPKRNLAAVLPTPSLPSISEVAQPELKLAGLRINPRTY  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF+TG+G    L D     E  + GLP   +I  + WS +  YLAF+     +  
Sbjct  88    SASRFSFHTGLG----LLDIDTQKEIKVSGLPASPRIADLAWSPDQRYLAFTHIAFADPA  143

Query  771   sssK---LTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRGDP  935
                K   + +W+ DV+T  AR L       L+ ++   F W+ DS TLLV   P   G  
Sbjct  144   KGVKESGVELWLLDVQTKAARKLGNQA---LSTVYGRGFSWLPDSKTLLVQLKPAKLGAA  200

Query  936   PKKPLVPSGPKVQ-SNEQKSIIQVRTFQD  1019
             P    +P+GP +Q S     + Q+RT+ D
Sbjct  201   PVASGIPTGPSIQDSVPGGGVKQLRTYPD  229



>ref|WP_019923325.1| hypothetical protein [Duganella zoogloeoides]
Length=830

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 118/211 (56%), Gaps = 15/211 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP  ++ IVDAP  PALS SP+RD    ++  +LP ++++A+PE+KLAG+RI+ +  
Sbjct  28    YRLPPEPLQAIVDAPRAPALSLSPRRDTAAVVQTPALPGIAEVAQPELKLAGLRINPRTY  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv-----  755
             + SR SF TG+ +  +        E  I GLP   +++ ++WS +  +LAF+        
Sbjct  88    AGSRFSFGTGLSLLDIASH----EESTIAGLPPDLRLSDLSWSPDQRHLAFTHVALNDGV  143

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDST-LLVCTIPLSRG  929
                   +  + +W+ D+    AR L       L+A+    F W+ DS+ LLV   P+  G
Sbjct  144   GGVGVDTGAVELWLVDIAARRARKLSPQP---LSAVLTRGFNWLPDSSGLLVHWRPVGIG  200

Query  930   DPPKKPLVPSGPKVQSNEQKSII-QVRTFQD  1019
              PP+   VP+GP +Q +E    + Q+RT+QD
Sbjct  201   KPPQASGVPAGPILQDSEADGAVRQLRTYQD  231



>ref|WP_040345786.1| aminoacyl peptidase, partial [Brevundimonas diminuta]
Length=352

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 110/206 (53%), Gaps = 16/206 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y  PP  I  I+DA P P +S SP R  +L   R +LP +++LA P ++LAG RI+ K N
Sbjct  37    YHQPPSPIAQILDAKPNPGVSVSPDRKTLLLTDRSNLPAIAELAEPMLRLAGYRINPKNN  96

Query  591   --SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               + SR+S+ TG+    +  DG  GP + + GLP  A++  V+W+ NG  +AF       
Sbjct  97    GPANSRVSWLTGLSFQAV--DG--GPARPVTGLPANARLTNVSWAPNGQAVAF------L  146

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPK  941
              N+ + L +W ADV    AR L  +  +   A    F W++DS+ LLV  +P  RG  P 
Sbjct  147   VNAPNGLELWTADVAQAKARKL--NGPMVNAAAGSGFSWLSDSSGLLVLAVPAGRGLAPN  204

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
                 P GP +     ++   VRT+QD
Sbjct  205   VDHPPEGPIITETGGRA-APVRTYQD  229



>ref|WP_035562151.1| aminoacyl peptidase [Hymenobacter sp. IS2118]
Length=821

 Score =   111 bits (278),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 116/206 (56%), Gaps = 10/206 (5%)
 Frame = +3

Query  408   QYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKC  587
             QY+ PP  ++D++ APP   +S S     +  L+ +  P +++L++PE++LAG+R++ + 
Sbjct  24    QYQTPPKALQDLLLAPPTSRVSLSSDGRVMALLQVQDFPTIAELSQPELRLAGLRVNPRT  83

Query  588   NSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeee  767
             N +SR+S+  GI +  L      G E  + GLP +A+I+ V+WS +   +AF        
Sbjct  84    NGQSRVSYAVGIKLKTLPN----GAEIDVKGLPAQARISSVSWSPDNKTMAF-ALTTPGS  138

Query  768   nsssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPK  941
              ++ ++ +WVADV   TAR L  +    LN  F N F WV+DS T++ CT+P  RG  P 
Sbjct  139   GTNGRVELWVADVAGATARRLLATP---LNDAFGNAFDWVSDSKTIVACTVPAGRGAAPA  195

Query  942   KPLVPSGPKVQSNEQKSIIQVRTFQD  1019
                VPSGP VQ +         T+QD
Sbjct  196   ADAVPSGPAVQESGGGKKTAAPTYQD  221



>ref|WP_021203441.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 gb|EQM80446.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia MF89]
Length=838

 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>ref|WP_014036004.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 gb|AEM49976.1| hypothetical protein BurJV3_0642 [Stenotrophomonas maltophilia 
JV3]
Length=838

 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTRQGDGVVSIRTYQD  238



>ref|WP_033834450.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   111 bits (278),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>gb|EZP47495.1| Peptidase S9 prolyl oligopeptidase active site domain protein 
precursor [Stenotrophomonas sp. RIT309]
Length=839

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 109/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ K  
Sbjct  46    YELPSAALQAVVDAPRAPSLFLSPRRDVAALMQMPSLPSIQVVAQPELKLAGLRINPKTF  105

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF   + +  + +    G E+ I GLP    I  +TWS +  +LAF+        
Sbjct  106   SDSRFSFGQKLWLMNVAD----GKERQISGLPASLSIASLTWSPDQKWLAFNQVDAATGA  161

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
             +     +W+ DV  G+AR L    +  L +    + W+ DS  L+V T P + G  P   
Sbjct  162   N----ELWLVDVAGGSARRLVAGLNTVLGS---GYQWLPDSRGLVVFTRPANLGAAPAAD  214

Query  948   LVPSGPKVQSNEQ-KSIIQVRTFQD  1019
              +P+GP VQ   Q   ++ +RT+QD
Sbjct  215   GIPTGPAVQQTSQGGGVVSIRTYQD  239



>ref|WP_017742555.1| hypothetical protein [Scytonema hofmanni]
Length=787

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 105/191 (55%), Gaps = 14/191 (7%)
 Frame = +3

Query  411  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
            ++ PP  I  I++AP  P +  SP R  ++ L++ SL  ++  A PE+ LAG+ ++ K N
Sbjct  11   WQSPPEPIAQILNAPSPPTILLSPNRQWMVELEKPSLQAIAHFAEPEIPLAGLLLNPKTN  70

Query  591  SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
            + SR+SFY  + I  +    ++G       LPE A+I ++ WS N   LAF         
Sbjct  71   ALSRLSFYQNLKIRAV----SVGDRDRTVVLPEGAQIGYIRWSPNSQKLAF------TLT  120

Query  771  sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDSTLLVCTIPLSRGDPPKKP  947
              + L +WV DV+  T++   Q T+  LNA +   + W++D  L+   IP  RG+PP KP
Sbjct  121  QDTGLELWVVDVDNLTSQ---QITEPTLNAAYGEPYRWLSDEALICKFIPTHRGEPPAKP  177

Query  948  LVPSGPKVQSN  980
             VPSGP +Q N
Sbjct  178  NVPSGPIIQEN  188



>ref|WP_025876539.1| MULTISPECIES: aminoacyl peptidase [Stenotrophomonas]
Length=838

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 109/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ K  
Sbjct  45    YELPSAALQAVVDAPRAPSLFLSPRRDVAALMQMPSLPSIQVVAQPELKLAGLRINPKTF  104

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF   + +  + +    G E+ I GLP    I  +TWS +  +LAF+        
Sbjct  105   SDSRFSFGQKLWLMNVAD----GKERQISGLPASLSIASLTWSPDQKWLAFNQVDAATGA  160

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
             +     +W+ DV  G+AR L    +  L +    + W+ DS  L+V T P + G  P   
Sbjct  161   N----ELWLVDVAGGSARRLVAGLNTVLGS---GYQWLPDSRGLVVFTRPANLGAAPAAD  213

Query  948   LVPSGPKVQSNEQ-KSIIQVRTFQD  1019
              +P+GP VQ   Q   ++ +RT+QD
Sbjct  214   GIPTGPAVQQTSQGGGVVSIRTYQD  238



>ref|WP_043614381.1| aminoacyl peptidase [Chromobacterium violaceum]
Length=814

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 107/204 (52%), Gaps = 15/204 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PPPE+  +VDAP  P  S +PQ D +L   R  LP ++D+A+PE+KLAG+R++ +  
Sbjct  27    YQTPPPELAALVDAPRTPLQSLNPQGDAVLQTHRPGLPAIADVAQPELKLAGLRLNPRMR  86

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR  F + +     L D   G  + + GLP R +I    WS +G  +A          
Sbjct  87    AASRFDFGSAL----TLLDVKSGKSRPVTGLPARPRIADNAWSPDGKQVAL------SLW  136

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTIPLSRGDPPKKP  947
                 + +W+ D  +  AR L    D +LNA     F W+  + LLV  +P  +G  P+KP
Sbjct  137   GDRGVELWLLDAASARARRL---GDFHLNASSGRGFAWMG-AQLLVKLLPAGQGPAPEKP  192

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
               P+GP +Q +   ++ Q RT+ D
Sbjct  193   STPTGPNIQQSAGGALSQTRTYPD  216



>ref|WP_026897909.1| aminoacyl peptidase [Pedobacter oryzae]
Length=805

 Score =   110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 115/205 (56%), Gaps = 16/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  I D+VDAP  P +  +     +L L++  LPP+S++A+PE+++AG+RI+   N
Sbjct  26    YQTPPQSIIDLVDAPTTPEIKLNSDGSWMLLLQKPGLPPISEVAQPELRIAGLRINPATN  85

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
              +SR +++ GI +  + ++     E    GLPE  +I+ V+WS +   +AFS        
Sbjct  86    GQSRSAYFNGIKLKSVKKN----EEFEFTGLPEILRISDVSWSPDESKIAFSNLSAYG--  139

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPKK  944
                 + +WVAD++T  A+ L +S   YLN  +   F+W   S +LL   +  +R DPP  
Sbjct  140   ----IELWVADIKTLEAKKLSES---YLNDTYGTPFIWSPGSKSLLAKFVDTNRADPPLA  192

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
              L P+GP VQ N  K+    RT+QD
Sbjct  193   DLRPTGPIVQENIGKTAPS-RTYQD  216



>ref|WP_020606187.1| glutamyl peptidase [Spirosoma spitsbergense]
Length=831

 Score =   110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 112/205 (55%), Gaps = 15/205 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  + D+V AP  P +S S + D +L L++ + P + +LA+PE KLAG+R++   N
Sbjct  36    YQTPPKALADLVTAPLTPTVSLSDKGDMMLILEQAAAPGIDELAQPEFKLAGLRLNPANN  95

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SR  + TG+ + +++       EK + GLP    I+FV WS +G  +AF        +
Sbjct  96    GPSRARYITGLKLKKVMGKD----EKALTGLPAAPLISFVQWSPDGTKIAF------THS  145

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPKK  944
             + S++ +++ADV T  A+ +     V LNA     + WV+DS +L+V TI   RG  P  
Sbjct  146   TDSRIDLYIADVATAAAQKV---GAVALNATLGAPYYWVSDSKSLVVKTIAAGRGPAPAI  202

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
               VP+GP  Q N      Q  T+QD
Sbjct  203   SAVPAGPTTQENVGGKRGQAPTYQD  227



>ref|WP_035787784.1| aminoacyl peptidase [Janthinobacterium sp. CG3]
Length=818

 Score =   110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 115/211 (55%), Gaps = 10/211 (5%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A  + Y+ PP  ++ IVDAP  PALS SP R+    ++  +LP +S++A+PE+KLAG+RI
Sbjct  23    AQSSGYQAPPAALQAIVDAPRAPALSLSPLRNLAAMVQTPALPGISEVAQPELKLAGVRI  82

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
             + +  S+SR SF +G+G    L D     E  + GLP   ++  ++WS +  +LAFS   
Sbjct  83    NPRTYSQSRFSFGSGLG----LLDIDTQKEIALKGLPRDLRVADLSWSPDQRHLAFSHIN  138

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDS-TLLVCTIPLSRG  929
               +      + +W+ D+   +AR L       L+A++   F W+ D  +LL+   P   G
Sbjct  139   LADTAKGGGVELWLVDIAARSARKLSAQA---LSAVYGRGFTWMPDGKSLLIKLKPAKLG  195

Query  930   DPPKKPLVPSGPKVQSNE-QKSIIQVRTFQD  1019
               P+   VP GP +Q ++      QVRT+ D
Sbjct  196   KAPQASGVPGGPSLQDSQPGGGQKQVRTYPD  226



>ref|WP_024957292.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   110 bits (276),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 109/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPTLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>gb|AIL06870.1| X-Pro dipeptidyl-peptidase family protein [Stenotrophomonas maltophilia]
Length=836

 Score =   110 bits (275),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 109/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  41    NGYELPSAALQAVVDAPRAPTLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  100

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  101   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  156

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  157   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  209

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  210   ADGIPTGPAVQQTSQGGGVVSIRTYQD  236



>ref|WP_019661088.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   110 bits (275),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/207 (34%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPP  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>ref|WP_026334910.1| aminoacyl peptidase [Oxalobacteraceae bacterium AB_14]
Length=819

 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 112/205 (55%), Gaps = 10/205 (5%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP  + DIVDAP  PALS SPQR+ +  ++   LP ++++A+PE+KLAG+RI+ +  
Sbjct  28    YRLPPSALLDIVDAPRAPALSLSPQRNLVAVVQTPPLPGIAEVAQPELKLAGLRINPRTC  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF T +     L D     E  I GLP   ++  + WS +  YLAFS    + E 
Sbjct  88    SSSRFSFGTDLA----LLDIATQKESRIRGLPRALRLADLAWSPDQRYLAFSHVAYKGER  143

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
              + +L  W+ D+    A+ L  S       +   F W+ DS+ LL    P   G  P+  
Sbjct  144   GAVEL--WLVDIAARKAKRL--SAQPLSAVLTRGFNWLPDSSGLLAHWRPAGIGKAPQSD  199

Query  948   LVPSGPKVQSNE-QKSIIQVRTFQD  1019
              +PSGP  Q +E   ++ Q+RT+QD
Sbjct  200   GIPSGPIQQDSEPGGAVRQLRTYQD  224



>ref|WP_033830372.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
 gb|EVT71224.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia 5BA-I-2]
Length=838

 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/205 (35%), Positives = 108/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ K  
Sbjct  45    YELPSAALQAVVDAPRAPSLFLSPRRDVAALMQMPSLPSIQVVAQPELKLAGLRINPKTF  104

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF   + +  + +    G E+ I GLP    I  +TWS +  +LAF+        
Sbjct  105   SDSRFSFGQKLWLMNVAD----GKERQISGLPASLSIASLTWSPDQKWLAFNQVDAATGA  160

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
             +     +W+ DV  G+AR L    +  L      + W+ DS  L+V T P + G  P   
Sbjct  161   N----ELWLVDVAGGSARRLVAGLNTVLGT---GYQWLPDSRGLVVFTRPGNLGAAPAAD  213

Query  948   LVPSGPKVQSNEQ-KSIIQVRTFQD  1019
              +P+GP VQ   Q   ++ +RT+QD
Sbjct  214   GIPTGPAVQQTSQGGGVVSIRTYQD  238



>gb|ABZ10203.1| hypothetical protein ALOHA_HF4000APKG10H12ctg3g18 [uncultured 
marine microorganism HF4000_APKG10H12]
Length=812

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 110/205 (54%), Gaps = 17/205 (8%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y  PPPEI DI+DAPP+P +  SP+ D +  L R ++P +++LA+P ++LAG R++ + N
Sbjct  35    YLTPPPEIVDILDAPPIPQVVVSPRGDTVALLSRPAMPSIAELAQPMLRLAGYRLNPRTN  94

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
                R +     GI ++   G     +     P    +  V +S +G  L F         
Sbjct  95    GPQRPA-----GITRITLTGISDGAEHAFDAPRETSLGRVEFSPDGSRLIF------TLT  143

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIF-DNFVWVNDSTLLVCTIPLS-RGDPPKK  944
               + + VW+ +V TG ARPL   +D  +NA + D   W+N++  ++CT   S RG PP  
Sbjct  144   RYNGIEVWLMEVATGDARPL---SDASINAAWGDPCDWLNENATVICTFKASARGAPPGA  200

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
             P VP+GP +Q +   +   +RT+QD
Sbjct  201   PDVPAGPNIQEHSGGA-APIRTYQD  224



>ref|WP_019101413.1| hypothetical protein [Chromobacterium sp. C-61]
Length=814

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 105/204 (51%), Gaps = 15/204 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y++PP E++ +VDAP  P  S  P+R  +L + R  LP ++D+A+PE+KLAG+R++    
Sbjct  30    YQIPPAELQALVDAPRPPLQSLGPKRRNLLQIHRPGLPGIADVAQPELKLAGLRLNPSMR  89

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR  F   +     L D   G  + + GLP  A+I    WS +   +AF         
Sbjct  90    AASRFDFGNAL----TLLDVKQGRARTVRGLPAGARIADTAWSADESRVAF------SLW  139

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLN-AIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
                 + +W+ DV    AR L    D +LN A    F W  +  LL+  +P  +G  P++P
Sbjct  140   GVKGVELWLLDVADARARRL---GDFHLNAATGSGFAWFGEQ-LLIKRVPAKQGPAPQQP  195

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
               PSGP +Q +E   + Q RT+ D
Sbjct  196   QAPSGPNIQQSEGGILSQTRTYPD  219



>ref|WP_044129974.1| aminoacyl peptidase [Rudanella lutea]
Length=839

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 116/210 (55%), Gaps = 20/210 (10%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQR-----DKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             Y+ PP  + D+V  PP P +S S +      D +L L+R + P +++L++PE++LAG+R+
Sbjct  32    YQTPPKALADLVTVPPTPGVSVSGKSERRPDDYLLILERAANPTIAELSQPELRLAGLRL  91

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
             +   N  SR ++ T + + +L      G E  I GLP  A+++ V WS +   +AF    
Sbjct  92    NPAINGPSRATYLTNLKLKKL----PAGTETAIAGLPSPAQLSNVQWSPDETKIAF----  143

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRG  929
                 ++ +++ ++VADV T TAR   +  D+ LN +  + + WV+DS +L+V  IP  RG
Sbjct  144   --VNSTDNRMELYVADVATATAR---RVADIALNGVLGSPYQWVSDSRSLIVKAIPTGRG  198

Query  930   DPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
               P+   VP GP  Q N      Q  T+QD
Sbjct  199   AAPEVSRVPVGPTTQENVGGRRGQAPTYQD  228



>ref|WP_004144050.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 gb|ACF50332.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Stenotrophomonas maltophilia R551-3]
 emb|CCP14750.1| hypothetical protein SMRA8_0836 [Stenotrophomonas maltophilia 
RA8]
Length=840

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 109/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +  
Sbjct  47    YELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPRTF  106

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+        
Sbjct  107   SDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAASGA  162

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
             +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P   
Sbjct  163   N----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPAAD  215

Query  948   LVPSGPKVQSNEQ-KSIIQVRTFQD  1019
              +P+GP VQ   Q   ++ +RT+QD
Sbjct  216   GIPTGPAVQQTSQGGGVVSIRTYQD  240



>ref|WP_032953936.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 109/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP    I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPATLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGPAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                VP+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGVPTGPAVQQTSQGGGVVSIRTYQD  238



>gb|EMI51368.1| hypothetical protein C405_01692 [Stenotrophomonas maltophilia 
AU12-09]
Length=836

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 109/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  41    NGYELPSAALQAVVDAPRAPSLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  100

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP    I  V WS +  +LAF+      
Sbjct  101   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPATLSIASVMWSPDQKWLAFNQVDAAS  156

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  157   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGPAPA  209

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                VP+GP VQ   Q   ++ +RT+QD
Sbjct  210   ADGVPTGPAVQQTSQGGGVVSIRTYQD  236



>ref|WP_035074703.1| aminoacyl peptidase [Anditalea andensis]
 gb|KEO73124.1| aminoacyl peptidase [Anditalea andensis]
Length=810

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 108/209 (52%), Gaps = 15/209 (7%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A  N Y+ PP +I ++V+AP  P +SFS + D +L + R     + DLA+ E+++AGIRI
Sbjct  28    AQDNTYQKPPSQIEELVNAPITPIVSFSNRGDFMLMMVRSGHGSIEDLAQEELRIAGIRI  87

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
             +   N  SR      I I  L     +     IHGLPE  K+  +T S +  YLAF+   
Sbjct  88    NPATNGPSRSGSIEKIKIKSLQSGEVID----IHGLPENPKLGSMTLSEDEQYLAFTHTS  143

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTIPLSRGD  932
             +        +++W+AD+ TG AR L   T+  LN ++  +  W+ D+ +L+  +   RG 
Sbjct  144   DAG------ISLWLADIRTGQARRL---TEDILNQVYGTSLEWLPDNRILIKAVNPERGS  194

Query  933   PPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
              P+ P  P GP +Q          RT+QD
Sbjct  195   KPEAPKAPKGPNIQET-MGDAAPSRTYQD  222



>ref|WP_042613666.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
 gb|KIP86290.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=831

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 108/208 (52%), Gaps = 19/208 (9%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y LP   ++ +VD P  P L  SPQRD    L+   LP +  +A+PE+KLAG RI+ +  
Sbjct  43    YELPSAALQAVVDQPRAPGLFLSPQRDLAAMLQMPPLPSIEVVAQPELKLAGRRINPRTF  102

Query  591   SRSRMSFYTGI---GIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrvee  761
             S SR S+ T +   GIH        G E+ I GLP    +  + WS +  +LAF+     
Sbjct  103   SDSRFSYGTKLWLMGIHD-------GKERQIRGLPPALSVASLAWSPDQKWLAFNQVDPA  155

Query  762   eensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPP  938
                +     +W+ DV   +AR L    +  L    D + W+ DS  LLV + P + G PP
Sbjct  156   SGAN----ELWLVDVANASARRLRGELNTVLG---DGYQWLPDSRGLLVMSRPGNAGSPP  208

Query  939   KKPLVPSGPKV-QSNEQKSIIQVRTFQD  1019
              + + P+GP V Q++E   ++ +RT+QD
Sbjct  209   SRDVAPTGPAVQQTSEGSGVVSIRTYQD  236



>ref|WP_011135850.1| hypothetical protein [Chromobacterium violaceum]
 gb|AAQ59975.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 
12472]
Length=814

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 106/204 (52%), Gaps = 15/204 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PPPE+  +VDAP  P  S +PQ D +L   R  LP ++D+A+PE+KLAG+R++ +  
Sbjct  27    YQTPPPELAALVDAPRTPLQSLNPQGDAVLQTHRPGLPAIADVAQPELKLAGLRLNPRMR  86

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR  F + +     L D   G  + + GLP R +I    WS +G  +A          
Sbjct  87    AASRFDFGSAL----TLLDVKSGKSRPVTGLPARPRIADNAWSPDGKQVAL------SLW  136

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDSTLLVCTIPLSRGDPPKKP  947
                 + +W+ D  +   R L    D +LNA     F W+  + LLV  +P  +G  P+KP
Sbjct  137   GDRGVELWLLDAASARVRRL---GDFHLNASSGRGFAWMG-AQLLVKLLPAGQGPAPEKP  192

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
               P+GP +Q +   ++ Q RT+ D
Sbjct  193   STPTGPNIQQSAGGALSQTRTYPD  216



>ref|WP_043641829.1| aminoacyl peptidase [Chromobacterium haemolyticum]
Length=814

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 104/204 (51%), Gaps = 15/204 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP E++ +VDAP  P  S  P+R  +L + R  LP ++D+A+PE+KLAG+R++    
Sbjct  30    YQTPPAELQALVDAPRPPLQSLGPKRRNLLQIHRPGLPGIADVAQPELKLAGLRLNPSMR  89

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR  F    G    L D   G  + + GLP  A+I    WS +   +AF         
Sbjct  90    AASRFDF----GNTLTLLDVKQGRARTVRGLPAGARIADTAWSADESRVAF------SLW  139

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLN-AIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
                 + +W+ DV    AR L    D +LN A    F W  +  LL+  +P  +G  P++P
Sbjct  140   GVKGVELWLLDVADARARRL---GDFHLNAATGSGFAWFGEQ-LLIKRVPAKQGPAPQQP  195

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
               PSGP +Q +E   + Q RT+ D
Sbjct  196   QAPSGPNIQQSEGGILSQTRTYPD  219



>ref|WP_014645961.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 emb|CCH11250.1| Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Stenotrophomonas 
maltophilia D457]
Length=838

 Score =   108 bits (269),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 110/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLHLSPRRDMAALMQMPSLPSIRVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP    I  + WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPATLSIASLMWSPDQKWLAFNQVDATS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV +G+AR L    +  + +    + W+ DS  L+V T P + G  P 
Sbjct  159   GAN----ELWLVDVASGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPANLGAAPA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   +   ++ +RT+QD
Sbjct  212   TDGIPTGPAVQQTRRGDGVVSIRTYQD  238



>ref|WP_041258970.1| aminoacyl peptidase [Fibrella aestuarina]
Length=830

 Score =   108 bits (269),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 115/205 (56%), Gaps = 15/205 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  + D+V  P  P++S S +   +L L++ S P +++LA+PE+KLAG+R++   N
Sbjct  37    YQTPPKALADLVTVPLTPSVSVSDKGSMMLILEQASAPGIAELAQPELKLAGLRLNPANN  96

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SRM + TG+ + +L    T   E  + GLP +  I++  WS +   +AF        +
Sbjct  97    GPSRMRYVTGLKLKKL----TAQTEVAVTGLPAQPLISYTQWSPDETKIAF------ANS  146

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPKK  944
             + S++ ++V DV T  A  +    +V LNA   + F W++DS +L+V  IP  RG  P+ 
Sbjct  147   TDSRIELYVVDVATAAATKV---GNVALNATMGSPFRWLSDSKSLIVKAIPAGRGAAPEV  203

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
               VP+GP +Q+N      Q  T+QD
Sbjct  204   SRVPAGPTIQANIGGKRGQAPTYQD  228



>emb|CCH00873.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Fibrella aestuarina BUZ 2]
Length=832

 Score =   108 bits (269),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 115/205 (56%), Gaps = 15/205 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  + D+V  P  P++S S +   +L L++ S P +++LA+PE+KLAG+R++   N
Sbjct  39    YQTPPKALADLVTVPLTPSVSVSDKGSMMLILEQASAPGIAELAQPELKLAGLRLNPANN  98

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
               SRM + TG+ + +L    T   E  + GLP +  I++  WS +   +AF        +
Sbjct  99    GPSRMRYVTGLKLKKL----TAQTEVAVTGLPAQPLISYTQWSPDETKIAF------ANS  148

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDS-TLLVCTIPLSRGDPPKK  944
             + S++ ++V DV T  A  +    +V LNA   + F W++DS +L+V  IP  RG  P+ 
Sbjct  149   TDSRIELYVVDVATAAATKV---GNVALNATMGSPFRWLSDSKSLIVKAIPAGRGAAPEV  205

Query  945   PLVPSGPKVQSNEQKSIIQVRTFQD  1019
               VP+GP +Q+N      Q  T+QD
Sbjct  206   SRVPAGPTIQANIGGKRGQAPTYQD  230



>gb|KIE09620.1| peptidase S9, partial [Tolypothrix bouteillei VB521301]
Length=470

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 103/191 (54%), Gaps = 14/191 (7%)
 Frame = +3

Query  411  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
            ++ PP  I  I++AP  P +  SP R  ++ L++ SL  ++  A PE+ LAG+ ++ K N
Sbjct  11   WQSPPEPIAQILNAPSPPTILLSPNRQWMVELEKPSLQAIAHYAEPEIPLAGLLLNPKTN  70

Query  591  SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
            + SR+SFY  + I  +    + G       LP   +I +V WS N   LAF         
Sbjct  71   TLSRLSFYQNLKIRAV----SAGEGDRTVALPNSPQIGYVKWSPNSQKLAF------TLT  120

Query  771  sssKLTVWVADVETGTARPLFQSTDVYLNAIF-DNFVWVNDSTLLVCTIPLSRGDPPKKP  947
              + L +WV DV++ TA+ L + T   LNA + + + W++D  L+   IP  RG+PP KP
Sbjct  121  QDTGLELWVVDVDSLTAQKLTEPT---LNAAYGEPYRWLSDEALICKFIPSHRGEPPAKP  177

Query  948  LVPSGPKVQSN  980
             +P GP +Q N
Sbjct  178  NIPLGPIIQEN  188



>ref|WP_017165787.1| hypothetical protein, partial [Xanthomonas axonopodis]
Length=327

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 110/210 (52%), Gaps = 13/210 (6%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  31    APGSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRI  90

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
               K  + SR +F + + +  + +    G E+ I GLP    +  ++WS +  YLAF    
Sbjct  91    HPKTFAASRFAFASKLWLLSVAD----GSERQIAGLPSPLSLADLSWSPDQRYLAFRRED  146

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVND-STLLVCTIPLSRGD  932
                  +     +W+ DV  G AR L    +  +N   D+  W+ D S LL+      +G 
Sbjct  147   AASGAN----ELWLVDVAAGQARRLVAGLNTSVN---DDLRWLPDGSGLLLQQQVAGQGA  199

Query  933   PPKKPLVPSGPKVQSNEQKSIIQ-VRTFQD  1019
             PP +   P+GP  Q     + ++ + T+QD
Sbjct  200   PPTRDATPTGPATQQTSAAAGVRSLPTYQD  229



>ref|WP_043593618.1| aminoacyl peptidase [Chromobacterium haemolyticum]
Length=814

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/204 (33%), Positives = 104/204 (51%), Gaps = 15/204 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP E++ +VDAP  P  S  P+R  +L + R  LP ++D+A+PE+KLAG+R++    
Sbjct  30    YQTPPAELQALVDAPRPPLQSLGPKRRTLLQIHRPGLPGIADVAQPELKLAGLRLNPSMR  89

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR  F   +     L D   G  + + GLP  A+I    W+ +   +AF         
Sbjct  90    AASRFDFGNAL----TLLDVKQGRARTVRGLPAGARIADTAWAADESRVAF------SLW  139

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLN-AIFDNFVWVNDSTLLVCTIPLSRGDPPKKP  947
                 + +W+ DV    AR L    D +LN A    F W  +  LL+  +P  +G  P++P
Sbjct  140   GVKGVELWLLDVADARARRL---GDFHLNAATGSGFAWFGEQ-LLIKRVPAKQGPAPRQP  195

Query  948   LVPSGPKVQSNEQKSIIQVRTFQD  1019
               PSGP +Q +E   + Q RT+ D
Sbjct  196   QAPSGPNIQQSEGGILSQTRTYPD  219



>ref|WP_042821301.1| aminoacyl peptidase [Xanthomonas axonopodis]
 gb|KGE53248.1| aminoacyl peptidase [Xanthomonas axonopodis pv. vasculorum]
Length=828

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 111/210 (53%), Gaps = 13/210 (6%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A G+ Y+LP P ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  31    AAGSGYQLPSPALQAVVDAPRAPLLQLSPKRDLAAMLQMPALPDIAEVAQPELKLAGLRI  90

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
               K  + SR SF + + +  + +    G E+ I GLP    +  ++WS +  YLAF    
Sbjct  91    HPKTFAASRFSFASKLWLLSVAD----GSERQIAGLPSPLSLADLSWSPDQRYLAFRRED  146

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVND-STLLVCTIPLSRGD  932
                  +     +W+ DV  G AR L    +  +N   D+  W+ D S LL+      +G 
Sbjct  147   AASGAN----ELWLVDVAAGQARRLVAGLNTSVN---DDLRWLPDGSGLLLQQQVAGQGA  199

Query  933   PPKKPLVPSGPKVQSNEQKSIIQ-VRTFQD  1019
             PP +   P+GP  Q     + ++ + T+QD
Sbjct  200   PPTRDATPTGPATQQTSAAAGVRSLPTYQD  229



>ref|WP_019595958.1| glutamyl peptidase [Rhodonellum psychrophilum]
 gb|ERM83448.1| glutamyl peptidase [Rhodonellum psychrophilum GCM71 = DSM 17998]
Length=810

 Score =   107 bits (267),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 111/207 (54%), Gaps = 16/207 (8%)
 Frame = +3

Query  402   GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  581
             GN Y+ PP  I D+V+AP  P++SFS   D +L L+R   P + +L++PE+++AG+RI+ 
Sbjct  32    GN-YKTPPKAIADLVNAPVTPSVSFSRMGDFMLILERSGNPSIEELSQPELRIAGVRINP  90

Query  582   KCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrvee  761
               NS SR   Y  I I +L E      EK I GLP+  K++  + S +  ++ F+     
Sbjct  91    ATNSPSRGITYESIKIKKLKE----ASEKEISGLPQNPKMSGFSLSKDEKHMVFTNASNT  146

Query  762   eensssKLTVWVADVETGTARPLFQSTDVYLN-AIFDNFVWVNDSTLLVCTIPLSRGDPP  938
                    +++W+ D+ T  A+ L   TD  +N A     VW  D+ +L+  I   RG  P
Sbjct  147   G------ISLWLVDLTTFQAKKL---TDEIVNLANGGAVVWTPDNRILLKAIHPKRGQMP  197

Query  939   KKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             K PL PSGP +Q     +    RT+QD
Sbjct  198   KTPLAPSGPNMQETAGNAAPS-RTYQD  223



>ref|WP_032129696.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
 gb|KGM22636.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score =   107 bits (267),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 109/207 (53%), Gaps = 13/207 (6%)
 Frame = +3

Query  405   NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  584
             N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43    NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  585   CNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               S SR SF   + +  + +    G E+ I GLP +  I  V WS +  +LAF+      
Sbjct  103   TFSDSRFSFGEKLWLMNVAD----GKERQISGLPAKLSIASVMWSPDQKWLAFNQVDAAS  158

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPK  941
               +     +W+ DV  G+AR L    +  + +    + W+ DS  L+V T P + G    
Sbjct  159   GAN----ELWLVDVAGGSARRLVAGLNTVIGS---GYQWLPDSRGLVVFTRPSNLGAALA  211

Query  942   KPLVPSGPKVQSNEQ-KSIIQVRTFQD  1019
                +P+GP VQ   Q   ++ +RT+QD
Sbjct  212   ADGIPTGPAVQQTSQGGGVVSIRTYQD  238



>ref|WP_040016621.1| aminoacyl peptidase, partial [Xanthomonas axonopodis]
 gb|KHF50397.1| aminoacyl peptidase, partial [Xanthomonas axonopodis pv. phaseoli]
Length=295

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 111/210 (53%), Gaps = 13/210 (6%)
 Frame = +3

Query  396   ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  575
             A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  47    APGSGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRI  106

Query  576   DGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrv  755
               K  + SR SF + + +  + +    G E+ I GLP    +  ++WS +  +LAF    
Sbjct  107   HPKTFAASRFSFASKLWLLSVAD----GSERQIAGLPSPLSLADLSWSPDQRHLAFRRED  162

Query  756   eeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVND-STLLVCTIPLSRGD  932
                  +     +W+ DV TG AR L    +  +N   D+  W+ D S LL+      +G 
Sbjct  163   AASGAN----ELWLVDVATGQARRLVAGLNTSVN---DDLRWLPDGSGLLLQQQVAGQGA  215

Query  933   PPKKPLVPSGPKVQSNEQKSIIQ-VRTFQD  1019
             PP +   P+GP  Q     + ++ + T+QD
Sbjct  216   PPTRDATPTGPATQQTSAAAGVRSLPTYQD  245



>ref|WP_017355273.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
Length=841

 Score =   107 bits (267),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 111/211 (53%), Gaps = 14/211 (7%)
 Frame = +3

Query  396   ALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIR  572
             A G Q Y LP   ++ +VDAP  P LS SP+RD    L+   LP +S +A+PE+KLAG+R
Sbjct  44    AKGEQGYELPSAALQAVVDAPRAPTLSLSPRRDIAAMLQTPPLPSISVVAQPELKLAGLR  103

Query  573   IDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvr  752
             I+   +S SR SF   + +  + +    G E+ I GLP+   I  + WS +  YLAF+  
Sbjct  104   INPATHSSSRFSFGDKLWLLNVAD----GRERQISGLPQPLSIATLAWSPDQKYLAFNQV  159

Query  753   veeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRG  929
                   +     +W+ DV  G+AR L    +  +    D + W+ DS  LLV      +G
Sbjct  160   HAPTGAN----ELWIVDVAAGSARRLLADLNTVMG---DGYSWLPDSRGLLVMQQLKGQG  212

Query  930   DPPKKPLVPSGPKVQSNEQKSIIQ-VRTFQD  1019
               P    +P+GP +Q  +  + ++ +RT+QD
Sbjct  213   PAPAAGGIPTGPAIQQTDADAGVRSIRTYQD  243



>ref|WP_036107173.1| aminoacyl peptidase [Lysobacter capsici]
Length=820

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 112/205 (55%), Gaps = 14/205 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP  ++ IVDAP  P +  SP+RD++  ++  SLP ++ +A+PE+KLAG+RI  +  
Sbjct  21    YQLPPKPLQAIVDAPRPPQMFLSPRRDRVALVQTPSLPGIAVVAQPELKLAGLRIHPRVR  80

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             ++SR SF + +    LL+ GT G    I GLP    +  + WS +  ++AF+        
Sbjct  81    AQSRFSFGSQLS---LLDTGT-GKNIEIEGLPSPLSLATLQWSPDQRWIAFNRIDTASAA  136

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
             +     +W+ ++ET  AR L       LN +   + W+ DS  LLV   P  +G+ P   
Sbjct  137   N----ELWLIELETRHARKLVSG----LNTVGAGYQWMPDSRRLLVQLQPEGQGEAPPSD  188

Query  948   LVPSGPKVQSNEQKSII-QVRTFQD  1019
               P+GP  Q  +  + + Q+RT+QD
Sbjct  189   ATPTGPAAQETQASATVRQIRTYQD  213



>emb|CEM59493.1| exported peptide hydrolase [Xanthomonas campestris pv. campestris]
Length=835

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K +
Sbjct  43    YQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTH  102

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR SF + + +  + +    G E+ I GLP    +  + WS +   LAF         
Sbjct  103   AASRFSFASKLWLLSVAD----GSERQIAGLPAPLSLADLAWSPDQRSLAFRREDAASGA  158

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
             +     +WV DV  G AR L    +  +N   D   W+ DS+ LLV      +  PP + 
Sbjct  159   N----ELWVVDVAAGQARRLLADVNTSIN---DELHWLPDSSGLLVQQQLRDQAAPPARD  211

Query  948   LVPSGPKVQSNEQKSIIQ-VRTFQD  1019
              VP+GP +Q     + ++ +RT+QD
Sbjct  212   AVPAGPAIQQTSADAGVRAIRTYQD  236



>gb|EYR68524.1| glutamyl peptidase [Lysobacter capsici AZ78]
Length=856

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 112/205 (55%), Gaps = 14/205 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LPP  ++ IVDAP  P +  SP+RD++  ++  SLP ++ +A+PE+KLAG+RI  +  
Sbjct  57    YQLPPKPLQAIVDAPRPPQMFLSPRRDRVALVQTPSLPGIAVVAQPELKLAGLRIHPRVR  116

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             ++SR SF + +    LL+ GT G    I GLP    +  + WS +  ++AF+        
Sbjct  117   AQSRFSFGSQLS---LLDTGT-GKNIEIEGLPSPLSLATLQWSPDQRWIAFNRIDTASAA  172

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDS-TLLVCTIPLSRGDPPKKP  947
             +     +W+ ++ET  AR L       LN +   + W+ DS  LLV   P  +G+ P   
Sbjct  173   N----ELWLIELETRHARKLVSG----LNTVGAGYQWMPDSRRLLVQLQPEGQGEAPPSD  224

Query  948   LVPSGPKVQSNEQKSII-QVRTFQD  1019
               P+GP  Q  +  + + Q+RT+QD
Sbjct  225   ATPTGPAAQETQASATVRQIRTYQD  249



>gb|AEL05845.1| hypothetical protein XCR_0928 [Xanthomonas campestris pv. raphani 
756C]
Length=820

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K +
Sbjct  28    YQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTH  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR SF + + +  + +    G E+ I GLP    +  + WS +   LAF         
Sbjct  88    AASRFSFASKLWLLSVAD----GSERQIAGLPAPLSLADLAWSPDQRSLAFRREDAASGA  143

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
             +     +WV DV  G AR L    +  +N   D   W+ DS+ LLV      +  PP + 
Sbjct  144   N----ELWVVDVAAGQARRLLADVNTSIN---DELHWLPDSSGLLVQQQLRDQAAPPARD  196

Query  948   LVPSGPKVQSNEQKSIIQ-VRTFQD  1019
              VP+GP +Q     + ++ +RT+QD
Sbjct  197   AVPAGPAIQQTSADAGVRAIRTYQD  221



>ref|WP_043921614.1| aminoacyl peptidase [Xanthomonas campestris]
Length=835

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K +
Sbjct  43    YQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTH  102

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR SF + + +  + +    G E+ I GLP    +  + WS +   LAF         
Sbjct  103   AASRFSFASKLWLLSVAD----GSERQIAGLPAPLSLADLAWSPDQRSLAFRREDAASGA  158

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
             +     +WV DV  G AR L    +  +N   D   W+ DS+ LLV      +  PP + 
Sbjct  159   N----ELWVVDVAAGQARRLLADVNTSIN---DELHWLPDSSGLLVQQQLRDQAAPPARD  211

Query  948   LVPSGPKVQSNEQKSIIQ-VRTFQD  1019
              VP+GP +Q     + ++ +RT+QD
Sbjct  212   AVPAGPAIQQTSADAGVRAIRTYQD  236



>ref|WP_042596862.1| aminoacyl peptidase [Xanthomonas campestris]
 gb|KIQ26170.1| aminoacyl peptidase [Xanthomonas campestris]
Length=835

 Score =   106 bits (264),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K +
Sbjct  43    YQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTH  102

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR SF + + +  + +    G E+ I GLP    +  + WS +   LAF         
Sbjct  103   AASRFSFASKLWLLSVAD----GSERQIAGLPAPLSLADLAWSPDQRSLAFRREDAASGA  158

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
             +     +WV DV  G AR L    +  +N   D   W+ DS+ LLV      +  PP + 
Sbjct  159   N----ELWVVDVAAGQARRLLADVNTSIN---DELHWLPDSSGLLVQQQLRDQAAPPARD  211

Query  948   LVPSGPKVQSNEQKSIIQ-VRTFQD  1019
              VP+GP +Q     + ++ +RT+QD
Sbjct  212   AVPAGPAIQQTSADAGVRAIRTYQD  236



>ref|WP_012439199.1| peptide hydrolase [Xanthomonas campestris]
 emb|CAP52966.1| exported peptide hydrolase [Xanthomonas campestris pv. campestris]
Length=835

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K +
Sbjct  43    YQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTH  102

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR SF + + +  + +    G E+ I GLP    +  + WS +   LAF         
Sbjct  103   ATSRFSFASKLWLLSVAD----GSERQIAGLPAPLSLADLAWSPDQRSLAFRREDAASGA  158

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
             +     +WV DV  G AR L    +  +N   D   W+ DS+ LLV      +  PP + 
Sbjct  159   N----ELWVVDVAAGQARRLLADVNTSIN---DELHWLPDSSGLLVQQQLRDQAAPPARD  211

Query  948   LVPSGPKVQSNEQKSIIQ-VRTFQD  1019
              VP+GP +Q     + ++ +RT+QD
Sbjct  212   AVPAGPAIQQTSADAGVRAIRTYQD  236



>ref|WP_035322400.1| aminoacyl peptidase [Dyella japonica]
Length=825

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 112/206 (54%), Gaps = 14/206 (7%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP  ++ +VDAP  P LS SP RD +  ++  +LP +  +A+PE+KLAG+RI+ +  
Sbjct  40    YRLPPAPLQALVDAPRPPQLSISPHRDLLALIQSPALPGIDVVAQPELKLAGLRINPRTY  99

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             ++S+ SF T +     L+D   G E  + GLP    I   +WS +  YLAF     + + 
Sbjct  100   AQSKFSFGTDL----WLQDVASGKELRLQGLPAPLSIATTSWSPDQRYLAF----NQVDA  151

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDST-LLVCTIPLSRGDPPKK  944
              S +  +WV DV   +AR L   T + LN +    + W++DS  LLV   P  +GD P  
Sbjct  152   KSGRNELWVVDVAARSARRL---TGMPLNTVAGRGYRWLSDSQRLLVQLRPEGQGDAPAG  208

Query  945   PLVPSGPKVQSNEQKSIIQVR-TFQD  1019
               +P+GP  Q  +    ++   T+QD
Sbjct  209   GGIPTGPNAQETKAGGGVKATPTYQD  234



>ref|WP_035727191.1| aminoacyl peptidase [Flexibacter elegans]
Length=794

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 113/207 (55%), Gaps = 20/207 (10%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+ PP  + D+ +AP  P +S   +  +++FL+R   P + +L++PE++LAG+RI+ + N
Sbjct  13    YQTPPQAMVDLANAPLTPLVSVDSKGARMVFLERSEAPTIEELSQPELRLAGLRINPQTN  72

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKL--IHGLPERAKINFVTWSNNGHYLAFsvrveee  764
               SR + + G+ +      GT+G  +   + GLP    I++V WS +   +AF       
Sbjct  73    GPSRATSFIGMSL------GTVGQRETSAVKGLPANVNISYVQWSPDERKVAF------A  120

Query  765   ensssKLTVWVADVETGTARPLFQSTDVYLNAIFDN-FVWVNDSTLLVCTIPL-SRGDPP  938
               +S  + +WV DV +  A+   +  ++ LNA+    F W+ D+  L+C + L SRG  P
Sbjct  121   NTTSQGIELWVLDVASAQAQ---RVGNLMLNAVLGAPFEWMPDNQQLICKLVLPSRGQAP  177

Query  939   KKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
             K+  VP GP +Q N  K     RT+QD
Sbjct  178   KRSSVPEGPVIQENIGKK-APARTYQD  203



>ref|WP_008628244.1| hypothetical protein [Mariniradius saccharolyticus]
 gb|EMS32898.1| hypothetical protein C943_00905 [Mariniradius saccharolyticus 
AK6]
Length=807

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 111/210 (53%), Gaps = 17/210 (8%)
 Frame = +3

Query  393   EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIR  572
             EAL  QY++PP EI D+V+AP  P +SFS   D ++ L+R   P + DLA+PE+++AG+R
Sbjct  26    EAL--QYQVPPKEIADLVNAPLTPLVSFSRSGDFMMLLERPGNPSIEDLAQPELRIAGLR  83

Query  573   IDGKCNSRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvr  752
             I+   +  SR   +  + I         G EK I GLP   ++   T S +  Y+A    
Sbjct  84    INPATSGPSRSGSFENVVIKMTRG----GQEKKITGLPANPRLGGFTLSKDEKYVAL---  136

Query  753   veeeensssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFV-WVNDSTLLVCTIPLSRG  929
                   + + +++WV D+ T  A+ L   TD  +N ++   + W  D+ +L+  +  +RG
Sbjct  137   ---TNTTPTGISLWVVDLTTLEAKKL---TDEIVNGVYGGAIAWTPDNKILLKAVNPNRG  190

Query  930   DPPKKPLVPSGPKVQSNEQKSIIQVRTFQD  1019
               PK P  PSGP VQ     +    RT+QD
Sbjct  191   SLPKAPTAPSGPTVQETSGNAAPS-RTYQD  219



>ref|WP_008444659.1| peptidase S9 prolyl oligopeptidase catalytic domain-containing 
protein [Janthinobacterium sp. HH01]
 gb|ELX12312.1| peptidase S9 prolyl oligopeptidase catalytic domain-containing 
protein [Janthinobacterium sp. HH01]
Length=819

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 115/206 (56%), Gaps = 12/206 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             YRLPP  + +IVDAP  PALS SPQR+    ++   LP ++++A+PE+KLAG+RI+ +  
Sbjct  28    YRLPPAALMEIVDAPRAPALSLSPQRNLAAVVQTPPLPGIAEVAQPELKLAGLRINPRTC  87

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             S SR +F T +G    L D     E  I GLP   ++  + WS +  YLAFS    + E 
Sbjct  88    SSSRFAFGTDLG----LLDIATQKESRIRGLPRALRLADLAWSPDQRYLAFSHVAYKGER  143

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFD-NFVWVNDST-LLVCTIPLSRGDPPKK  944
              + +L  W+ D+    AR   + +   L+A+    F W+ DS+ LLV   P   G  P  
Sbjct  144   GAVEL--WLVDI---AARKASRMSAQPLSAVLTRGFNWLPDSSGLLVHWRPSGIGKAPVS  198

Query  945   PLVPSGPKVQ-SNEQKSIIQVRTFQD  1019
               +P+GP  Q S+   ++ Q+RT+QD
Sbjct  199   DGIPTGPIQQDSDPGGALRQLRTYQD  224



>ref|WP_011270002.1| hypothetical protein [Xanthomonas campestris]
 gb|AAY50524.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris 
str. 8004]
Length=835

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 108/205 (53%), Gaps = 13/205 (6%)
 Frame = +3

Query  411   YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  590
             Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K +
Sbjct  43    YQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTH  102

Query  591   SRSRMSFYTGIGIHQLLEDGTLGPEKLIHGLPERAKINFVTWSNNGHYLAFsvrveeeen  770
             + SR SF + + +  + +    G E+ I GLP    +  + WS +   LAF         
Sbjct  103   AASRFSFASKLWLLSVAD----GSERQIAGLPAPLSLADLAWSPDQRSLAFRREDAASGA  158

Query  771   sssKLTVWVADVETGTARPLFQSTDVYLNAIFDNFVWVNDST-LLVCTIPLSRGDPPKKP  947
             +     +WV DV  G AR L    +  +N   D   W+ DS+ LLV      +  PP + 
Sbjct  159   N----ELWVVDVAAGQARRLLADVNTSIN---DELHWLPDSSGLLVQQQLRDQTAPPARD  211

Query  948   LVPSGPKVQSNEQKSIIQ-VRTFQD  1019
              VP+GP +Q     + ++ +RT+QD
Sbjct  212   AVPAGPAIQQTSADAGVRAIRTYQD  236



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2584178199290